WorldWideScience

Sample records for capped cds nanoparticles

  1. Sulfonsuccinate (AOT Capped Pure and Mn-Doped CdS Nanoparticles

    Directory of Open Access Journals (Sweden)

    D. Venkatesan

    2012-01-01

    Full Text Available CdS nanoparticles and thin films are well known for their excellent semiconducting properties. When transition metal ions are doped into the CdS, it exhibits magnetic properties in addition to semiconducting properties and they are termed as dilute magnetic semiconductors (DMSs. In this paper, we discuss the preparation of sodium bis(2-ethylhexyl sulfonsuccinate (AOT capped CdS nanoparticles and thin films doped with magnetic impurity Mn. Sodium bis(2-ethulexyl sulfonsuccinate (AOT, capping agent promotes the uniform formation of nanoparticles. Optical characterizations are made using the UV-Vis spectrometer, PL, and FTIR. XRD shows the hexagonal structure of the CdS. SEM images and EDS measurements were made for the thin films. EPR shows the clear hyperfine lines corresponding to Mn2+ ion in the CdS nanoparticles.

  2. Optical properties of hydrothermally synthesized TGA-capped CdS nanoparticles: controlling crystalline size and phase

    Science.gov (United States)

    Tavakoli Banizi, Zoha; Seifi, Majid

    2017-10-01

    TGA-capped CdS nanoparticles were obtained in the presence of thioglycolic acid (TGA) as capping agent via a facile hydrothermal method at relatively low temperature and over a short duration. As-synthesized TGA-capped CdS nanoparticles were characterized by x-ray diffraction, scanning electron microscopy, transmission electron microscopy, Fourier transform infrared spectra, photoluminescence spectroscopy, Ultraviolet-visible spectroscopy and energy-dispersive x-ray spectroscopy. The products had spherical shapes, although their crystalline size and phase was dependent on temperature and time of the reaction. Photoluminescence spectra showed that the fluorescence intensity decreased when increasing the reaction time and temperature.

  3. Microwave-assisted polyol synthesis and characterization of pvp-capped cds nanoparticles for the photocatalytic degradation of tartrazine

    Energy Technology Data Exchange (ETDEWEB)

    Darwish, Maher, E-mail: m-darwish@razi.tums.ac.ir [Department of Drug and Food Control, Faculty of Pharmacy, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Mohammadi, Ali, E-mail: alimohammadi@tums.ac.ir [Department of Drug and Food Control, Faculty of Pharmacy, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Nanotechnology Research Centre, Faculty of Pharmacy, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Assi, Navid, E-mail: navid_a30@yahoo.com [Department of Drug and Food Control, Faculty of Pharmacy, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of)

    2016-02-15

    Highlights: • PVP-stabilized CdS nanoparticles have been fabricated by a polyol-microwave method. • CdS nanoparticles were characterized and the size was approximately 48 ± 10 nm. • Catalytic activity of our nanoparticles was examined for tartrazine degradation. • Remarkable results were obtained under both UV and visible light irradiations. - Abstract: Polyvinylpyrrolidone capped cadmium sulfide nanoparticles have been successfully synthesized by a facile polyol method with ethylene glycol. Microwave irradiation and calcination were used to control the size and shape of nanoparticles. Characterization with scanning electron microscopy revealed a restricted nanoparticles growth comparing with the uncapped product, hexagonal phase and 48 nm average particle size were confirmed by X-ray diffraction, and finally mechanism of passivation was suggested depending on Fourier transform infrared spectra. The efficiency of nanoparticles was evaluated by the photocatalytic degradation of tartrazine in aqueous solution under UVC and visible light irradiation. Complete degradation of the dye was observed after 90 min of UVC irradiation under optimized conditions. Kinetic of reaction fitted well to the pseudo-first-order kinetic and Langmuir–Hinshelwood models. Furthermore, 85% degradation of the dye in 9 h under visible light suggests that cadmium sulfide is a promising tool to work under visible light for environmental remediation.

  4. Effect of acid or alkaline catalyst and of different capping agents on the optical properties of CdS nanoparticles incorporated within a diureasil hybrid matrix

    Science.gov (United States)

    Gonçalves, Luis F. F. F.; Silva, Carlos J. R.; Kanodarwala, Fehmida K.; Stride, John A.; Pereira, Mario R.

    2015-11-01

    CdS nanoparticles (NPs) were synthesized using colloidal methods and incorporated within a diureasil hybrid matrix. The surface capping of the CdS NPs by 3-mercaptopropyltrimethoxysilane (MPTMS) and 3-aminopropyltrimethoxysilane (APTMS) organic ligands during the incorporation of the NPs within the hybrid matrix has been investigated. The matrix is based on poly(ethylene oxide)/poly(propylene oxide) chains grafted to a siliceous skeleton through urea bonds and was produced by sol-gel process. Both alkaline and acidic catalysis of the sol-gel reaction were used to evaluate the effect of each organic ligand on the optical properties of the CdS NPs. The hybrid materials were characterized by absorption, steady-state and time-resolved photoluminescence spectroscopy and High Resolution Transmission Electron Microscopy (HR-TEM). The preservation of the optical properties of the CdS NPs within the diureasil hybrids was dependent on the experimental conditions used. Both organic ligands (APTMS and MPTMS) demonstrated to be crucial in avoiding the increase of size distribution and clustering of the NPs within the hybrid matrix. The use of organic ligands was also shown to influence the level of interaction between the hybrid host and the CdS NPs. The CdS NPs showed large Stokes shifts and long average lifetimes, both in colloidal solution and in the xerogels, due to the origin of the PL emission in surface states. The CdS NPs capped with MPTMS have lower PL lifetimes compared to the other xerogel samples but still larger than the CdS NPs in the original colloidal solution. An increase in PL lifetimes of the NPs after their incorporation within the hybrid matrix is related to interaction between the NPs and the hybrid host matrix.

  5. CdS nanoparticles capped with 1-substituted 5-thiotetrazoles: Synthesis, characterization, and thermolysis of the surfactant

    OpenAIRE

    Voitekhovich, Sergei V.; Talapin, Dmitri V.; Klinke, Christian; Kornowski, Andreas; Weller, Horst

    2013-01-01

    We propose a new type of surfactants, namely, tetrazole derivatives which can be controllably removed from the nanoparticle surface. Tetrazoles are a peculiar class of heterocyclic compounds. The presence of four nitrogen atoms in the tetrazole ring determines their interesting physical and chemical properties. Tetrazoles show high thermal stability below 200C while decomposing at higher temperature with formation of gaseous products and no or very little solid residue. Moreover, the tetrazol...

  6. [Spectroscopic study on CdS nanoparticles prepared by microwave irradiation].

    Science.gov (United States)

    Cheng, Wei-qing; Liu, Di; Yan, Zheng-yu

    2008-06-01

    CdS nanoparticles capped by mercaptoacetic acid have been successfully synthesized by microwave method employing thioacetamide as sulfur source, which was proved to be a simple, rapid and specific mothod compared with traditional synthetical methods, such as precipitation, sol-gel, solvo-thermal method and so on. The concrete procedure synthesizing CdS nanoparticles was as follows: Cd(NO3)2 (40 mL, 5 mmol c L(-1)) was titrated with mercaptoacetic acid to pH 2.0, resulting in a turbid blue solution. NaOH (0.1 mol x L(-1)) was then added dropwise until the pH was 7 and the solution was again colorless. While quickly stirring the solution, 40 mL of 5 mmol x L(-1) CH3CSNH2 was added. Subsequently, the solution was adjusted to pH 9.0 and placed in a microwave oven for 25 min with power 30% (it means that if microwave works in a 30 s regime, it works 6 s, and does not work 24 s. This is some kind of pulse regime, but the totalpower is still 100%). This kind of nanoparticles were water-soluble and symmetrical. The diameter of CdS nanoparticles which have a spherical morphology was determined to be 12 nm by transmission electron microscopy(TEM), which posess perfect uniforminty. According to literatures report, there are two kinds of emission peak: one is edge-emission peak, and the other is surface blemish emission. In contrast to edge-emission peak, the surface blemish emission shows red shift on fluorescence spectra. In the present paper, the prominent peak of CdS QDs fluorescence spectrum was located at 490 nm, the humpbacked peak caused by surface blemish of CdS nanoparticles was located at 565 nm. However, the surface blemish emission was unconspicuous, thus we can conclude that the synthetical CdS QDs possesses excellent luminescence capability and favorable structure. The size and absorption and fluorescence spectra of CdS nanoparticles at different microwave power, pH value, reaction time and different sulfur source were investigated. The result showed that the

  7. Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using ...

    African Journals Online (AJOL)

    Cell-associated biosynthesis of cadmium sulfide (CdS) nanoparticles has been reported to be rather slow and costly. In this study, we report on a rapid and low cost biosynthesis of CdS using culture supernatants of Escherichia coli ATCC 8739, Bacillus subtilis ATCC 6633 and Lactobacillus acidophilus DSMZ 20079T.

  8. Ecotoxicological studies of CdS nanoparticles on photosynthetic microorganisms.

    Science.gov (United States)

    Brayner, Roberta; Dahoumane, Si Amar; Nguyen, Julie Ngoc-Lan; Yéprémian, Claude; Djediat, Chakib; Couté, Alain; Fiévet, Fernand

    2011-03-01

    The potential ecotoxicity of nanosized cadmium sulfide (CdS), synthesized by the polyol process, was investigated using common Anabaena flos-aquae cyanobacteria and Euglena gracilis euglenoid microalgae. The photosynthetic activities of these microorganisms, after addition of free Cd2+ ions and CdS nanoparticles, varied with the presence of tri-n-octylphosphine oxide (TOPO) used to protect surface particle to avoid toxicity and also to control particle size and shape during the synthesis. The nanoparticle concentration was varied from 10(-3) to 5 x 10(-4) M. It was observed that the cadmium concentration, the addition of TOPO protective agent and the particle dissolution process in the culture medium play an important role during the ecotoxicological tests. Viability tests were followed by PAM fluorimetry. Cd2+ ions were very toxic for Anabaena flos aquae. The same behavior was observed after contact with CdS and CdS-TOPO nanoparticles. However, for Euglena gracilis, the photosynthetic activity was stable for more than 1 month in the presence of Cd2+ ions. Moreover, it was observed that the toxicity varies with the concentration of CdS and CdS-TOPO nanoparticles, both kind of nanoparticles are toxic for this microorganism. Transmission electron microscopy (TEM) analyses of microorganisms ultrathin sections showed that polysaccharides produced by Anabaena flos-aquae, after contact with CdS and CdS-TOPO nanoparticles, protect the microalgae against particle internalization. Only some particles were observed inside the cells. Moreover, the nanoparticle internalization was observed after contact with all nanoparticles in the presence of Euglena gracilis by endocytosis. All nanoparticles are inside vesicles formed by the cells.

  9. Simple and green synthesis of protein-conjugated CdS nanoparticles and spectroscopic study on the interaction between CdS and zein

    Science.gov (United States)

    Qin, Dezhi; Zhang, Li; Du, Xian; Wang, Yabo; Zhang, Qiuxia

    2016-09-01

    The present study demonstrates the role of zein molecules in synthesizing CdS nanoassemblies through protein-directed, green synthetic approach. Zein molecules can as capping ligand and stabilizing agent to regulate the nucleation and growth of CdS nanocrystals, and the obtained products are organic-inorganic nanocomposites. The analysis of surface charge and conductivity indicates that strong electrostatic force restricts mobility of ions, which creates a local supersaturation surrounding the binding sites of zein and reduces the activated energy of nucleation. The interaction between Cd2+/CdS and zein molecules was systematically investigated through spectroscopy techniques. Fourier transform infrared (FT-IR) spectra were used to envisage the binding of the functional groups of zein with the surface of CdS nanoparticles. Ultraviolet visible (UV-Vis) and photoluminescence (PL) spectra results show that Cd2+/CdS might interact with the aromatic amino acids of protein molecules and change its chemical microenvironment. The quantum-confined effect of nanocrystals is confirmed by optical absorption spectrum due to the small size (3-5 nm) of CdS particles. The data of circular dichroism (CD) spectra indicate that the formation of CdS nanocrystals could lead to the conformational change of zein molecules. Moreover, the possible mechanism of CdS nanocrystals growth in zein solution was also discussed. The weak interactions such as Van der Waals, hydrophobic forces and hydrogen bonds in zein molecules should play a crucial factor in the self-assembly of small nanoparticles.

  10. Simple and green synthesis of protein-conjugated CdS nanoparticles and spectroscopic study on the interaction between CdS and zein

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Dezhi, E-mail: dezhiqin@163.com; Zhang, Li; Du, Xian; Wang, Yabo; Zhang, Qiuxia [Pingdingshan University, College of Chemistry and Environmental Engineering (China)

    2016-09-15

    The present study demonstrates the role of zein molecules in synthesizing CdS nanoassemblies through protein-directed, green synthetic approach. Zein molecules can as capping ligand and stabilizing agent to regulate the nucleation and growth of CdS nanocrystals, and the obtained products are organic–inorganic nanocomposites. The analysis of surface charge and conductivity indicates that strong electrostatic force restricts mobility of ions, which creates a local supersaturation surrounding the binding sites of zein and reduces the activated energy of nucleation. The interaction between Cd{sup 2+}/CdS and zein molecules was systematically investigated through spectroscopy techniques. Fourier transform infrared (FT-IR) spectra were used to envisage the binding of the functional groups of zein with the surface of CdS nanoparticles. Ultraviolet visible (UV–Vis) and photoluminescence (PL) spectra results show that Cd{sup 2+}/CdS might interact with the aromatic amino acids of protein molecules and change its chemical microenvironment. The quantum-confined effect of nanocrystals is confirmed by optical absorption spectrum due to the small size (3–5 nm) of CdS particles. The data of circular dichroism (CD) spectra indicate that the formation of CdS nanocrystals could lead to the conformational change of zein molecules. Moreover, the possible mechanism of CdS nanocrystals growth in zein solution was also discussed. The weak interactions such as Van der Waals, hydrophobic forces and hydrogen bonds in zein molecules should play a crucial factor in the self-assembly of small nanoparticles.

  11. Characterization of chemically synthesized CdS nanoparticles

    Indian Academy of Sciences (India)

    Similar to the effects of charge carriers on optical properties, confinement of optical and acoustic phonons leads to interesting changes in the phonon spectra. In the present work, we have synthesized nanoparticles of CdS using chemical precipitation technique. The crystal structure and grain size of the particles are studied ...

  12. The toxic effects of l-Cysteine-capped cadmium sulfide nanoparticles on the aquatic plant Spirodela polyrrhiza

    Science.gov (United States)

    Khataee, Alireza; Movafeghi, Ali; Nazari, Fatemeh; Vafaei, Fatemeh; Dadpour, Mohammad Reza; Hanifehpour, Younes; Joo, Sang Woo

    2014-12-01

    Plants play an important role in the fate of nanoparticles in the environment through their uptake, bioaccumulation, and transfer to trophic chains. However, the impacts of nanoparticles on plants as essential components of all ecosystems are not well documented. In the present study, the toxic effects of l-Cysteine-capped CdS nanoparticles on Spirodela polyrrhiza as an aquatic higher plant species were studied. l-Cysteine-capped CdS nanoparticles were synthesized using hydrothermal method and their characteristics were determined by XRD, SEM, HR-TEM, and FT-IR techniques. The diameter of majority of synthesized nanoparticles was about 15-20 nm. Subsequently, the uptake of l-Cysteine-capped CdS nanoparticles by the plant species was confirmed using epifluorescence microscopy. The activity of peroxidase and superoxide dismutase as antioxidant enzymes was assayed and the relative frond number was calculated in the presence of different concentrations of l-Cysteine-capped CdS nanoparticles. The obtained results revealed the toxic effects of the synthesized nanoparticles on S. polyrrhiza, leading to growth reduction and significant changes in antioxidant enzymes' activity.

  13. The toxic effects of l-Cysteine-capped cadmium sulfide nanoparticles on the aquatic plant Spirodela polyrrhiza

    Energy Technology Data Exchange (ETDEWEB)

    Khataee, Alireza, E-mail: ar_khataee@yahoo.com [University of Tabriz, Research Laboratory of Advanced Water and Wastewater Treatment Processes, Department of Applied Chemistry, Faculty of Chemistry (Iran, Islamic Republic of); Movafeghi, Ali [University of Tabriz, Department of Plant Biology, Faculty of Natural Sciences (Iran, Islamic Republic of); Nazari, Fatemeh [University of Tabriz, Research Laboratory of Advanced Water and Wastewater Treatment Processes, Department of Applied Chemistry, Faculty of Chemistry (Iran, Islamic Republic of); Vafaei, Fatemeh [University of Tabriz, Department of Plant Biology, Faculty of Natural Sciences (Iran, Islamic Republic of); Dadpour, Mohammad Reza [University of Tabriz, Department of Horticultural Science, Faculty of Agriculture (Iran, Islamic Republic of); Hanifehpour, Younes; Joo, Sang Woo, E-mail: swjoo@yu.ac.kr [Yeungnam University, School of Mechanical Engineering (Korea, Republic of)

    2014-12-15

    Plants play an important role in the fate of nanoparticles in the environment through their uptake, bioaccumulation, and transfer to trophic chains. However, the impacts of nanoparticles on plants as essential components of all ecosystems are not well documented. In the present study, the toxic effects of l-Cysteine-capped CdS nanoparticles on Spirodela polyrrhiza as an aquatic higher plant species were studied. l-Cysteine-capped CdS nanoparticles were synthesized using hydrothermal method and their characteristics were determined by XRD, SEM, HR-TEM, and FT-IR techniques. The diameter of majority of synthesized nanoparticles was about 15–20 nm. Subsequently, the uptake of l-Cysteine-capped CdS nanoparticles by the plant species was confirmed using epifluorescence microscopy. The activity of peroxidase and superoxide dismutase as antioxidant enzymes was assayed and the relative frond number was calculated in the presence of different concentrations of l-Cysteine-capped CdS nanoparticles. The obtained results revealed the toxic effects of the synthesized nanoparticles on S. polyrrhiza, leading to growth reduction and significant changes in antioxidant enzymes’ activity.Graphical Abstract.

  14. Hierarchical self-assembly of photoluminescent CdS nanoparticles into a bile acid derived organogel: morphological and photophysical properties.

    Science.gov (United States)

    Chatterjee, Sayantan; Maitra, Uday

    2017-07-21

    We have described a strategy towards integrating photoluminescent semiconductor nanoparticles into a bio-surfactant derived organogel. A facially amphiphilic bile thiol was used for capping CdS nanoparticles (NPs) which were embedded in a bile acid derived new organogelator in order to furnish a soft hybrid material. The presence of CdS NPs in a well-ordered 1D array on the organogel network was confirmed using microscopic techniques. Photophysical studies of the gel-NP hybrid revealed resolved excitation and emission characteristics. Time resolved spectroscopic studies showed that the average lifetime value of the CdS NPs increased in the gel state compared to the sol phase. A kinetic model was utilized to obtain quantitative information about the different decay pathways of the photoexcited NPs in the sol and gel states.

  15. Biosynthesis and characterization of cadmium sulfide nanoparticles – An emphasis of zeta potential behavior due to capping

    Energy Technology Data Exchange (ETDEWEB)

    Sankhla, Aryan, E-mail: aaryansankhla@gmail.com [Centre for Converging Technologies, University of Rajasthan, Jaipur, 302015 (India); Sharma, Rajeshwar; Yadav, Raghvendra Singh [Centre for Converging Technologies, University of Rajasthan, Jaipur, 302015 (India); Kashyap, Diwakar [Department of Biological Chemistry, Ariel University, Ariel, 40700 (Israel); Kothari, S.L. [Institute of Biotechnology, Amity University, Jaipur, 303002 (India); Kachhwaha, S. [Department of Botany, University of Rajasthan, Jaipur, 302004 (India)

    2016-02-15

    Biological approaches have been amongst the most promising protocols for synthesis of nanomaterials. In this study, Cadmium sulfide nanoparticles (CdS NPs) were synthesized by incubating their precursor salts with Escherichia coli and zeta potential (ζ-potential) measurement with varying pH was carried out to evaluate stability of the colloidal dispersion. Formation of CdS NPs was studied in synchrony with microbial growth. TEM analysis confirmed the uniform distribution of NPs. Average size (5 ± 0.4 nm) and electron diffraction pattern revealed polycrystalline cubic crystal phase of these nanoparticles. X-ray diffractogram ascertained the formation of CdS nanoparticles with phase formation and particle size distribution in accordance with the particle size obtained from TEM. Absorption edge of biosynthesized CdS NPs showed a blue shift at ∼400 nm in comparison to their bulk counterpart. A hump at 279 nm indicated presence of biomolecules in the solution in addition to the particles. FT-IR spectrum of capped CdS NPs showed peaks of protein. This confirms adsorption of protein molecules on nanoparticle surface. They act as a capping agent hence responsible for the stability of NPs. The enhanced stability of the particles was confirmed by Zeta potential analysis. The presence of charge on the surface of capped CdS NPs gave a detail understanding of dispersion mechanism and colloidal stability at the NP interface. This stability study of biosynthesized semiconductor nanoparticles utilizing microbial cells had not been done in the past by any research group providing an impetus for the same. Surface area of capped CdS NPs and bare CdS NPs were found to be 298 ± 2.65 m{sup 2}/g and 117 ± 2.41 m{sup 2}/g respectively. A possible mechanism is also proposed for the biosynthesis of CdS NPs. - Highlights: • Synthesis of CdS NPs utilizing reproducible molecular machinery viz. Escherichia coli biomass. • Uniform and Polydispersed NPs with high surface area

  16. Facially amphiphilic thiol capped gold and silver nanoparticles

    Indian Academy of Sciences (India)

    Abstract. A series of bile acid-derived facially amphiphilic thiols have been used to cap sliver and gold nanoparticles. The self-assembling properties of these steroid-capped nanoparticles have been investigated and reported in this article.

  17. Synthesis and spectral studies on Cd(II) dithiocarbamate complexes and their use as precursors for CdS nanoparticles

    Science.gov (United States)

    Sathiyaraj, Ethiraj; Padmavathy, Krishnaraj; Kumar, Chandran Udhaya; Krishnan, Kannan Gokula; Ramalingan, Chennan

    2017-11-01

    Bis(N-cyclopropyl-N-4-chlorobenzyldithiocarbamato-S,S‧)cadmium(II) (1) and (2,2‧-bipyridine) bis(N-cyclopropyl-N-4-chlorobenzyldithiocarbamato-S,S‧)cadmium(II) (2) have been synthesized and characterized by FT-IR, 1HNMR and 13C NMR analyses. For the complex 2, single crystal X-ray diffraction analysis and computational studies (optimized geometry, HOMO-LUMO and MEP) have been executed employing DFT/B3LYP method with LANL 2DZ basic set. The optimized bond lengths and bond angles agree well with the experimental results. The complexes 1 and 2 have been used as single source precursors for the synthesis of ethyleneglycol capped CdS1 and CdS2 nanoparticles, respectively. CdS1 and CdS2 nanoparticles have been synthesized by solvothermal method. PXRD, SEM, Elemental colour mapping, EDAX, TEM and UV-Vis spectroscopy have been used to characterize the as-prepared CdS nanoparticles. The X-ray diffraction pattern confirms both their hexagonal structures.

  18. Arrays of magnetic nanoparticles capped with alkylamines

    Indian Academy of Sciences (India)

    Magnetic metal and metal oxide nanoparticles capped with alkylamines have been synthesized and characterized by transmission electron microscopy, X-ray diffraction, energy dispersive X-ray analysis and magnetization measurements. Core-shell Pd–Ni particles with composition, Pd561Ni3000, (diameter ∼ 3.3 nm) are ...

  19. Characterization of chemically synthesized CdS nanoparticles

    Indian Academy of Sciences (India)

    itation technique starting from analar grade cadmium salt and sodium sulfide, and using triethanolamine as capping agent. The nanoparticles are separated .... to the volume of the nanocrystal results in the relax- ation of the conservation of crystal momentum in the process of creation and decay. Pramana – J. Phys., Vol.

  20. Synthesis of CdS nanoparticles for photocatalytic application of methyleneblue degradation

    Energy Technology Data Exchange (ETDEWEB)

    Muthuraj, V., E-mail: muthuraj75@gmail.com [Research Department of Chemistry, VHNSN College, Virudhunagar-626001 (India); Umadevi, M. [Department of Chemistry, Nehru Memorial College, Puthanampatti, Trichy-621007, Tamilnadu (India); Sankarasubramanian, K.; Kajamuhideen, M. S. [School of Physics, Madurai Kamaraj University, Madurai-625 021, Tamilnadu (India)

    2014-04-24

    CdS nanoparticles were prepared by the reaction of cadmium acetate with thiourea in the presence and absence of methylene blue dye (MB). The nanoparticles were characterized by, XRD, FT-IR, UV-Vis. XRD study shows the presence of hexagonal phase for the nanoparticles whereas in case of the bulk samples only the hexagonal phase is observed. Fourier transform infrared spectroscopy (FT-IR) showed a strong interaction of methyl groups with CdS nanoparticles. The degradation of methylene blue was analysed using UV-Vis absorbance spectrum. Thus the results authenticate that methylene blue dye influences the structural and optical properties of the CdS nanoparticles.

  1. Effect of CdS nanoparticles on photoluminescence spectra of Tb 3 in ...

    Indian Academy of Sciences (India)

    derived silica glasses. S Rai L Bokatial. Volume 34 ... Glasses; sol–gel technique; nanoparticles; semiconductors; photoluminescence. Abstract. CdS nanoparticles doped with Tb3+ were synthesized by sol–gel technique. The influence of CdS on ...

  2. CdS Nanoparticles with a Thermoresponsive Polymer: Synthesis and Properties

    Directory of Open Access Journals (Sweden)

    Aslam Khan

    2012-01-01

    Full Text Available This paper describes the synthesis of thermoresponsive colloidal nanocomposites based on CdS and poly(N-isopropylacrylamide. The CdS nanoparticles were prepared at room temperature from cadmium chloride and sodium sulfide salts in the presence of an organic ligand, 3-mercaptopropionic acid (MPA. The as-prepared MPA-bound CdS nanoparticles were stable for more than 30 days and exhibited good optical properties. The effect of various ratios of MPA/Cd2+ and H2O/DMF (dimethylformamide on the particle size of the CdS nanoparticles was investigated using UV-vis absorption measurements. Transmission electron microscopy studies showed that the particle sizes were approximately 4 nm in diameter, which is consistent with the size obtained using UV-vis spectroscopy. The CdS nanocomposite showed a temperature-responsive phenomenon as its temperature increased from 20 to 45°C.

  3. Time and Temperature Dependence of CdS Nanoparticles Grown in a Polystyrene Matrix

    Directory of Open Access Journals (Sweden)

    F. Antolini

    2012-01-01

    Full Text Available Luminescent CdS nanocrystals embedded in a polystyrene matrix were successfully prepared. The in situ growth of CdS QDs was realized by thermal treatment of Cd bis(thiolate/polymer foil at different times and temperatures (240°C and 300°C of annealing, in order to evaluate their influence on the quantum dots growth process. As a general trend, the increasing of time and temperature of annealing induces a rise of the CdS nanocrystals size into the polymeric matrix. The size distribution, morphology, and structure of the CdS nanoparticles were analysed with HRTEM and XRD experiments. UV-Vis and PL data are strongly size-dependent and were used to investigate the particles' growth process, too. The CdS nanoparticles behavior in solution indicated a general trend of QDs to aggregation. This predisposition was clearly displayed by DLS measurements.

  4. Synthesis and characterization of CdS nanoparticle/polymer composites

    Science.gov (United States)

    Lama, Bimala

    Pure, sulfur rich and wurtzite phase CdS nanoparticles with average size ~4.7 nm were prepared in aqueous solution using thioglycerol as a capping ligand. Approximately 542 molecules of thioglycerol molecules were present on the surface of each CdS-TG nanoparticle. CdS-TG nanoparticles can trap a large amount of water molecules and the chemical shift of the trapped water molecules are dependent on the environment and the amount of water trapped. The presence of sodium ions in CdS-TG increases the order of thioglycerol molecules due to the interaction with ions. Relaxation values indicated the interaction between TSLi molecule and thioglycerol. Formation of the hydrophobic monolayer of TSLi on the outer surface of CdS-TG nanoparticles were confirmed by 2D-HETCOR studies. At the interface, cations are far from the aromatic ring and thioglycerol molecules and remain in water pockets with some motions. Pure, sulfur rich, wurtzite phase CdS-TEG nanoparticles with average size of ~4.5 nm were prepared using 2-mercaptoethanol (also known as thioethyleneglycol, TEG) as a capping ligand. Grafting of aromatic ring containing sulfonyl chloride with CdS-TEG nanoparticles through sulfonate ester was studied using benzene sulfonyl chloride in the basic aqueous medium. NMR studies confirmed the feasibility of the reaction and indicated that the rate of esterification reaction increased with increase in concentration of benzene sulfonyl chloride. Naphthalene sulfonyl chloride with CdS-TEG nanoparticles were used to study the photoluminescence behavior before and after the reaction. Quenching of the light observed in the naphthalene rings bonded to the nanoparticles and confirmed that electron or energy transfer took place easily in covalently bonded aromatic rings and nanoparticles. Grafting of polystyrene chain was done by changing polystyrene sulfonic acid to the polystyrene sulfonyl chloride. Some aromatic rings in polymer were bonded with nanoparticles through ester bond and

  5. Photoluminescence and energy transfer study of Eu3+ codoped with CdS nanoparticles in silica glass.

    Science.gov (United States)

    Bokatial, L; Rai, S

    2012-01-01

    The CdS nanoparticles along with Eu(3+) ions were embedded in silica xerogel by sol gel technique. The samples were studied by TGA, DTA and fluorescence techniques. The result suggested that doping of CdS nanoparticles enhanced the luminescence properties of Eu(3+) even in the gel stage itself and this avoids the need of heating gel at higher temperature. The effects of CdS nanoparticles on the Eu(3+) luminescence were discussed.

  6. Optical Properties of ZnO Nanoparticles Capped with Polymers

    Directory of Open Access Journals (Sweden)

    Atsushi Noguchi

    2011-06-01

    Full Text Available Optical properties of ZnO nanoparticles capped with polymers were investigated. Polyethylene glycol (PEG and polyvinyl pyrrolidone (PVP were used as capping reagents. ZnO nanoparticles were synthesized by the sol-gel method. Fluorescence and absorption spectra were measured. When we varied the timing of the addition of the polymer to the ZnO nanoparticle solution, the optical properties were drastically changed. When PEG was added to the solution before the synthesis of ZnO nanoparticles, the fluorescence intensity increased. At the same time, the total particle size increased, which indicated that PEG molecules had capped the ZnO nanoparticles. The capping led to surface passivation, which increased fluorescence intensity. However, when PEG was added to the solution after the synthesis of ZnO nanoparticles, the fluorescence and particle size did not change. When PVP was added to the solution before the synthesis of ZnO nanoparticles, aggregation of nanoparticles occurred. When PVP was added to the solution after the synthesis of ZnO nanoparticles, fluorescence and particle size increased. This improvement of optical properties is advantageous to the practical usage of ZnO nanoparticles, such as bioimaging

  7. Study of optical phonon modes of CdS nanoparticles using Raman ...

    Indian Academy of Sciences (India)

    In the case of nanostructured materials, confinement of optical phonons can produce noticeable changes in their vibrational spectra compared to those of bulk crystals. In this paper we report the study of optical phonon modes of nanoparticles of CdS using Raman spectroscopy. Nanoparticle sample for the present study ...

  8. Effect of Au coating on optical properties of CdS nanoparticles and their optical limiting studies

    Science.gov (United States)

    Mathew, S.; Samuel, Boni; Mujeeb, A.; Kailasnath, M.; Nampoori, V. P. N.; Girijavallabhan, C. P.

    2017-10-01

    We synthesized Au coated CdS nanoparticles by a novel synthesis route in which CdS is acting as a core. Transmission electron microscopy of the prepared CdS and Au coated nanoparticles shows that the size of the nanoparticles are in the range of 5 nm. TEM elemental maps of the Au coated CdS nanoparticles confirms the presence of Au nanoparticles on the surface of CdS nanoparticles. Nonlinear optical characteristics of these nanoparticles embedded in PVA thin films were studied by the Z-scan technique using Q-switched nanosecond Nd:YAG laser (532 nm). An enhancement in nonlinear optical property was observed for the prepared Au coated CdS embedded PVA nanocomposite films compared to that of bare CdS embedded PVA nanocomposite films. Nonlinear optical absorption coefficient and positive nonlinear refractive index of these films were measured to be 6.28 × 10-6cm/W and 4.86 × 10-11 cm2/W respectively. Au coated CdS nanoparticles embedded PVA film possesses a low limiting threshold of 34 MW/cm2 and also possess good positive nonlinear refractive index making suitable for optical limiting and optical switching applications.

  9. CdS nanoparticle sensitized titanium dioxide decorated graphene for enhancing visible light induced photoanode

    Energy Technology Data Exchange (ETDEWEB)

    Yousefzadeh, S.; Faraji, M. [Physics Department, Sharif University of Technology, P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Nien, Y.T. [Department of Materials Science and Engineering, National Formosa University, Taiwan (China); Moshfegh, A.Z., E-mail: moshfegh@sharif.edu [Physics Department, Sharif University of Technology, P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology, P.O. Box 14588-89694, Tehran (Iran, Islamic Republic of)

    2014-11-30

    Highlights: • CdS nanoparticles were deposited on TiO{sub 2}/graphene film by different SILAR cycles. • The visible light absorption increased due to graphene and CdS nanoparticles. • The highest photocurrent density was achieved for nanocomposite with 30 CdS cycles. • A mechanism has been suggested for nanocomposite photoanodes, significantly. - Abstract: CdS/TiO{sub 2}/graphene (CTG) nanocomposite thin films were synthesized by a facile production route. The TiO{sub 2}/graphene (TG) nanocomposite was initially fabricated by sol-gel method in such a way that TiO{sub 2} nanoparticles loaded on graphene oxide (GO) sheet via photocatalytic process. Then, CdS nanoparticles were deposited on the TG thin film by successive ion layer adsorption and reaction process (SILAR) approach. Based on atomic force microscopy (AFM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses, the TG thin film possessed a larger surface area as compared with the pure TiO{sub 2} thin film due to presence of graphene sheet. UV/visible spectroscopy exhibited that visible absorption of the CTG samples increased with increasing CdS SILAR deposition cycle (n). Enhanced photocurrent response of the CTG(n) photoanodes measured as compared with the TG and T photoanodes due to good electrical conductivity and large surface area of graphene as well as the visible light-harvesting ability of CdS nanoparticles. Maximum photocurrent density of about 4.5 A/m{sup 2} and electron life time of about 5 s was measured for the CTG(30) photoanodes.

  10. Optical properties of CdS nanoparticles embedded in polymeric microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Monte, A.F.G. [Universidade Federal de Uberlandia, Instituto de Fisica, Uberlandia MG 38400-902 (Brazil); Rabelo, D. [Universidade Federal de Goias, Instituto de Quimica, Goiania GO 74001-970 (Brazil); Morais, P.C., E-mail: pcmor@unb.b [Universidade de Brasilia, Instituto de Fisica, Brasilia DF 70919-970 (Brazil)

    2010-04-16

    Mesoporous microspheres of styrene-divinylbenzene (Sty-DVB) copolymer have been used as template for encapsulation of CdS nanocrystal-quantum-dots (NQDs). Raman, micro-photoluminescence and optical absorption were used to investigate the optical properties of the nanocomposites containing CdS NQDs. When a single microsphere nanocomposite is excited by a laser beam at room temperature, very strong and sharp whispering-gallery mode (WGM) is shown on the background of CdS NQD PL spectra, which confirms that coupling between the optical emission of the encapsulated NQDs and spherical cavity modes was realized. The results show that the microspheres loaded with CdS nanoparticles work as an optical microcavity allowing the observation of WGM. The lasing behavior is achieved at relatively low laser excitation intensity ({approx}1 mW) at room temperature. High-optical stability and low-threshold value make this optical system promising in visible microlaser applications.

  11. Diffusion mediated agglomeration of CdS nanoparticles via Langmuir–Blodgett technique

    Energy Technology Data Exchange (ETDEWEB)

    Das, Nayan Mani, E-mail: nayanmanidas3@gmail.com; Roy, Dhrubojyoti; Gupta, P.S.

    2013-10-15

    Graphical abstract: - Highlights: • Diffusion mediated agglomeration of CdS nanoparticles are discussed. • Formation of CdS nanoparticles are confirmed by the change of chain length in XRD. • AFM shows the agglomeration of particles with a film swelling of about 5 Å. • UV–vis absorbance suggests that the grown particles show quantum confinement. • Hexagonal form of particle was confirmed by UV–vis reflectivity. - Abstract: We have reported a diffusion mediated agglomeration of cadmium sulphide (CdS) nanoparticles within cadmium arachidate (CdA{sub 2}) film matrix. The structural morphology and formation of CdS nanoparticles are characterized by X-ray diffraction (XRD), X-ray reflectivity (XRR), atomic force microscopy (AFM) and ultraviolet-visible spectroscopy techniques. X-ray diffraction (XRD) results show a change in bilayer difference from 53.04 Å to 43 Å after the sulphidation. An epitaxial growth of the films by ∼5 Å after sulphidation is confirmed from atomic force microscopy studies. The particle size calculated form UV–vis absorption edges are found to be varying from 2.6 nm to 3.3 nm for the different layers. A lateral dimension of 72–80 nm from AFM measurements and a size of 2.6–3.3 nm have confirmed one side flat pseudo two-dimensional disk-like nanoparticles. UV–vis reflectivity peak at E{sub 1} (A) confirms the formation of hexagonal CdS nanoparticles along the c-axis.

  12. Anodic stripping voltammetry of synthesized CdS nanoparticles at boron-doped diamond electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Hayat, Mohammad; Ivandini, Tribidasari A., E-mail: ivandini.tri@sci.ui.ac.id; Saepudin, Endang [Department of Chemistry, FMIPA, Universitas Indonesia, Kampus UI Depok (Indonesia); Einaga, Yasuaki [Department of Chemistry, Keio University (Japan)

    2016-04-19

    Cadmium sulphide (CdS) nanoparticles were chemically synthesized using reverse micelles microreactor methods. By using different washing treatments, UV-Vis spectroscopy showed that the absorption peaks appeared at 465 nm, 462 nm, 460 nm, and 459 nm respectively for CdS nanoparticles without and with 1, 2, and 3 times washing treatments using pure water. In comparison with the absorbance peak of bulk CdS at 512 nm, the shifted absorption peaks, indicates that the different sizes of CdS can be prepared. Anodic stripping voltammetry of the CdS nanoparticles was then studied at a boron-doped diamond electrode using 0.1 M KClO{sub 4} and 0.1 M HClO{sub 4} as the electrolytes. A scan rate of 100 mV/s with a deposition potential of -1000 mV (vs. Ag/AgCl) for 60 s at a potential scan from -1600 mV to +800 mV (vs. Ag/AgCl) was applied as the optimum condition of the measurements. Highly-accurate linear calibration curves (R{sup 2} = 0.99) in 0.1 M HClO{sub 4} with the sensitivity of 0.075 mA/mM and the limit of detection of 81 µM in 0.1 M HClO{sub 4} can be achieved, which is promising for an application of CdS nanoparticles as a label for biosensors.

  13. Re-dispersible Li+ and Eu3+ co-doped CdS nanoparticles ...

    Indian Academy of Sciences (India)

    dispersible Li+ and Eu3+ co-doped CdS nanoparticles: Luminescence studies. N S Gajbhiye Raghumani Singh Ninghoujam Asar Ahmed D K Panda S S Umare S J Sharma. Contributed papers Volume 70 Issue 2 February 2008 pp 313-321 ...

  14. Biosynthesis of CdS nanoparticles: A fluorescent sensor for sulfate-reducing bacteria detection.

    Science.gov (United States)

    Qi, Peng; Zhang, Dun; Zeng, Yan; Wan, Yi

    2016-01-15

    CdS nanoparticles were synthesized with an environmentally friendly method by taking advantage of the characteristic metabolic process of sulfate-reducing bacteria (SRB), and used as fluorescence labels for SRB detection. The presence of CdS nanoparticles was observed within and immediately surrounded bacterial cells, indicating CdS nanoparticles were synthesized both intracellularly and extracellularly. Moreover, fluorescent properties of microbial synthesized CdS nanoparticles were evaluated for SRB detection, and a linear relationship between fluorescence intensity and the logarithm of bacterial concentration was obtained in the range of from 1.0×10(2) to 1.0×10(7)cfu mL(-1). The proposed SRB detection method avoided the use of biological bio-recognition elements which are easy to lose their specific recognizing abilities, and the bacterial detection time was greatly shortened compared with the widely used MPN method which would take up to 15 days to accomplish the detection process. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Growth of CdS nanoparticles by chemical method and its ...

    Indian Academy of Sciences (India)

    Abstract. In the present work a simple chemical reduction method is followed to grow. CdS nanoparticles at room temperature. The grown sample is ultrasonicated in acetone. The dispersed sample is characterized using electron diffraction technique. Simultaneously optical absorption of this sample is studied in the range of ...

  16. Study of optical phonon modes of CdS nanoparticles using Raman ...

    Indian Academy of Sciences (India)

    Wintec

    Department of Physics, Centre for Nanoscience and Nanotechnology, University of Kerala,. Kariavattom PO, Thiruvananthapuram 695 581, India. Abstract. The reduction in the grain size to nanometer range can bring about radical changes in almost all of the properties of semiconductors. CdS nanoparticles have attracted ...

  17. Growth of CdS nanoparticles by chemical method and its ...

    Indian Academy of Sciences (India)

    In the present work a simple chemical reduction method is followed to grow CdS nanoparticles at room temperature. The grown sample is ultrasonicated in acetone. The dispersed sample is characterized using electron diffraction technique. Simultaneously optical absorption of this sample is studied in the range of 400–700 ...

  18. Structural characterisation of alkyl amine-capped zinc sulphide nanoparticles.

    Science.gov (United States)

    Kremser, Gabriele; Rath, Thomas; Kunert, Birgit; Edler, Michael; Fritz-Popovski, Gerhard; Resel, Roland; Letofsky-Papst, Ilse; Grogger, Werner; Trimmel, Gregor

    2012-03-01

    Nanoparticles capped with amine ligands with different steric properties, dodecylamine and oleylamine, respectively, are investigated in the solid state as well as in solution. A combined X-ray diffraction, small angle X-ray scattering and electron microscopy investigation showed that the nanoparticles exhibit the sphalerite modification of ZnS as crystal phase with a diameter of 3-5 nm. A close packing of the monocrystalline nanoparticles in the solid state is observed. However, in the dodecylamine sample, besides spherical particles, a fraction of the nanoparticles is elongated. The nanoparticles are readily resoluble in apolar solvents like hexane. Dynamic light scattering (DLS) and SAXS investigations of the solutions reveal that the nanoparticles are dissolved as singular particles. In the case of oleylamine-capped ZnS, a defined core-shell structure with a ZnS core with a diameter of 4 nm and an organic shell with a thickness of approximately 2 nm have been found. Dodecylamine-capped nanoparticles slightly tend to form agglomerates with a diameter of approximately 40 nm. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. Synthesis of anisotropic CdS nanostructures via a single-source route

    CSIR Research Space (South Africa)

    Rajasekhar Pullabhotla, VSR

    2011-02-01

    Full Text Available A cadmium tetrahydroisoquinoline dithiocarbamate (DTC) complex has been used as single-source precursor for the synthesis of highly faceted hexadecylamine (HDA) capped CdS nanoparticles. Hexagonal and close to cubic shaped particles with distinct...

  20. Au Nanoparticles as Interfacial Layer for CdS Quantum Dot-sensitized Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhu Guang

    2010-01-01

    Full Text Available Abstract Quantum dot-sensitized solar cells based on fluorine-doped tin oxide (FTO/Au/TiO2/CdS photoanode and polysulfide electrolyte are fabricated. Au nanoparticles (NPs as interfacial layer between FTO and TiO2 layer are dip-coated on FTO surface. The structure, morphology and impedance of the photoanodes and the photovoltaic performance of the cells are investigated. A power conversion efficiency of 1.62% has been obtained for FTO/Au/TiO2/CdS cell, which is about 88% higher than that for FTO/TiO2/CdS cell (0.86%. The easier transport of excited electron and the suppression of charge recombination in the photoanode due to the introduction of Au NP layer should be responsible for the performance enhancement of the cell.

  1. Thermal and Optical Properties of CdS Nanoparticles in Thermotropic Liquid Crystal Monomers

    Directory of Open Access Journals (Sweden)

    Marc Alnot

    2010-03-01

    Full Text Available Two new mesogenic monomers, namely 3,3’-dimethoxy-4,4’-di(hydroxyhexoxy-N-benzylidene-o-Tolidine (Ia and 4,4’-di(6-hydroxyhexoxy-N-benzylidene-o-Tolidine (IIa, were reacted with cadmium sulfide (CdS via an in situ chemical precipitation method in ethanol to produce CdS nanocomposites. A series of different mass compositions of CdS with Ia and IIa ranging from 0.1:1.0 to 1.0:1.0 (w/w were prepared and characterized using X-ray Diffraction (XRD, Raman spectroscopy, Fourier Transform Infrared Spectroscopy (FT-IR, Transmission Electron Microscopy (TEM, Polarizing Optical Microscopy (POM and Differential Scanning Calorimetry (DSC, X-ray Photoelectron Spectroscopy (XPS and Photoluminescence Spectroscopy (PL. XRD showed that the broad peaks are ascribed to the formation of cubic CdS nanoparticles in both Ia and IIa. The average particle size for both nanocomposites was less than 5 nm with a narrower size distribution when compared with pure CdS nanoparticles. The analyses from POM and DSC demonstrated that mass composition from 0.1:1.0 up to 0.5:1.0 of CdS:Ia nanocomposites showed their enantiotropic nematic phase. On the other hand, polarizing optical microscopy (POM for IIa nanocomposites showed that the liquid crystal property vanished completely when the mass composition was at 0.2:1.0. PL emissions for CdS: Ia or IIa nanocomposites indicated deep trap defects occurred in these both samples. The PL results revealed that addition of CdS to Ia monomers suppressed the photoluminescence intensity of Ia. However, the introduction of CdS to IIa monomers increased the photoluminescence and was at a maximum when the mass composition was 0.3:1.0, then decreased in intensity as more CdS was added. The XPS results also showed that the stoichiometric ratios of S/Cd were close to 1.0:1.0 for both types of nanocomposites for a mass composition of 1.0:1.0 (CdS:matrix.

  2. Synthesis of Stabilized Myrrh-Capped Hydrocolloidal Magnetite Nanoparticles

    Directory of Open Access Journals (Sweden)

    Ayman M. Atta

    2014-07-01

    Full Text Available Herein we report a new method for synthesizing stabilized magnetic nanoparticle (MNP colloids. A new class of monodisperse water-soluble magnetite nano-particles was prepared by a simple and inexpensive co-precipitation method. Iron ions and iodine were prepared by the reaction between ferric chloride and potassium iodide. The ferrous and ferric ions were hydrolyzed at low temperature at pH 9 in the presence of iodine to produce iron oxide nanoparticles. The natural product myrrh gum was used as capping agent to produce highly dispersed coated magnetite nanoparticles. The structure and morphology of the magnetic nanogel was characterized by Fourier transform infrared spectroscopy (FTIR and transmission electron microscopy (TEM, and X-ray diffraction (XRD was used to examine the crystal structure of the produced magnetite nanoparticles.

  3. Performance of colloidal CdS sensitized solar cells with ZnO nanorods/nanoparticles

    Science.gov (United States)

    Roy, Anurag; Das, Partha Pratim; Tathavadekar, Mukta; Das, Sumita

    2017-01-01

    As an alternative photosensitizer in dye-sensitized solar cells, bovine serum albumin (BSA) (a nonhazardous protein) was used in the synthesis of colloidal CdS nanoparticles (NPs). This system has been employed to replace the commonly used N719 dye molecule. Various nanostructured forms of ZnO, namely, nanorod and nanoparticle-based photoanodes, have been sensitized with colloidal CdS NPs to evaluate their effective performance towards quantum dot sensitized solar cells (QDSSCs). A polysulphide (Sx 2−)-based electrolyte and CuxS counter electrode were used for cell fabrication and testing. An interesting improvement in the performance of the device by imposing nanorods as a scattering layer on a particle layer has been observed. As a consequence, a maximum conversion efficiency of 1.06% with an open-circuit voltage (V OC) of 0.67 V was achieved for the ZnO nanorod/nanoparticle assembled structure. The introduction of ZnO nanorods over the nanoparticle led to a significant enhancement of the overall efficiency compared to the corresponding bare nanoparticles. PMID:28243559

  4. Performance of colloidal CdS sensitized solar cells with ZnO nanorods/nanoparticles.

    Science.gov (United States)

    Roy, Anurag; Das, Partha Pratim; Tathavadekar, Mukta; Das, Sumita; Devi, Parukuttyamma Sujatha

    2017-01-01

    As an alternative photosensitizer in dye-sensitized solar cells, bovine serum albumin (BSA) (a nonhazardous protein) was used in the synthesis of colloidal CdS nanoparticles (NPs). This system has been employed to replace the commonly used N719 dye molecule. Various nanostructured forms of ZnO, namely, nanorod and nanoparticle-based photoanodes, have been sensitized with colloidal CdS NPs to evaluate their effective performance towards quantum dot sensitized solar cells (QDSSCs). A polysulphide (S x2-)-based electrolyte and Cu x S counter electrode were used for cell fabrication and testing. An interesting improvement in the performance of the device by imposing nanorods as a scattering layer on a particle layer has been observed. As a consequence, a maximum conversion efficiency of 1.06% with an open-circuit voltage (VOC) of 0.67 V was achieved for the ZnO nanorod/nanoparticle assembled structure. The introduction of ZnO nanorods over the nanoparticle led to a significant enhancement of the overall efficiency compared to the corresponding bare nanoparticles.

  5. Performance of colloidal CdS sensitized solar cells with ZnO nanorods/nanoparticles

    Directory of Open Access Journals (Sweden)

    Anurag Roy

    2017-01-01

    Full Text Available As an alternative photosensitizer in dye-sensitized solar cells, bovine serum albumin (BSA (a nonhazardous protein was used in the synthesis of colloidal CdS nanoparticles (NPs. This system has been employed to replace the commonly used N719 dye molecule. Various nanostructured forms of ZnO, namely, nanorod and nanoparticle-based photoanodes, have been sensitized with colloidal CdS NPs to evaluate their effective performance towards quantum dot sensitized solar cells (QDSSCs. A polysulphide (Sx2−-based electrolyte and CuxS counter electrode were used for cell fabrication and testing. An interesting improvement in the performance of the device by imposing nanorods as a scattering layer on a particle layer has been observed. As a consequence, a maximum conversion efficiency of 1.06% with an open-circuit voltage (VOC of 0.67 V was achieved for the ZnO nanorod/nanoparticle assembled structure. The introduction of ZnO nanorods over the nanoparticle led to a significant enhancement of the overall efficiency compared to the corresponding bare nanoparticles.

  6. DMSO as a solvent/ligand to monodisperse CdS spherical nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Kaijun [China Pharmaceutical University, Physical Chemistry Lab, School of Science (China); Han, Qiaofeng, E-mail: hanqiaofeng@njust.edu.cn [Nanjing University of Science and Technology, Key Laboratory for Soft Chemistry and Functional Materials, Ministry of Education (China)

    2016-01-15

    Monodisperse CdS nanospheres assembled by small nanoparticles were prepared using dimethyl sulfoxide (DMSO) as a solvent through several routes including thermolysis of xanthate, the reaction of cadmium acetate (Cd(CH{sub 3}CO{sub 2}){sub 2}) with thiourea, and interfacial reaction of CS{sub 2} and Cd(CH{sub 3}CO{sub 2}){sub 2}/DMSO. The corresponding products possessed the particle sizes ranging from around 35 to 45 nm, 63 to 73 nm, and 240 to 280 nm, respectively. These products presented uniform spherical morphology, which provide insights into the effect of DMSO on CdS morphology. DMSO, as an aprotic and polar solvent, possesses unique properties. The oxygen and sulfur atoms in DMSO can coordinate to metal ions on nanoparticles surface, and the high polarity of DMSO is favorable to fast reaction, nucleation, growth, and Ostwald ripening, forming monodisperse nanospheres with narrow size distribution. The influence of CdS size on its photocatalytic activity was evaluated using Rhodamine B (RhB) as a model compound under visible light irradiation.

  7. Starch mediated CdS nanoparticles and their photocatalytic performance under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Firdaus, Farha, E-mail: Farha-firdaus@yahoo.co.in [Chemistry Section, Women’s College, Aligarh Muslim University, Aligarh 202002 UP (India); Faraz, Mohd [Department of Chemistry, Faculty of Science, Aligarh Muslim University, Aligarh 202002 (India)

    2016-05-06

    Green synthesis of Cadmium Sulphide (CdS-S) nanoparticles is of considerable interest due to its biocompatible and nontoxicity. Here, we present a biomolecule stimulated chemical method was adopted for the successful synthesis of CdS-S nanoparticles using starch as a capping agent. The CdS-S nanoparticles were characterized by various analytical techniques. The CdS-S nanoparicles exhibit photocatalytic activity against methyl orange (MO) at pH 9 in Visible light and the reaction follows pseudo first-order kinetics. The comparative photocatalytic activity revealed that CdS-S nanoparticles remarkably enhanced activities as compared to the commercial TiO{sub 2} nanoparticles. The outcome of these studies offers valuable for planning CdS-S nanoparticles having photocatalytic activities helpful for the formulation of waste water remediation.

  8. Structural and Thermal Studies of ZnS and CdS Nanoparticles in Polymer Matrices

    Directory of Open Access Journals (Sweden)

    Jejenija Osuntokun

    2016-01-01

    Full Text Available We report the synthesis and structural studies of ZnS and CdS nanoparticles in polyvinylpyrrolidone (PVP, poly(vinyl alcohol (PVA, and poly(methyl methacrylate (PMMA matrices. The metal sulfides/polymer nanocomposites were characterized by X-ray diffraction (XRD, Fourier transform infrared spectroscopy, electronic spectroscopy (UV-Vis, transmission electron microscopy (TEM, and thermogravimetric analysis (TGA. The particle sizes as calculated from the absorption spectra were in agreement with the results obtained from TEM and XRD data. They showed metal sulfides nanoparticles in the polymers matrices with average crystallite sizes of 1.5–6.9 nm. The TGA results indicate that incorporation of the nanoparticles significantly altered the thermal properties of the respective polymers with ZnS/PVA and CdS/PVA nanocomposites displaying higher thermal stability than the other polymer nanocomposites.

  9. Influence of organic ligands on the formation and functional properties of CdS nanostructures

    Science.gov (United States)

    K. D., Nisha; Navaneethan, M.; Harish, S.; Archana, J.; Ponnusamy, S.; Muthamizhchelvan, C.; Aswal, D. K.; Shimomura, M.; Ikeda, H.; Hayakawa, Y.

    2017-10-01

    The effect of capping agents (Piperazine, Polyvinylpyrrolidone and triton X) on the functional properties of CdS nanostructures have investigated. SEM analysis revealed the formation of different morphologies of CdS nanostructures in the presence of different capping agents. Surface passivation of CdS with polyvinylpyrrolidone and piperazine lead to the formation of CdS nanorods, whereas capping with triton X resulted in the formation of CdS clusters. XRD studies revealed the formation of cubic phase and hexagonal phase with polyvinylpyrrolidone, triton X and piperazine, respectively. Absorption and emission studies revealed that the capping agents play an important role in passivation of the dangling bonds on the nanoparticle surface and greatly influence the optical properties.

  10. Synthesis and characterization of dextran-capped silver nanoparticles with enhanced antibacterial activity.

    Science.gov (United States)

    Yang, Guili; Lin, Qiuxia; Wang, Chunren; Li, Junjie; Wang, Jian; Zhou, Jin; Wang, Yan; Wang, Changyong

    2012-05-01

    Dextran-capped silver nanoparticles were synthesized by reducing silver nitrate with NaBH4 in the presence of dextran as capping agent. The characters of silver nanoparticles were investigated using UV-Vis spectrophotometer, nano-grainsize analyzer, X-ray diffraction, and transmission electron microscopy. Results showed that the silver nanoparticles capped with dextran were in uniform shape and narrow size distribution. Moreover, compared with polyvinylpyrrolidone (PVP)-capped silver nanoparticles, the dextran-capped ones possessed better stability. Antibacterial tests of these silver nanoparticles were carried out for Escherichia coli, Staphylococcus aureus, Staphylococcus epidermidis, Pseudomonas aeruginosa, and Klebsiella pneumoniae. Results suggested that the dextran-capped silver nanoparticles had high antibacterial activity against both Gram-positive and Gram-negative bacteria. In addition, the cytotoxicity in vitro of the dextran-capped silver nanoparticles was investigated using mouse fibrosarcoma cells (L929). The toxicity was evaluated by the changes of cell morphology and 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium bromide assay. Results indicated that these silver nanoparticles had slight effect on the survival and proliferation of L-929 cells at their minimal inhibitory concentration (MIC). After modified by dextran, the physiochemical properties of the silver nanoparticles had been improved. We anticipated that these dextran-capped silver nanoparticles could be integrated into systems for biological and pharmaceutical applications.

  11. Activity of catalytic silver nanoparticles modulated by capping agent hydrophobicity.

    Science.gov (United States)

    Janani, Seralathan; Stevenson, Priscilla; Veerappan, Anbazhagan

    2014-05-01

    In this paper, a facile in situ method is reported for the preparation of catalytic silver nanoparticles (AgNPs) using N-acyl tyramine (NATA) with variable hydrophobic acyl length. Scanning electron microscopic analysis shows that NATA exists initially as larger aggregates in alkaline aqueous solution. The addition of AgNO3 dissociates these larger aggregate and subsequently promotes the formation of self-assembled NATA and AgNPs. Characterization of AgNPs using UV-vis spectroscopy, scanning electron microscope and transmission electron microscope revealed that the hydrophobic acyl chain length of NATA does not influence the particle size, shape and morphology. All NATA-AgNPs yielded relatively identical values in full width at half-maximum (FWHM) analysis, indicating that the AgNPs prepared with NATA are relatively polydispersed at all tested acyl chain lengths. These nanoparticles are able to efficiently catalyze the reduction of 4-nitro phenol to 4-amino phenol, 2-nitro aniline to 1,2-diamino benzene, 2,4,6-trinitro phenol to 2,4,6-triamino phenol by NaBH4 in an aqueous environment. The reduction reaction rate is determined to be pseudo-first order and the apparent rate constant is linearly dependent on the hydrophobic acyl chain length of the NATA. All reaction kinetics presented an induction period, which is dependent on the N-acyl chain length, indicating that the hydrophobic effects play a critical role in bringing the substrate to the metal nanoparticle surface to induce the catalytic reaction. In this study, however, the five catalytic systems have similar size and polydispersity, differing only in terms of capping agent hydrophobicity, and shows different catalytic activity with respect to the alkyl chain length of the capping agent. As discussed, the ability to modulate the metal nanoparticles catalytic property, by modifying the capping agent hydrophobicity represents a promising future for developing an efficient nanocatalyst without altering the size

  12. Cellulose acetate fibers covered by CdS nanoparticles for hybrid solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Cortina, Hugo; Martinez-Alonso, Claudia [Centro de Investigacion en Energia, UNAM, Priv. Xochicalco S/N, Temixco, Morelos 62580 (Mexico); Castillo-Ortega, Monica [Universidad de Sonora, Hermosillo, Sonora 83000 (Mexico); Hu, Hailin, E-mail: hzh@cie.unam.mx [Centro de Investigacion en Energia, UNAM, Priv. Xochicalco S/N, Temixco, Morelos 62580 (Mexico)

    2012-09-20

    In this work cellulose acetate (CA) fibers with a diameter of approximately 1 {mu}m were immersed in a cadmium sulfide (CdS) precursor solution. After 3 h the original white color CA fibers became yellow and maintained the same form, suggesting the deposition of CdS on fiber surface. SEM images showed that CA fibers were covered by uniformly sized CdS nanoparticles of approximately 100 nm. XRD and optical absorption spectra indicated that they contained mostly cubic crystalline phase with the optical band gap of 2.43 eV. CdS coated CA fibers, called CdS(CA) fibers, were dispersed in a polar dispersant (dimethyl sulfoxide, DMSO) and then mixed with a poly(3-hexylthiophene) (P3HT) solution in a non-polar solvent (dichlorobenzene, DCB). The mixture was cast onto a transparent conductive glass substrate (Indium-Tin-Oxide, ITO), and after solvent evaporation a thin layer of CdS(CA)-P3HT composite was formed. It is observed that the volume relation between the polar dispersant and non-polar solvent influences the solubility of the P3HT product in the composite coating and the photovoltaic performance of the corresponding cell as well. The mass ratio between CdS(CA) fibers and P3HT in the composite layer affects the optical absorption of the composite. The best photovoltaic performance was obtained in CdS(CA)-P3HT based cells with a volume relation between DCB and DMSO of 3.5-1, a mass ratio between CdS(CA) and P3HT of 1:1, and a rapid drying process for composite coatings.

  13. Evolution of different morphologies of CdS nanoparticles by thermal decomposition of bis(thiourea)cadmium chloride in various solvents

    Energy Technology Data Exchange (ETDEWEB)

    Gaur, Rama; Jeevanandam, P., E-mail: jeevafcy@iitr.ernet.in, E-mail: jeevafcy@iitr.ac.in [Indian Institute of Technology Roorkee, Department of Chemistry (India)

    2015-03-15

    CdS nanoparticles with different morphologies have been synthesized by thermal decomposition of bis(thiourea)cadmium chloride in different solvents without the use of any ligand/surfactant. CdS nanoparticles with pyramid, sponge-like and hexagonal disc-like morphologies were obtained in diphenyl ether (DPE), 1-octadecene (ODE) and ethylene glycol (EG), respectively. In addition, CdS nanoparticles with unique morphologies were obtained when the decomposition of the complex was carried out in mixed solvents (DPE–EG and ODE–EG). Extensive characterization of the CdS nanoparticles was carried out using powder X-ray diffraction, FT-IR spectroscopy, thermal analysis, field-emission scanning electron microscopy, diffuse reflectance spectroscopy and photoluminescence spectroscopy, and detailed mechanism of the formation of CdS nanoparticles with different morphologies in various solvents has been proposed.

  14. Evolution of different morphologies of CdS nanoparticles by thermal decomposition of bis(thiourea)cadmium chloride in various solvents

    Science.gov (United States)

    Gaur, Rama; Jeevanandam, P.

    2015-03-01

    CdS nanoparticles with different morphologies have been synthesized by thermal decomposition of bis(thiourea)cadmium chloride in different solvents without the use of any ligand/surfactant. CdS nanoparticles with pyramid, sponge-like and hexagonal disc-like morphologies were obtained in diphenyl ether (DPE), 1-octadecene (ODE) and ethylene glycol (EG), respectively. In addition, CdS nanoparticles with unique morphologies were obtained when the decomposition of the complex was carried out in mixed solvents (DPE-EG and ODE-EG). Extensive characterization of the CdS nanoparticles was carried out using powder X-ray diffraction, FT-IR spectroscopy, thermal analysis, field-emission scanning electron microscopy, diffuse reflectance spectroscopy and photoluminescence spectroscopy, and detailed mechanism of the formation of CdS nanoparticles with different morphologies in various solvents has been proposed.

  15. Synthesis and Use of [Cd(Detu2(OOCCH32]·H2O as Single Molecule Precursor for Cds Nanoparticles

    Directory of Open Access Journals (Sweden)

    Peter A. Ajibade

    2013-01-01

    Full Text Available Substituted thiourea ligands are of interest because they possess various donor sites for metal ions and their application in separation of metal ions and as antimicrobial agents. The coordination of the sulfur donor atom led to interest in them as precursor for semiconductor nanoparticles. In this study, cadmium(II complex of diethylthiourea was synthesized and characterized by elemental analysis, FTIR, and X-ray crystallography. Single crystal X-ray structure of the complex showed that the octahedral geometry around the Cd ion consists of two molecules of diethylthiourea acting as monodentate ligands and two chelating acetate ions. The thermal decomposition of the compound showed that it decomposed to give CdS. The compound was thermolysed in hexadecylamine (HDA to prepare HDA-capped CdS nanoparticles. The absorption spectrum showed blue shifts in its absorption band edges which clearly indicated quantum confinement effect, and the emission spectrum showed characteristic band edge luminescence. The broad diffraction peaks of the XRD pattern showed the materials to be of the nanometric size.

  16. Functionalization of gold nanoparticles and CdS quantum dots with cell penetrating peptides

    Science.gov (United States)

    Berry, Catherine C.; de la Fuente, Jesus M.

    2009-02-01

    During the last decade, there has been great deal of interest in the self-assembly fabrication of hybrid materials from inorganic nanoparticles and biomolecules. Nanoparticles are similar in size range to many common biomolecules, thus, nanoparticles appear to be natural companions in hybrid systems. At present, it is straightforward to control and modify properties of nanostructures to better suit their integration with biological systems; for example, controlling their size, modifying their surface layer for enhanced aqueous solubility, biocompatibility, or biorecognition. A particularly desirable target for therapeutic uses is the cell nucleus, because the genetic information is there. We review in this article the synthesis developed by our research group of water-soluble gold nanoparticles and CdS nanocrystals functionalized with a Tat protein-derived peptide sequence by straightforward and economical methodologies. The particles were subsequently tested in vitro with a human fibroblast cell line using optical and transmission electron microscopy to determine the biocompatibility of these nanoparticles and whether the functionalization with the cell penetrating peptide allowed particles to transfer across the cell membrane and locate into the nucleus.

  17. Synthesis of poly (3-hexyl thiophene-2,5-diyl) in presence of CdS nanoparticles: microscopic and spectroscopic studies

    Energy Technology Data Exchange (ETDEWEB)

    Nicho, M. E.; Jaimes, W. [Universidad Autonoma del Estado de Morelos, Centro de Investigacion en Ingenierias y Ciencias Aplicadas, Av. Universidad 1001, Col. Chamilpa, 62209 Cuernavaca, Morelos (Mexico); Rivas A, M. E.; Quevedo L, M. A. [University of Texas at Dallas, Department of Materials Science and Engineering, 800 West Campbell Road, Richardson, Texas 75252 (United States); Hu, H., E-mail: menicho@uaem.mx [UNAM, Instituto de Energias Renovables, 62580 Temixco, Morelos (Mexico)

    2017-11-01

    In this paper, the synthesis of nano composites of poly(3-hexyl thiophene-2,5-diyl) (P3HT) and cadmium sulfide (CdS) nanoparticles are reported. CdS nanoparticles were first synthesized using chemical precipitation. Then P3HT was synthesized by direct oxidation of 3-hexyl thiophene with FeCl{sub 3} as oxidant in presence of CdS nanoparticles. The goal of this work was to investigate the effect of the CdS nanoparticles during the synthesis of P3HT. The resulting films of P3HT/CdS nano composites were investigated by Fourier Transform Infrared Spectroscopy (Ft-IR), Ultraviolet-Visible Spectroscopy (UV-Vis), X-ray diffraction, Transmission electron microscopy (Tem), Atomic force microscopy (AFM) and Scanning electron microscopy (Sem). Homogeneous distribution of CdS nanoparticles in P3HT was demonstrated by Sem, AFM and Tem. Ft-IR analysis showed interaction between CdS and the S atoms of the thiophene rings. This result, together with UV-Vis spectra and XRD pattern suggest a better arrangement of the polymer chains. It is possible that the CdS nanoparticles are coupled with the unpaired electrons of S atoms in the thiophene rings through the positive delocalized charge, resulting in a more ordered P3HT polymer matrix with embedded CdS nanoparticles. (Author)

  18. Biocompatible capped iron oxide nanoparticles for Vibrio cholerae detection

    Science.gov (United States)

    Sharma, Anshu; Baral, Dinesh; Rawat, Kamla; Solanki, Pratima R.; Bohidar, H. B.

    2015-05-01

    We report the studies relating to fabrication of an efficient immunosensor for Vibrio cholerae detection. Magnetite (iron oxide (Fe3O4)) nanoparticles (NPs) have been synthesized by the co-precipitation method and capped by citric acid (CA). These NPs were electrophoretically deposited onto indium-tin-oxide (ITO)-coated glass substrate and used for immobilization of monoclonal antibodies against Vibrio cholerae (Ab) and bovine serum albumin (BSA) for Vibrio cholerae detection using an electrochemical technique. The structural and morphological studies of Fe3O4 and CA-Fe3O4/ITO were characterized by x-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FTIR) spectroscopy, and dynamic light scattering (DLS) techniques. The average crystalline size of Fe3O4, CA-Fe3O4 nanoparticles obtained were about 29 ± 1 nm and 37 ± 1 nm, respectively. The hydrodynamic radius of the nanoparticles was found to be 77.35 nm (Fe3O4) and 189.51 nm (CA-Fe3O4) by DLS measurement. The results of electrochemical response studies of the fabricated BSA/Ab/CA-Fe2O3/ITO immunosensor exhibits a good detection range of 12.5-500 ng mL-1 with a low detection limit of 0.32 ng mL-1, sensitivity 0.03 Ω/ng ml-1 cm-2, and reproducibility more than 11 times.

  19. SYNTHESIS OF NANOPARTICLE SEMICONDUCTOR CdS IN PHASE TRANSFORMED MICROEMULSION OF WATER/ SDS/ ETANOL/ n-HEXANE SYSTEM

    Directory of Open Access Journals (Sweden)

    Fitria Rahmawati

    2010-06-01

    Full Text Available The objective of this research is to study wheather the emulsion system of water/SDS (Sodium Dodecyl Sulphate/ethanol/n-hexane can be transformed from S1 (hydrocarbon in water type to S2 (water in hydrocarbon. CdS can be synthesized in the transformed product of microemulsion medium. The emulsion type transformation from S1 to S2 was conducted by adding n-hexane increment of 5 mL as hydrocarbon phase and stirring at 300 rpm for 2 minutes. The inversion point was defined from the measurement of emulsion conductivity and was supported by data of the droplet view under optical microscope. CdS was synthesized from reaction of Cd(NO32.4H2O with Na2S in phase transformed microemulsion medium. CdS cluster size was obtained from its UV-Vis spectrum and was characterized using X-ray diffraction to analyse the crystallinity and crystal system, then the influence of the variation of SDS amount to the CdS cluster size and its UV-Vis spectrum was observed.The result of this research shows that the system of n-hexane/SDS/water emulsion can be transformed from S1 to S2 type. The SDS amount in the microemulsion has influence the CdS cluster size. The larger amount of SDS added, the smaller of CdS cluster size was obtained. XRD data indicated that CdS cluster has been obtained with 40.613 % of purity. Keywords: emulsion system, nanoparticle semiconductor, CdS, sodium dodecyl sulphate

  20. Photoelectrochemical and Raman characterization of In2O3 mesoporous films sensitized by CdS nanoparticles

    Directory of Open Access Journals (Sweden)

    Mikalai V. Malashchonak

    2013-04-01

    Full Text Available The method of successive ion layer adsorption and reaction was applied for the deposition of CdS nanoparticles onto a mesoporous In2O3 substrate. The filling of the nanopores in In2O3 films with CdS particles mainly occurs during the first 30 cycles of the SILAR deposition. The surface modification of In2O3 with CdS nanoparticles leads to the spectral sensitization of photoelectrochemical processes that manifests itself in a red shift of the long-wavelength edge in the photocurrent spectrum by 100–150 nm. Quantum-confinement effects lead to an increase of the bandgap from 2.49 to 2.68 eV when decreasing the number of SILAR cycles from 30 to 10. The spectral shift and the widening of the Raman line belonging to CdS evidences the lattice stress on the CdS/In2O3 interfaces and confirms the formation of a close contact between the nanoparticles.

  1. Enhancing Photocatalytic Degradation of Methyl Blue Using PVP-Capped and Uncapped CdSe Nanoparticles

    Directory of Open Access Journals (Sweden)

    Kgobudi Frans Chepape

    2017-01-01

    Full Text Available Quantum confinement of semiconductor nanoparticles is a potential feature which can be interesting for photocatalysis, and cadmium selenide is one simple type of quantum dot to use in the following photocatalytic degradation of organic dyes. CdSe nanoparticles capped with polyvinylpyrrolidone (PVP in various concentration ratios were synthesized by the chemical reduction method and characterized. The transmission electron microscopy (TEM analysis of the samples showed that 50% PVP-capped CdSe nanoparticles were uniformly distributed in size with an average of 2.7 nm and shape which was spherical-like. The photocatalytic degradation of methyl blue (MB in water showed efficiencies of 31% and 48% when using uncapped and 50% PVP-capped CdSe nanoparticles as photocatalysts, respectively. The efficiency of PVP-capped CdSe nanoparticles indicated that a complete green process can be utilized for photocatalytic treatment of water and waste water.

  2. The Role of Organic Capping Layers of Platinum Nanoparticles in Catalytic Activity of CO Oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jeong Y.; Aliaga, Cesar; Renzas, J. Russell; Lee, Hyunjoo; Somorjai, Gabor A.

    2008-12-17

    We report the catalytic activity of colloid platinum nanoparticles synthesized with different organic capping layers. On the molecular scale, the porous organic layers have open spaces that permit the reactant and product molecules to reach the metal surface. We carried out CO oxidation on several platinum nanoparticle systems capped with various organic molecules to investigate the role of the capping agent on catalytic activity. Platinum colloid nanoparticles with four types of capping layer have been used: TTAB (Tetradecyltrimethylammonium Bromide), HDA (hexadecylamine), HDT (hexadecylthiol), and PVP (poly(vinylpyrrolidone)). The reactivity of the Pt nanoparticles varied by 30%, with higher activity on TTAB coated nanoparticles and lower activity on HDT, while the activation energy remained between 27-28 kcal/mol. In separate experiments, the organic capping layers were partially removed using ultraviolet light-ozone generation techniques, which resulted in increased catalytic activity due to the removal of some of the organic layers. These results indicate that the nature of chemical bonding between organic capping layers and nanoparticle surfaces plays a role in determining the catalytic activity of platinum colloid nanoparticles for carbon monoxide oxidation.

  3. Pseudorotaxane capped mesoporous silica nanoparticles for 3,4-methylenedioxymethamphetamine (MDMA) detection in water

    DEFF Research Database (Denmark)

    Lozano-Torres, Beatriz; Pascual, Lluís; Bernardos, Andrea

    2017-01-01

    Mesoporous silica nanoparticles loaded with fluorescein and capped by a pseudorotaxane, formed between a naphthalene derivative and cyclobis(paraquat-p-phenylene) (CBPQT4+), were used for the selective and sensitive fluorogenic detection of 3,4-methylenedioxymethamphetamine (MDMA)....

  4. Polyacrylamide hydrogel as a template in situ synthesis of CdS nanoparticles with high photocatalytic activity and photostability

    Science.gov (United States)

    Yang, Jiangbing; Gao, Jianping; Wang, Xiaoxue; Mei, Shunkang; Zhao, Ruiru; Hao, Chaoyue; Wu, Yongli; Zhai, Xiangang; Liu, Yu

    2017-10-01

    Porous polyacrylamide hydrogel (PAM) was prepared by polymerization at room temperature. Cadmium sulfide/polyacrylamide hydrogels (CdS/PAM) was synthesized by in situ loading CdS nanoparticles and used for photocatalytic decomposition of water for the first time. The size distribution of the loaded CdS nanoparticles is 3-12 nm. We studied the enhanced photocatalytic activity and photo-corrosion inhibition of CdS/PAM the compared with pure CdS and probed the mechanism of the improvement. In particular, the CdS/PAM prepared in 0.003 M CdCl2 solution exhibited the highest hydrogen production efficiency of 2.929 mmol g-1 h-1, about 79 times that of pure CdS. The results demonstrate that the formation of new N-Cd bond and high transmittance of CdS/PAM dramatically enhance photocatalytic activity. The electron cloud of nitrogen atom can attract holes and repel photogenerated electrons, which lowers the carrier recombination probability. The results also reveal that the excellent hydrophilicity of hydrogel plays an important role in the inhibition of photocorrosion. In addition, CdS/PAM is easily recycled and processed. The present work will pave a good way for the application of smart hydrogels in the field of photocatalytic hydrogen production. [Figure not available: see fulltext.

  5. Structural, spectroscopic and biological investigation of copper oxides nanoparticles with various capping agents

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, A., E-mail: ana.maria.nowak@gmail.com [A. Chelkowski Institute of Physics, University of Silesia, Katowice (Poland); Szade, J.; Talik, E.; Ratuszna, A. [A. Chelkowski Institute of Physics, University of Silesia, Katowice (Poland); Ostafin, M. [Agricultural University of Cracow, Department of Microbiology, Krakow (Poland); Peszke, J. [A. Chelkowski Institute of Physics, University of Silesia, Katowice (Poland)

    2014-06-01

    Powder composed of copper oxides nanoparticles with various capping agents has been synthesized and characterized with the use of X-ray photoelectron spectroscopy (XPS), scanning electron microscopy (SEM) and X-ray diffraction (XRD). Polyvinyl alcohol (PVA), glycol propylene, glycerin and glycerin plus ammonia were used as capping agents. The scanning electron microscopy (SEM) studies showed that nanoparticles form agglomerates with the size from 80 to 120 nm while particles size determined from the XRD experiment was in the range from 7 to 21 nm. XPS and XRD experiments revealed that depending on capping and reducing agents used in the synthesis nanoparticles are composed of Cu{sub 2}O, CuO or a mixture of them. The biological activity test performed for a selected sample where the capping agent was glycerin plus ammonia has shown promising killing/inhibiting behavior, very effective especially for Gram negatives bacteria. - Highlights: • We obtained copper oxide nanoparticles in a powder form. • Several capping agents were tested. • Structural and chemical tests showed that the main component were Cu{sub 2}O and CuO. • The size of nanoparticles was in the range 7–21 nm. • Nanoparticles with glycerin and ammonia capping agent showed good antibacterial properties.

  6. Effect of capping agents: Structural, optical and biological properties of ZnO nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Javed, Rabia [Department of Biotechnology, Faculty of Biological Sciences, Quaid-i-Azam University, Islamabad 45320 (Pakistan); Usman, Muhammad, E-mail: uk_phy@yahoo.com [Department of Physics, Faculty of Natural Sciences, Quaid-i-Azam University, Islamabad 45320 (Pakistan); Department of Physics, School of Science and Engineering, Lahore University of Management Sciences, Lahore 54729 (Pakistan); Tabassum, Saira; Zia, Muhammad [Department of Biotechnology, Faculty of Biological Sciences, Quaid-i-Azam University, Islamabad 45320 (Pakistan)

    2016-11-15

    Highlights: • ZnO nanoparticles have been effectively capped with polyethylene glycol (PEG) and polyvinyl pyrrolidone (PVP) shown by the data of XRD, FTIR and UV–visible spectroscopy. • Reduction in size occurred from 34 nm to 26 nm due to capping agent and band gap energy increases with the decrease in the particle size. • Antibacterial activity against Gram-positive bacteria is greater than the Gram-negative bacteria. • All biological assays reveal highest activities in capped ZnO nanoparticles as compared to the uncapped ZnO nanoparticles. • Highest antibacterial activity has been exhibited by ZnO-PVP while highest antioxidant and antidiabetic activities have been conferred by ZnO- PEG. - Abstract: Different biological activities of capped and uncapped ZnO nanoparticles were investigated, and the effects of potential capping agents on these biological activities were studied. ZnO nanoparticles were synthesized and capped by polyethylene glycol (PEG) and polyvinyl pyrrolidone (PVP) using a simple chemical method of co-precipitation. Characterization by X-ray diffraction (XRD), Fourier transform Infrared spectroscopy (FTIR) and UV–vis spectroscopy confirmed the crystallinity, size, functional group, and band gap of synthesized nanoparticles. Reduction in size occurred from 34 nm to 26 nm due to surfactant. Results of all biological activities indicated significantly higher values in capped as compared to uncapped nanoparticles. Antibacterial activity against Staphylococcus aureus (ATCC 6538), Bacillus subtilis (ATCC 6633), Escherichia coli (ATCC15224), and Acetobacter was obtained. This activity was more prominent against Gram-positive bacteria, and ZnO-PVP nanoparticles elucidated highest antibacterial activity (zone of inhibition 17 mm) against Gram-positive, Bacillus subtilis species. Antioxidant activities including total flavonoid content, total phenolic content, total antioxidant capacity, total reducing power and %age inhibition of DPPH, and

  7. Simple Synthesis and Luminescence Characteristics of PVP-Capped GeO2 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Wei Wu

    2011-01-01

    Full Text Available Polyvinylpyrrolidone (PVP-capped rutile GeO2 nanoparticles were synthesized through a facile hydrothermal process. The obtained nanoparticles were characterized by X-ray diffraction (XRD, transmission electron microscopy (TEM, Fourier transform infrared spectroscopy (FTIR, thermo gravimetric analysis (TGA, and photoluminescence spectroscopy (PL. The capped GeO2 nanoparticles showed significantly enhanced luminescence properties compared with those of the uncapped ones. We attributed this result to the effect of reducing surface defects and enhancing the possibility of electron-hole recombination of the GeO2 nanoparticles by the PVP molecules. PVP-capped GeO2 nanoparticles have potential application in optical and electronic fields.

  8. Alkylamine capped metal nanoparticle "inks" for printable SERS substrates, electronics and broadband photodetectors.

    Science.gov (United States)

    Polavarapu, Lakshminarayana; Manga, Kiran Kumar; Yu, Kuai; Ang, Priscilla Kailian; Cao, Hanh Duyen; Balapanuru, Janardhan; Loh, Kian Ping; Xu, Qing-Hua

    2011-05-01

    We report a facile and general method for the preparation of alkylamine capped metal (Au and Ag) nanoparticle "ink" with high solubility. Using these metal nanoparticle "inks", we have demonstrated their applications for large scale fabrication of highly efficient surface enhanced Raman scattering (SERS) substrates by a facile solution processing method. These SERS substrates can detect analytes down to a few nM. The flexible plastic SERS substrates have also been demonstrated. The annealing temperature dependent conductivity of the nanoparticle films indicated a transition temperature above which high conductivity was achieved. The transition temperature could be tailored to the plastic compatible temperatures by using proper alkylamine as the capping agent. The ultrafast electron relaxation studies of the nanoparticle films demonstrated that faster electron relaxation was observed at higher annealing temperatures due to stronger electronic coupling between the nanoparticles. The applications of these highly concentrated alkylamine capped metal nanoparticle inks for the printable electronics were demonstrated by printing the oleylamine capped gold nanoparticles ink as source and drain for the graphene field effect transistor. Furthermore, the broadband photoresponse properties of the Au and Ag nanoparticle films have been demonstrated by using visible and near-infrared lasers. These investigations demonstrate that these nanoparticle "inks" are promising for applications in printable SERS substrates, electronics, and broadband photoresponse devices. © The Royal Society of Chemistry 2011

  9. Removal of Protein Capping Enhances the Antibacterial Efficiency of Biosynthesized Silver Nanoparticles

    Science.gov (United States)

    Jain, Navin; Bhargava, Arpit; Rathi, Mohit; Dilip, R. Venkataramana; Panwar, Jitendra

    2015-01-01

    The present study demonstrates an economical and environmental affable approach for the synthesis of “protein-capped” silver nanoparticles in aqueous solvent system. A variety of standard techniques viz. UV-visible spectroscopy, transmission electron microscopy (TEM), energy dispersive spectroscopy (EDS) and X-ray diffraction (XRD) measurements were employed to characterize the shape, size and composition of nanoparticles. The synthesized nanoparticles were found to be homogenous, spherical, mono-dispersed and covered with multi-layered protein shell. In order to prepare bare silver nanoparticles, the protein shell was removed from biogenic nanoparticles as confirmed by UV-visible spectroscopy, FTIR and photoluminescence analysis. Subsequently, the antibacterial efficacy of protein-capped and bare silver nanoparticles was compared by bacterial growth rate and minimum inhibitory concentration assay. The results revealed that bare nanoparticles were more effective as compared to the protein-capped silver nanoparticles with varying antibacterial potential against the tested Gram positive and negative bacterial species. Mechanistic studies based on ROS generation and membrane damage suggested that protein-capped and bare silver nanoparticles demonstrate distinct mode of action. These findings were strengthened by the TEM imaging along with silver ion release measurements using inductively coupled plasma atomic emission spectroscopy (ICP-AES). In conclusion, our results illustrate that presence of protein shell on silver nanoparticles can decrease their bactericidal effects. These findings open new avenues for surface modifications of nanoparticles to modulate and enhance their functional properties. PMID:26226385

  10. Visible Light-Assisted Photoreduction of Graphene Oxide Using CdS Nanoparticles and Gas Sensing Properties

    Directory of Open Access Journals (Sweden)

    Amirhossein Hasani

    2015-01-01

    Full Text Available Graphene oxide sheets suspended in ethanol interact with excited CdS nanoparticles and contributed to photocatalytic reduction by accepting electron from nanoparticle. The UV-Vis measurement showed that electrical absorbance of the CdS/graphene oxide sheets increased by decreasing the irradiation time and after 2 h it remained constant which indicates the optimum reduction time. Furthermore, the direct interaction between CdS nanoparticles and graphene sheets hinders the collapse of exfoliated sheets of graphene. The 4-point probe measurement of nanocomposite with different ratios of graphene oxide in CdS solution after irradiation shows that the conductivity of them increased by increasing the amount of GO, but further increasing causes incomplete photo reduction process due to exorbitance increasing GO sheets which contribute to decreasing the conductivity. The CdS/RGO composite material can be used as a gas sensor for CO2 based on its electrocatalytic behavior. The low-cost and easy fabrication sensor shows rapid response and high sensitivity. By varying the amount of GO the optimum concentration which shows high sensitivity is found and its good performance compared with other is attributed to its higher conductivity due to complete reduction. Moreover, the effects of thermal annealing on the conductivity of CdS/RGO film and the performance of devices are researched.

  11. Synergistic Effect of Fullerene-Capped Gold Nanoparticles on Graphene Electrochemical Supercapacitors

    OpenAIRE

    Yong, Virginia; Hahn, H. Thomas

    2013-01-01

    We report the synthesis of graphene/fullerene-capped gold nanoparticle nanocomposite film which was used to construct supercapacitor electrodes. The fullerene-based self-assembled monolayers on gold nanoparticles (AuNPs) were attained via the fullerene(C60)-gold interaction. The fullerene-capped AuNPs effectively separated the graphene sheets preventing aggregation. A synergistic effect was observed—the specific capacitance of graphene/fullerene-capped AuNP electrode is 197 F/g, which is high...

  12. Synthesis of water soluble glycine capped silver nanoparticles and their surface selective interaction

    Energy Technology Data Exchange (ETDEWEB)

    Agasti, Nityananda, E-mail: nnagasti@gmail.com [Department of Chemistry, University of Delhi, Delhi 110007 (India); Singh, Vinay K. [Department of Chemistry, Sri Aurobindo College, University of Delhi, Delhi 110017 (India); Kaushik, N.K. [Department of Chemistry, University of Delhi, Delhi 110007 (India)

    2015-04-15

    Highlights: • Synthesis of water soluble silver nanoparticles at ambient reaction conditions. • Glycine as stabilizing agent for silver nanoparticles. • Surface selective interaction of glycine with silver nanoparticles. • Glycine concentration influences crystalinity and optical property of silver nanoparticles. - Abstract: Synthesis of biocompatible metal nanoparticles has been an area of significant interest because of their wide range of applications. In the present study, we have successfully synthesized water soluble silver nanoparticles assisted by small amino acid glycine. The method is primarily based on reduction of AgNO{sub 3} with NaBH{sub 4} in aqueous solution under atmospheric air in the presence of glycine. UV–vis spectroscopy, transmission electron microscopy (TEM), X–ray diffraction (XRD), Fourier transform infrared (FTIR) spectroscopy, thermogravimetry (TG) and differential thermal analysis (DTA) techniques used for characterization of resulting silver nanoparticles demonstrated that, glycine is an effective capping agent to stabilize silver nanoparticles. Surface selective interaction of glycine on (1 1 1) face of silver nanoparticles has been investigated. The optical property and crystalline behavior of silver nanoparticles were found to be sensitive to concentration of glycine. X–ray diffraction studies ascertained the phase specific interaction of glycine on silver nanoparticles. Silver nanoparticles synthesized were of diameter 60 nm. We thus demonstrated an efficient synthetic method for synthesis of water soluble silver nanoparticles capped by amino acid under mild reaction conditions with excellent reproducibility.

  13. Structural, optical, and catalytic properties of undoped and CdS doped CuO-ZnO nanoparticles

    Science.gov (United States)

    Younas, Naeem; Farrukh, Muhammad Akhyar; Ali, Shaista; Ditta, Maryam Allah; Adnan, Rohana

    2017-11-01

    The structural, optical and catalytic properties of undoped (CuO-ZnO) and CdS doped CuO-ZnO (CdS/CuO-ZnO) nanoparticles were studied. The blue shifting of optical band gap in CuO-ZnO nanoparticles as compared to their respective bulk oxides (CuO: 1.21-1.5 eV, ZnO: 3.37 eV) was observed as 3.9 eV, while red shifting after doping of CdS was found from 3.9 to 3.7 eV. The angle of diffraction and FWHM values were used to observe crystallite phase and to calculate crystallite size (using Scherer and Williamson-Hall equations) and other parameters like strain, dislocation density and bond length of nanoparticles. The particle size of CuO-ZnO and CdS/CuO-ZnO nanoparticles using transmission electron microscopy (TEM) was found 12.54 and 6.93 nm, respectively. It was concluded that decrease in particle size cause red shifting which increase the catalytic efficiency of nanoparticles.

  14. Solid state synthesis of starch-capped silver nanoparticles.

    Science.gov (United States)

    Hebeish, A; Shaheen, Th I; El-Naggar, Mehrez E

    2016-06-01

    The present research addresses the establishment of a technique which is solely devoted to environmentally friendly one-pot green synthesis of dry highly stable powdered silver nanoparticles (AgNPs) using starch as both reductant and stabilizing agent in the presence of sodium hydroxide. It is believed that the sodium hydroxide can improve the reduction potential of starch. Thus when the alkali treated starch is submitted to addition of silver nitrate (AgNO3), the alkali treated starch induces the well-established dual role of starch; reduction of silver ions (Ag(+)) to AgNPs and capping the as-formed AgNPs to prevent them from further growth and agglomeration. Beside assessment of AgNPs formation, structural and morphological characteristics of AgNPs are investigated by making use of UV-vis spectroscopy, transmission electron microscopy (TEM), dynamic light scattering (DLS), zeta potential, FT-IR and X-ray diffraction (XRD) analysis. Research outputs signify (a) the absorbance around 410-420nm in the UV-vis spectra of AgNPs appears most, probably owing to the presence of nanosized silver particles and the intensity of this peak increases by increasing AgNO3 concentration; (b) that highly stable AgNPs with well-dispersed particle are successfully prepared using the present research-based innovation; (c) that the size of AgNPs does not exceed 30nm with sphere-like morphology even at the highest Ag(+) concentration employed during synthesis operation; (d) that the XRD and FT-IR confirm the successful preparation of pure AgNPs without noticeable impurities; (d) and that the one-pot synthesis of powdered AgNPs in large scale is clean and easily operated and easily transportation which may be applied as per demands of industries such as textile and painting industry. Copyright © 2016. Published by Elsevier B.V.

  15. Attenuated effects of chitosan-capped gold nanoparticles on LPS-induced toxicity in laboratory rats

    Energy Technology Data Exchange (ETDEWEB)

    Stefan, Marius [Department of Biology, ' Alexandru Ioan Cuza' University, B-dul Carol I, No. 11, Iasi, 700506 (Romania); Melnig, Viorel; Pricop, Daniela [COMB Laboratory, ' Alexandru Ioan Cuza' University, B-dul Carol I, No. 11, Iasi, 700506 (Romania); Neagu, Anca; Mihasan, Marius [Department of Biology, ' Alexandru Ioan Cuza' University, B-dul Carol I, No. 11, Iasi, 700506 (Romania); Tartau, Liliana [' Gr.T. Popa' , University of Medicine and Pharmacy, 16 University Str., Iasi, 700115 (Romania); Hritcu, Lucian, E-mail: hritcu@uaic.ro [Department of Biology, ' Alexandru Ioan Cuza' University, B-dul Carol I, No. 11, Iasi, 700506 (Romania)

    2013-01-01

    The impact of nanoparticles in medicine and biology has increased rapidly in recent years. Gold nanoparticles (AuNP) have advantageous properties such as chemical stability, high electron density and affinity to biomolecules. However, the effects of AuNP on human body after repeated administration are still unclear. Therefore, the purpose of the present study was to evaluate the effects of gold-11.68 nm (AuNP1, 9.8 {mu}g) and gold-22.22 nm (AuNP2, 19.7 {mu}g) nanoparticles capped with chitosan on brain and liver tissue reactivity in male Wistar rats exposed to lipopolysaccharide (LPS from Escherichia coli serotype 0111:B4, 250 {mu}g) upon 8 daily sessions of intraperitoneal administration. Our results suggest that the smaller size of chitosan-capped AuNP shows the protective effects against LPS-induced toxicity, suggesting a very high potential for biomedical applications. - Highlights: Black-Right-Pointing-Pointer Smaller size of chitosan-capped gold nanoparticles acts against LPS-induced toxicity. Black-Right-Pointing-Pointer Larger size of chitosan-capped gold nanoparticles agglomerated inside neurons and induced toxicity in combination with LPS. Black-Right-Pointing-Pointer Chitosan has excellent biocompatible proprieties. Black-Right-Pointing-Pointer Smaller size of chitosan-capped gold nanoparticles demonstrates great potential in biomedical applications.

  16. Low-temperature biosynthesis of fluorescent semiconductor nanoparticles (CdS) by oxidative stress resistant Antarctic bacteria.

    Science.gov (United States)

    Gallardo, C; Monrás, J P; Plaza, D O; Collao, B; Saona, L A; Durán-Toro, V; Venegas, F A; Soto, C; Ulloa, G; Vásquez, C C; Bravo, D; Pérez-Donoso, J M

    2014-10-10

    Bacterial biosynthesis of nanoparticles represents a green alternative for the production of nanostructures with novel properties. Recently, the importance of antioxidant molecules on the biosynthesis of semiconductor fluorescent nanoparticles (quantum dots, QDs) by mesophilic bacteria was reported. The objective of this work was the isolation of psychrotolerant, oxidative stress-resistant bacteria from Antarctica to determine their ability for biosynthesizing CdS QDs at low temperatures. QDs biosynthesis at 15 °C was evaluated by determining their spectroscopic properties after exposing oxidative-stress resistant isolates identified as Pseudomonas spp. to Cd(2+) salts. To characterize the QDs biosynthetic process, the effect of metal exposure on bacterial fluorescence was determined at different times. Time-dependent changes in fluorescence color (green to red), characteristic of QDs, were observed. Electron microscopy analysis of fluorescent cells revealed that biosynthesized nanometric structures localize at the cell periphery. QDs were purified from the bacterial isolates and their fluorescence properties were characterized. Emission spectra displayed classical CdS peaks when excited with UV light. Thiol content, peroxidase activity, lipopolysaccharide synthesis, metabolic profiles and sulfide generation were determined in QDs-producing isolates. No relationship between QDs production and cellular thiol content or peroxidase activity was found. However, sulfide production enhanced CdS QDs biosynthesis. In this work, the use of Antarctic psychrotolerant Pseudomonas spp. for QDs biosynthesis at low temperature is reported for the first time. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. The contribution of capping layer dielectric properties to nanoparticle stability

    NARCIS (Netherlands)

    Galanis, J.; Sood, A.; Gill, Ron; Harries, D.

    2015-01-01

    A surge in research aimed at both synthesis and application of colloidal nanoparticles occurred in recent decades. Many biological and biomedical applications with nanoparticles depend on specifically tailored surface modifications that enable dispersion stability in high salt buffers. To address

  18. Genotoxic effects of CdS quantum dots and Ag2S nanoparticles in fish cell lines (RTG-2).

    Science.gov (United States)

    Munari, Marco; Sturve, Joachim; Frenzilli, Giada; Sanders, Matthew B; Brunelli, Andrea; Marcomini, Antonio; Nigro, Marco; Lyons, Brett P

    2014-12-01

    The increasing use of nanotechnologies will lead to significant releases of engineered nanoparticles into the aquatic environment, where their impact is still poorly characterized. In the present paper, the genotoxic and cytotoxic properties of CdS quantum dots (QDs) and silver sulphide (Ag2S) coated with methyl polyethylene glycol (M-PEG) were investigated in a rainbow trout cell line (RTG-2). The results showed that CdS QDs were highly cytotoxic at high concentrations (10 and 50μg/ml), and exhibited a concentration-dependent genotoxicity in the sub-toxic range (0.01-1μg/ml) after 24h exposure. Ag2S showed neither genotoxic nor cytotoxic effects. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. Studies on the chemical synthesis and characterization of lead oxide nanoparticles with different organic capping agents

    Energy Technology Data Exchange (ETDEWEB)

    Arulmozhi, K. T., E-mail: arulsheelphy@gmail.com [Physics Wing (DDE), Annamalai University, Tamil Nadu, India - 608 002 (India); Mythili, N. [Department of Physics, Annamalai University, Tamil Nadu, India - 608 002 (India)

    2013-12-15

    Lead oxide (PbO) nanoparticles were chemically synthesized using Lead (II) acetate as precursor. The effects of organic capping agents such as Oleic acid, Ethylene Diamine Tetra Acetic acid (EDTA) and Cetryl Tri Methyl Butoxide (CTAB) on the size and morphology of the nanoparticles were studied. Characterization techniques such as X-ray diffraction (XRD), Fourier Transform-Infrared spectroscopy (FT-IR), Photoluminescence (PL) Field Emission Scanning Electron Microscopy (FE-SEM), Energy Dispersive Spectroscopy (EDS) and Transmission Electron Microscopy (TEM) were used to analyse the prepared nanoparticles for their physical, structural and optical properties. The characterization studies reveal that the synthesized PbO nanoparticles had well defined crystalline structure and sizes in the range of 25 nm to 36 nm for capping agents used and 40 nm for pure PbO nanoparticles.

  20. Effect of temperature, precursor concentration and capping group on the shape of Cds nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2009-01-01

    Full Text Available as a fungicide to protect seeds, fruit, vegetables, ornamentals, turf crops, and herbs from a variety of fungal diseases. In a biological study it was observed that thiram reacts with copper and lead metals to enhance the uptake of these metals...

  1. Effect of precursor concentration, temperature and capping group on the morphology of CdS nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2008-01-01

    Full Text Available ), tetramethylthiuram monosulphide (TMTM) and dipentamethylenethiuram disulphide (PTD) are sulphur containing compounds which speed up vulcanization, i.e. they are 'accelerators'.2 Thiram (tetramethylthiuram disulphide) is used as a fungicide to protect seeds, fruit...

  2. Photoluminescence of urea- and urea/rhodamine B-capped TiO{sub 2} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalo-Juan, I., E-mail: gonzalo@materials.tu-darmstadt.de; Macé, L.; Tengeler, S.; Mosallem, A.; Nicoloso, N.; Riedel, R.

    2016-07-01

    Urea- and rhodamine B (RhB)-capped TiO{sub 2} nanoparticles (NPs) have been prepared by solvothermal synthesis and characterized by HRTEM, XRD, FTIR, XPS, optical absorption and photoemission. The urea and urea/RhB ligands are capped to the surface of the TiO{sub 2} NPs for the first time through carbamate bonding. The band gap of TiO{sub 2} is slightly reduced from 3.1 eV to 3.0 eV in the urea capped TiO{sub 2} NPs (TU) and 2.9 eV for the NPs capped with urea/RhB (TUR). The generation of new trapping states in TU and TUR at the conduction band edges (surface oxygen vacancies) has been confirmed by the Urbach law providing tail state energies of 180 meV and 270 meV, respectively. These tail states are considered to be responsible for the strong reduction of the photoluminescence at ≈400 nm and the increased emission at ≈600 nm in TU and TUR. The findings suggest that urea- and RhB-capped TiO{sub 2} NPs could have potential applications as photocatalysts, opto-electronic devices, sensors, biological labels and anti-bacterial agents. - Highlights: • Urea- and urea/rhodamine B (RhB)-capped TiO{sub 2} nanoparticles preparation. • Characterization of optical properties of urea- and urea/rhodamine B (RhB)-capped TiO{sub 2} nanoparticles. • The recombination of electrons and holes is significantly reduced in the capped TiO{sub 2} nanoparticles, in comparison with TiO{sub 2}.

  3. Synthesis, stabilisation and characterisation of rhamnolipid-capped ZnS nanoparticles in aqueous medium.

    Science.gov (United States)

    Narayanan, J; Ramji, R; Sahu, H; Gautam, P

    2010-06-01

    Capping agents stabilise the size of the nanoparticles in the range of 1-10 nm. Microbial surfactants as capping agents are beneficial replacements for chemically synthesised ones because of lower toxicity. Rhamnolipids are surfactants produced by Pseudomonas aeruginosa, having high affinity for metal ions. In this study, the authors used rhamnolipids for capping ZnS nanoparticles. The capped particles were stabilised in aqueous environment and its characteristics were studied using Fourier transform infrared spectroscopy (FT-IR), small angle X-ray scattering (SAXS), high resolution transmission electron microscopy (HR-TEM) and ultraviolet-visible spectra, fluorescence spectra. The particle Bohr radius was found to be 4.5 nm both by SAXS and HRTEM, thus proving rhamnolipid to be an effective capping agent for the synthesis of uniform nanoparticles. SAXS study not only reveals the particle size and distribution but also its self-affined agglomeration behaviour. This work is a novel method for stabilising nanoparticles in aqueous condition using biosurfactant.

  4. Fullerenol-Capped Porous Silica Nanoparticles for pH-Responsive Drug Delivery

    Directory of Open Access Journals (Sweden)

    Nikola Ž. Knežević

    2015-01-01

    Full Text Available Novel nanocomposite containing fullerenol nanoparticles (FNP and porous silica nanoparticles (PSNs was constructed and characterized. The capability of FNP to serve as a pore-capping agent and for entrapping 9-aminoacridine (9-AA inside the pores of the PSN material was also demonstrated. Nitrogen sorption measurements evidence the successful capping of the silica pores while thermogravimetric analysis of FNP loaded PSN indicates the existence of pore-loaded fullerenol molecules. Higher amount of the drug release was noted by exposing the material to weakly acidic conditions in comparison to physiological pH, which may find application in targeted treatment of weakly acidic tumor tissues.

  5. Free Energy of Bare and Capped Gold Nanoparticles Permeating through a Lipid Bilayer.

    Science.gov (United States)

    Mhashal, Anil R; Roy, Sudip

    2016-11-04

    Herein, we study the permeation free energy of bare and octane-thiol-capped gold nanoparticles (AuNPs) translocating through a lipid membrane. To investigate this, we have pulled the bare and capped AuNPs from bulk water to the membrane interior and estimated the free energy cost. The adsorption of the bare AuNP on the bilayer surface is energetically favorable but further loading inside it requires energy. However, the estimated free-energy barrier for loading the capped AuNP into the lipid membrane is much higher compared to bare AuNP. We also demonstrate the details of the permeation process of bare and capped AuNPs. Bare AuNP induces the curvature in the lipid membrane whereas capped AuNP creates an opening in the interacting monolayer and get inserted into the membrane. The insertion of capped AuNP induces a partial unzipping of the lipid bilayer, which results in the ordering of the local lipids interacting with the nanoparticle. However, bare AuNP disrupts the lipid membrane by pushing the lipid molecules inside the membrane. We also analyze pore formation due to the insertion of capped AuNP into the membrane, which results in water molecules penetrating the hydrophobic region. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. γ-Cyclodextrin capped silver nanoparticles for molecular recognition and enhancement of antibacterial activity of chloramphenicol.

    Science.gov (United States)

    Gannimani, Ramesh; Ramesh, Muthusamy; Mtambo, Sphamandla; Pillay, Karen; Soliman, Mahmoud E; Govender, Patrick

    2016-04-01

    Computational studies were conducted to identify the favourable formation of the inclusion complex of chloramphenicol with cyclodextrins. The results of molecular docking and molecular dynamics predicted the strongest interaction of chloramphenicol with γ-cyclodextrin. Further, the inclusion complex of chloramphenicol with γ-cyclodextrin was experimentally prepared and a phenomenon of inclusion was verified by using different characterization techniques such as thermogravimetric analysis, differential scanning calorimetry, (1)H nuclear magnetic resonance (NMR) and two dimensional nuclear overhauser effect spectroscopy (NOESY) experiments. From these results it was concluded that γ-cyclodextrins could be an appropriate cyclodextrin polymer which can be used to functionalize chloramphenicol on the surface of silver nanoparticles. In addition, γ-cyclodextrin capped silver nanoparticles were synthesized and characterized using UV-visible spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), energy dispersive X-ray analysis (EDX), Fourier transform infrared spectroscopy (FTIR) and zeta potential analysis. Molecular recognition of chloramphenicol by these cyclodextrin capped silver nanoparticles was confirmed by surface enhanced raman spectroscopy (SERS) experiments. Synergistic antibacterial effect of chloramphenicol with γ-cyclodextrin capped silver nanoparticles was evaluated against Pseudomonas aeruginosa (ATCC 27853), Enterococcus faecalis (ATCC 5129), Klebsiella pneumoniae (ATCC 700603) and Staphylococcus aureus (ATCC 43300). The results from the antibacterial experiment were favourable thus allowing us to conclude that the approach of modifying organic drug molecules with cyclodextrin capped inorganic silver nanoparticles could help to enhance the antibacterial activity of them. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Solution-processable carboxylate-capped CuO nanoparticles obtained by a simple solventless method

    Energy Technology Data Exchange (ETDEWEB)

    Estruga, Marc [Universitat Autonoma de Barcelona, Department of Chemistry (Spain); Roig, Anna; Domingo, Concepcion [CSIC, Institut de Ciencia de Materials de Barcelona (Spain); Ayllon, Jose A., E-mail: joseantonio.ayllon@uab.es [Universitat Autonoma de Barcelona, Department of Chemistry (Spain)

    2012-08-15

    Carboxylate-capped CuO nanoparticles were obtained via a simple solventless route, based on the thermal decomposition at 120 Degree-Sign C of solid precursors. The reaction mixture consisted of copper acetate monohydrate, acting as the CuO precursor, and different organic carboxylic acids (lauric, phenylvaleric or 3,6,9-trioxadecanoic acid) used as the capping agent. The proposed method, in good agreement with environmentally friendly practices, produced dry nanoparticles, thereby totally eliminating the need of washing, filtration, or other downstream steps. Transmission electron micrographs show crystalline roughly spherical CuO nanoparticles with average diameters between 3.1 and 5.5 nm depending on the capping ligand. The laurate-capped CuO nanoparticles showed a paramagnetic behaviour at room temperature, while a weak ferromagnetic component was detected at low temperature (<40 K). It was also proved that the chemical structure of the carboxylic acid tail enabled the straightforward dispersibility of nanoparticles in common solvents and assisted in the deposition of the material as thin films.

  8. Photosensitization of TiO2 P25 with CdS Nanoparticles for Photocatalytic Applications

    Directory of Open Access Journals (Sweden)

    Trenczek-Zając A.

    2017-06-01

    Full Text Available A TiO2/CdS coupled system was prepared by mixing the TiO2 P25 with CdS synthesized by means of the precipitation method. It was found that the specific surface area (SSA of both components is extremely different and equals 49.5 for TiO2 and 145.4 m2·g−1 for CdS. The comparison of particle size distribution and images obtained by means of transmission electron microscopy (TEM showed agglomeration of nanocomposites. X-ray diffraction (XRD patterns suggest that CdS crystallizes in a mixture of cubic and hexagonal phases. Optical reflectance spectra revealed a gradual shift of the fundamental absorption edge towards longer wavelengths with increasing CdS molar fraction, which indicates an extension of the absorption spectrum of TiO2. The photocatalytic activity in UV and UV-vis was tested with the use of methyl orange (MO. The Langmuir–Hinshelwood model described well the photodegradation process of MO. The results showed that the photocatalytic behaviour of the TiO2/CdS mixture is significantly better than that of pure nanopowders.

  9. Sensitization of CdS nanoparticles onto reduced graphene oxide (RGO) fabricated by chemical bath deposition method for effective removal of Cr(VI)

    Energy Technology Data Exchange (ETDEWEB)

    Pawar, Rajendra C.; Lee, Caroline Sunyong, E-mail: sunyong523@gmail.com

    2013-09-16

    RGO (Reduced Graphene Oxide)–CdS composites were successfully synthesized by chemical bath deposition (CBD) method onto soda lime glass substrate at low temperature (70 °C). Their structural, optical and morphological properties were studied using X-ray diffraction, UV–Vis spectrophotometer, Raman spectroscopy, Brunauer–Emmett–Teller, Field emission scanning electron microscope and transmission electron microscope. It is clearly seen that spherically shaped CdS nanoparticles with an average diameter 30 nm are uniformly coated over the entire graphene sheet. Further, synthesized CdS nanoparticles and RGO–CdS nanocomposites were investigated for the reduction of Cr(VI) under visible light. The photocatalytic results show that photodegradation rate of RGO–CdS composites is two times higher than that of CdS nanoparticles toward reduction of Cr(VI). The improved photocatalytic performance by combining RGO with CdS nanoparticles, is attributed to its increased specific surface area (47.44 m{sup 2} g{sup −1}), efficient transportation of photoelectrons and improved absorbance of CdS nanoparticles. Therefore, it was found that RGO in RGO–CdS composites makes a significant impact on photocatalytic activity toward reduction of Cr(VI), making an excellent candidate for water refiner. - Graphical abstract: Display Omitted - Highlights: • Chemical bath deposition was used to deposit CdS nanoparticles over graphene sheets. • RGO/CdS shows effective photocatalytic reduction of Cr(VI) under visible light. • High photocurrent of RGO/CdS proved reduction in recombination due to graphene. • High specific surface area (47.44 m{sup 2} g{sup −1}) of RGO/CdS improves Cr(VI) adsorption.

  10. Sum Frequency Generation Vibrational Spectroscopy of Colloidal Platinum Nanoparticle Catalysts: Disordering versus Removal of Organic Capping

    KAUST Repository

    Krier, James M.

    2012-08-23

    Recent work with nanoparticle catalysts shows that size and shape control on the nanometer scale influences reaction rate and selectivity. Sum frequency generation (SFG) vibrational spectroscopy is a powerful tool for studying heterogeneous catalysis because it enables the observation of surface intermediates during catalytic reactions. To control the size and shape of catalytic nanoparticles, an organic ligand was used as a capping agent to stabilize nanoparticles during synthesis. However, the presence of an organic capping agent presents two major challenges in SFG and catalytic reaction studies: it blocks a significant fraction of active surface sites and produces a strong signal that prevents the detection of reaction intermediates with SFG. Two methods for cleaning Pt nanoparticles capped with poly (vinylpyrrolidone) (PVP) are examined in this study: solvent cleaning and UV cleaning. Solvent cleaning leaves more PVP intact and relies on disordering with hydrogen gas to reduce the SFG signal of PVP. In contrast, UV cleaning depends on nearly complete removal of PVP to reduce SFG signal. Both UV and solvent cleaning enable the detection of reaction intermediates by SFG. However, solvent cleaning also yields nanoparticles that are stable under reaction conditions, whereas UV cleaning results in aggregation during reaction. The results of this study indicate that solvent cleaning is more advantageous for studying the effects of nanoparticle size and shape on catalytic selectivity by SFG vibrational spectroscopy. © 2012 American Chemical Society.

  11. CdS nanoparticles immobilized on porous carbon polyhedrons derived from a metal-organic framework with enhanced visible light photocatalytic activity for antibiotic degradation

    Science.gov (United States)

    Yang, Cao; Cheng, Jianhua; Chen, Yuancai; Hu, Yongyou

    2017-10-01

    The CdS/MOF-derived porous carbon (MPC) composite as an efficient visible-light-driven photocatalyst was prepared through the pyrolysis of ZIF-8 and subsequent growth of CdS. The porous and functionalized MPC enables intimate and discrete growth of CdS nanoparticles. This unique structure not only reduces the bulk recombination owing to nano-size effect of CdS, but also suppresses the surface recombination due to the discrete growth of CdS nanoparticles on MPC polyhedrons, which facilitates electron transfer and charge separation. Moreover, such a composite material possessed good adsorption ability toward the antibiotic pollutants because of the amino-functionalized surface. As a result, the as-prepared CdS/MPC composites showed excellent photocatalytic performance for the antibiotic degradation, significantly improving the photoactivity of CdS. Importantly, the CdS/MPC composite with the CdS loading of 20 wt% exhibited the highest photocatalytic efficiency of approximately 91% and apparent rate constant of 0.024 min-1.

  12. Keratin capped silver nanoparticles - synthesis and characterization of a nanomaterial with desirable handling properties

    Science.gov (United States)

    Silver nanoparticles (NPs) were produced with keratin stabilizer and the NPs exhibited unimodal Gaussian distribution with average diameter of 3.5nm +/- 0.7 nm. The molecular mass of keratin stabilizer was 6-8 kDa. The mass of keratin capped NPs was >250 kDa to indicate the formation of crosslinked...

  13. The Role of Surface-Capping Ligands in Photoexcited Electron Transfer Between CdS Nanorods and [FeFe] Hydrogenase and the Subsequent H 2 Generation

    Energy Technology Data Exchange (ETDEWEB)

    Wilker, Molly B.; Utterback, James K.; Greene, Sophie; Brown, Katherine A.; Mulder, David W.; King, Paul W.; Dukovic, Gordana

    2017-12-08

    Complexes of CdS nanorods and [FeFe] hydrogenase from Clostridium acetobutylicum have been shown to photochemically produce H2. This study examines the role of the ligands that passivate the nanocrystal surfaces in the electron transfer from photoexcited CdS to hydrogenase and the H2 generation that follows. We functionalized CdS nanorods with a series of mercaptocarboxylate surface-capping ligands of varying lengths and measured their photoexcited electron relaxation by transient absorption (TA) spectroscopy before and after hydrogenase adsorption. Rate constants for electron transfer from the nanocrystals to the enzyme, extracted by modeling of TA kinetics, decrease exponentially with ligand length, suggesting that the ligand layer acts as a barrier to charge transfer and controls the degree of electronic coupling. Relative light-driven H2 production efficiencies follow the relative quantum efficiencies of electron transfer, revealing the critical role of surface-capping ligands in determining the photochemical activity of these nanocrystal-enzyme complexes. Our results suggest that the H2 production in this system could be maximized with a choice of a surface-capping ligand that decreases the distance between the nanocrystal surface and the electron injection site of the enzyme.

  14. Effect of pH and biological media on polyvinylpyrrolidone-capped silver nanoparticles

    Science.gov (United States)

    Lau, Chew Ping; Abdul-Wahab, Mohd Firdaus; Jaafar, Jafariah; Chan, Giek Far; Rashid, Noor Aini Abdul

    2016-07-01

    Toxicity and mobility of silver nanoparticles (AgNPs) vary in different surrounding environments. Surface coatings or functionalization, temperature, pH, dissolved oxygen concentration, nanoparticle concentration, the presence of organic matter, and ionic strength are factors which dictate the transformation of AgNPs in terms of aggregation and stabilization. Thus, the purpose of this study is to investigate the behavior of polyvinylpyrrolidone (PVP)-capped AgNPs at different pHs (pH 2 to 10) and in different biological media (0.1 M phosphate buffer, nutrient broth, P5 and modified P5 media) analyzed using UV-Vis spectroscopy and zeta potential analyzer. The PVP-capped AgNPs changed its behavior in the presence of varying media, after 24 h incubation with shaking at 200 rpm at 30°C. No aggregation was observed at pH 4 to 10, but distinctive at very low pH of 2. Low pH further destabilized PVP-capped AgNPs after 24 h of incubation. High ionic strength 0.1 M phosphate buffer also resulted in slow aggregation and eventually destabilized the nanoparticles. Biological media (nutrient broth, P5 and modified P5 media) containing organic components caused aggregation of the PVP-capped AgNPs. The increase in glucose and nutrient broth concentrations led to increased aggregation. However, PVP-capped AgNPs stabilized after 24 h incubation in media containing a high concentration of glucose and nutrient broth. The results demonstrate that low pH value, high ionic strength and the content of the biological media can influence the stability of AgNPs. This provides information on the aggregation behavior of PVP-capped AgNPs and can possibly further predict the fate, transport as well as the toxicity of silver nanoparticles after being released into the aquatic environment.

  15. INTERACTION OF SILVER MOLECULAR CLUSTERS, INTRODUCED BY LOW-TEMPERATURE ION EXCHANGE METHOD, WITH NANOPARTICLES OF CdS IN FLUORINE PHOSPHATE GLASSES

    Directory of Open Access Journals (Sweden)

    N. D. Grazhdanov

    2015-09-01

    Full Text Available Glasses with metallic and semi-conductive nano-particles appear to be perspective non-linear and luminescent materials of photonics. It was shown in theory that composite optical materials containing semi-conductive CdS-core with Ag shell (or vice versa are optimal for enhancement of non-linear Kerr effect. Interaction of such an ensemble of particles leads to the forming of Ag island structures on the CdS particle, and formation of acanthite Ag2S on the two phases border (CdS-Ag is minimal. In glasses synthesis of CdS quantum dots occurred due to thermal treatment close to glass transition temperature; introduction of silver was realized by low-temperature ion exchange (LIE. The main object of this work is investigation of Ag+ -LIE effect on the growth of CdS nano-particles. Two glasses were explored in this work: without CdS (glass 1 and with CdS (glass 2, processed by LIE at the temperature of 320°С for 10, 20 and 30 minutes and subsequent heat treatment at temperatures of 410°С and 420°С. In case of glass 1, intensive luminescence appears as a result of LIE, and subsequent heat treatment results in surface resonance at λ=410 nm. In case of glass 2, absorbance spectra change appears that is specific for formation of acanthite and weak luminescence shifting to long-wavelength region (from 550 to 700 nm as a result of applying LIE and heat treatment. It indicates the growth of CdS quantum dots. Experiment has shown that quantum efficiency increases to 70% for glass 2 containing CdS quantum dots without LIE, while glass that contains silver shows steep decrease of quantum efficiency to 0%. That decrease is caused by formation of acanthite Ag2S on the surface of CdS quantum dot.

  16. Study of energy transfer from capping agents to intrinsic vacancies/defects in passivated ZnS nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Manoj, E-mail: manojnarad@gmail.co [Thapar University, School of Physics and Materials Science (India); Kumar, Sunil, E-mail: sunilkumar32@gmail.co [Maharishi Markandeshwar University, Department of Physics (India); Pandey, O. P. [Thapar University, School of Physics and Materials Science (India)

    2010-09-15

    The study of energy transfer mechanism from different capping agents to intrinsic luminescent vacancy centres of zinc sulphide (ZnS) has been reported in the present work. Nanoparticles of capped and uncapped ZnS are prepared by co-precipitation reaction. These nanoparticles are sterically stabilized using organic polymers-poly vinyl pyrrolidone, 2-mercaptoethanol and thioglycerol. Monodispersed nanoparticles were observed under TEM for both capped and uncapped ZnS nanopowders. However, for uncapped ZnS nanopowders, tendency for formation of nanorod like structure exists. Size of ZnS crystallites was calculated from X-ray diffraction pattern. The primary crystallite size estimated from X-ray diffraction pattern is 1.95-2.20 nm for capped nanostructures and 2.2 nm for uncapped nanostructures. FTIR spectra were conducted to confirm capping. Zeta potential measurements have been done to check the stability of dispersed nanoparticles. Band gap measurement was done by UV-visible spectrophotometer. Excitation and emission spectra are also performed in order to compare optical properties in various samples. Increase in emission intensity and band gap has been observed by adding different capping agents in comparison to uncapped ZnS nanoparticles. The results show that in capped ZnS nanoparticles the mechanism of energy transfer from capping layer to photoluminescent vacancy centres is more pronounced.

  17. Prolonged reorganization of thiol-capped Au nanoparticles layered structures

    Directory of Open Access Journals (Sweden)

    Sarathi Kundu

    2013-09-01

    Full Text Available Prolonged reorganization behaviour of mono-, di-, tri- and multi-layer films of Au nanoparticles prepared by Langmuir-Blodgett method on hydrophobic Si(001 substrates have been studied by using X-ray scattering techniques. Out-of-plane study shows that although at the initial stage the reorganization occurs through the compaction of the films keeping the layered structure unchanged but finally all layered structures modify to monolayer structure. Due to this reorganization the Au density increases within the nanometer thick films. In-plane study shows that inside the reorganized films Au nanoparticles are distributed randomly and the particle size modifies as the metallic core of Au nanoparticles coalesces.

  18. Facially amphiphilic thiol capped gold and silver nanoparticles

    Indian Academy of Sciences (India)

    Wintec

    Generally, gold nanoparticles are easily produced in a liquid ('liquid chemical methods') by the reduction of chloroauric acid (HAuCl4), although more advanced and precise methods exist. As the neutral gold atoms form, the solution becomes su- persaturated, and gold gradually starts to precipitate in the form of ...

  19. Quaternized Chitosan-Capped Mesoporous Silica Nanoparticles as Nanocarriers for Controlled Pesticide Release

    Directory of Open Access Journals (Sweden)

    Lidong Cao

    2016-06-01

    Full Text Available Nanotechnology-based pesticide formulations would ensure effective utilization of agricultural inputs. In the present work, mesoporous silica nanoparticles (MSNs with particle diameters of ~110 nm and pore sizes of ~3.7 nm were synthesized via a liquid crystal templating mechanism. A water-soluble chitosan (CS derivative (N-(2-hydroxylpropyl-3-trimethyl ammonium CS chloride, HTCC was successfully capped on the surface of pyraclostrobin-loaded MSNs. The physicochemical and structural analyses showed that the electrostatic interactions and hydrogen bonding were the major forces responsible for the formation of HTCC-capped MSNs. HTCC coating greatly improved the loading efficiency (LC (to 40.3% compared to using bare MSNs as a single encapsulant (26.7%. The microstructure of the nanoparticles was revealed by scanning electron microscopy (SEM and transmission electron microscopy (TEM. The pyraclostrobin-loaded nanoparticles showed an initial burst and subsequent sustained release behavior. HTCC-capped MSNs released faster than bare MSNs in the initial stage. Pyraclostrobin-loaded HTCC-capped MSNs with half doses of pyraclostrobin technical demonstrated almost the same fungicidal activity against Phomopsis asparagi (Sacc., which obviously reduced the applied pesticide and enhanced the utilization efficiency. Therefore, HTCC-decorated MSNs demonstrated great potential as nanocarriers in agrochemical applications.

  20. Quaternized Chitosan-Capped Mesoporous Silica Nanoparticles as Nanocarriers for Controlled Pesticide Release.

    Science.gov (United States)

    Cao, Lidong; Zhang, Huirong; Cao, Chong; Zhang, Jiakun; Li, Fengmin; Huang, Qiliang

    2016-06-28

    Nanotechnology-based pesticide formulations would ensure effective utilization of agricultural inputs. In the present work, mesoporous silica nanoparticles (MSNs) with particle diameters of ~110 nm and pore sizes of ~3.7 nm were synthesized via a liquid crystal templating mechanism. A water-soluble chitosan (CS) derivative (N-(2-hydroxyl)propyl-3-trimethyl ammonium CS chloride, HTCC) was successfully capped on the surface of pyraclostrobin-loaded MSNs. The physicochemical and structural analyses showed that the electrostatic interactions and hydrogen bonding were the major forces responsible for the formation of HTCC-capped MSNs. HTCC coating greatly improved the loading efficiency (LC) (to 40.3%) compared to using bare MSNs as a single encapsulant (26.7%). The microstructure of the nanoparticles was revealed by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The pyraclostrobin-loaded nanoparticles showed an initial burst and subsequent sustained release behavior. HTCC-capped MSNs released faster than bare MSNs in the initial stage. Pyraclostrobin-loaded HTCC-capped MSNs with half doses of pyraclostrobin technical demonstrated almost the same fungicidal activity against Phomopsis asparagi (Sacc.), which obviously reduced the applied pesticide and enhanced the utilization efficiency. Therefore, HTCC-decorated MSNs demonstrated great potential as nanocarriers in agrochemical applications.

  1. Synthesis and characterization of carbon or/and boron-doped CdS nanoparticles and investigation of optical and photoluminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Fakhri, Ali, E-mail: ali.fakhri88@yahoo.com [Department of Chemistry, Shahr-e-Qods Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Young Researchers and Elite Club, Science and Research Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Khakpour, Reza [Department of Physics, Tehran North Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of)

    2015-04-15

    Un-doped and carbon or/and boron doped Cadmium sulfide nanoparticles were prepared via chemical co-precipitation procedure by Polyvinyl pyrrolidone (PVP) as a stabilizer. The optical and structural properties were investigated using several techniques. The morphology of CdS nanophotocatalyst was characterized using X-ray diffraction (XRD) and scanning electron microscopy. The optical properties of both un-doped and doped samples were carried out by photoluminescence (PL) spectroscopy and UV–vis Diffuse reflectance spectra (DRS). An optimum doping level of the atoms dopant for enhanced PL properties are found through optical study. Degradation of Amoxicillin under UV light elucidation was applied to appraise the photocatalytic efficiency. The results show that the carbon and boron doping CdS nanoparticles has high potential in green chemistry. - Highlights: • Un-doped, C or/and B-doped CdS nanoparticles were successfully synthesized. • The Blue shift was observed in UV–vis absorption spectra for the doped nanoparticles. • Doping of CdS with C and B enhances the fluorescence.

  2. Structural and luminescent properties of Fe3+ doped PVA capped CdTe nanoparticles

    Directory of Open Access Journals (Sweden)

    Ravindranadh K.

    2017-07-01

    Full Text Available During recent decades, magnetic and semiconductor nanoparticles have attracted significant attention of scientists in various fields of engineering, physics, chemistry, biology and medicine. Fe3+ doped PVA capped CdTe nanoparticles were prepared by co-precipitation method and characterized by powder X-ray diffraction, SEM, TEM, FT-IR, optical, EPR and PL techniques to collect the information about the crystal structure, coordination/local site symmetry of doped Fe3+ ions in the host lattice and the luminescent properties of prepared sample. Powder XRD data revealed that the crystal structure belongs to a cubic system and its lattice cell parameters were evaluated. The average crystallite size was estimated to be 8 nm. The morphology of prepared samples was analyzed by using SEM and TEM investigations. Functional groups of the prepared sample were observed in FT-IR spectra. Optical absorption and EPR studies have shown that on doping, Fe3+ ions enter the host lattice in octahedral site symmetry. PL studies of Fe3+ doped PVA capped CdTe nanoparticles revealed UV and blue emission bands. CIE chromaticity coordinates were also calculated from the emission spectrum of Fe3+ doped PVA capped CdTe nanoparticles.

  3. Synthesis of a novel glucose capped gold nanoparticle as a better theranostic candidate.

    Directory of Open Access Journals (Sweden)

    Saritha Suvarna

    Full Text Available Gold nanoparticles are predominantly used in diagnostics, therapeutics and biomedical applications. The present study has been designed to synthesize differently capped gold nanoparticles (AuNps by a simple, one-step, room temperature procedure and to evaluate the potential of these AuNps for biomedical applications. The AuNps are capped with glucose, 2-deoxy-D-glucose (2DG and citrate using different reducing agents. This is the first report of synthesis of 2DG-AuNp by the simple room temperature method. The synthesized gold nanoparticles are characterized with UV-Visible Spectroscopy, Fourier transform infrared spectroscopy (FTIR, Transmission electron microscopy (TEM and selected area electron diffraction (SAED, Dynamic light scattering (DLS, and Energy-dispersive X-ray spectroscopy (SEM-EDS. Surface-enhanced Raman scattering (SERS study of the synthesized AuNps shows increase in Raman signals up to 50 times using 2DG. 3-(4, 5-dimethylthiozol-2-yl-2,5-diphenyl tetrazolium bromide (MTT assay has been performed using all the three differently capped AuNps in different cell lines to assess cytotoxcity if any, of the nanoparticles. The study shows that 2DG-AuNps is a better candidate for theranostic application.

  4. Synthesis, characterization and biocompatibility of cadmium sulfide nanoparticles capped with dextrin for in vivo and in vitro imaging application.

    Science.gov (United States)

    Reyes-Esparza, Jorge; Martínez-Mena, Alberto; Gutiérrez-Sancha, Ivonne; Rodríguez-Fragoso, Patricia; de la Cruz, Gerardo Gonzalez; Mondragón, R; Rodríguez-Fragoso, Lourdes

    2015-11-17

    The safe use in biomedicine of semiconductor nanoparticles, also known as quantum dots (QDs), requires a detailed understanding of the biocompatibility and toxicity of QDs in human beings. The biological characteristics and physicochemical properties of QDs entail new challenges regarding the management of potential adverse health effects following exposure. At certain concentrations, the synthesis of semiconductor nanoparticles of CdS using dextrin as capping agent, at certain concentration, to reduce their toxicity and improves their biocompatibility. This study successfully synthesized and characterized biocompatible dextrin-coated cadmium sulfide nanoparticles (CdS-Dx/QDs). The results show that CdS-Dx/QDs are cytotoxic at high concentrations (>2 μg/mL) in HepG2 and HEK293 cells. At low concentrations (nanoparticles only induced cell death by apoptosis in HEK293 cells at 1 μg/mL concentrations. The in vitro results showed that the cells efficiently took up the CdS-Dx/QDs and this resulted in strong fluorescence. The subcellular localization of CdS-Dx/QDs were usually small and apparently unique in the cytoplasm in HeLa cells but, in the case of HEK293 cells it were more abundant and found in cytoplasm and the nucleus. Animals treated with 100 μg/kg of CdS-Dx/QDs and sacrificed at 3, 7 and 18 h showed a differential distribution in their organs. Intense fluorescence was detected in lung and kidney, with moderate fluorescence detected in liver, spleen and brain. The biocompatibility and toxicity of CdS-Dx/QDs in animals treated daily with 100 μg/kg for 1 week showed the highest level of fluorescence in kidney, liver and brain. Less fluorescence was detected in lung and spleen. There was also evident presence of fluorescence in testis. The histopathological and biochemical analyses showed that CdS-Dx/QDs were non-toxic for rodents. The in vitro and in vivo studies confirmed the effective cellular uptake and even distribution pattern of CdS-Dx/QDs in tissues

  5. In situ growth of CdS nanoparticles on UiO-66 metal-organic framework octahedrons for enhanced photocatalytic hydrogen production under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jian-Jian; Wang, Rong; Liu, Xin-Ling; Peng, Fu-Min [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Li, Chuan-Hao, E-mail: chuanhao.li@yale.edu [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Department of Chemical & Environmental Engineering, Yale University, New Haven 06511 (United States); Teng, Fei [Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China); Yuan, Yu-Peng, E-mail: yupengyuan@ahu.edu.cn [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China)

    2015-08-15

    Graphical abstract: Enhanced photocatalytic hydrogen generation was achieved though constructing the CdS/UiO-66 MOF hybrids. In addition, the resultant hybrids show excellent photostability for hydrogen generation. - Highlights: • CdS nanoparticles were hydrothermally grown on UiO-66 octahedrons. • The resultant CdS/UiO-66 hybrids show enhanced photocatalytic H{sub 2} generation under visible light irradiation. • CdS/UiO-66 hybrids possess excellent photostability for long-term hydrogen generation. - Abstract: CdS nanoparticles acting as photosensitizer was grown in situ upon UiO-66 metal-organic framework octahedrons through a hydrothermal process. The resultant CdS/UiO-66 hybrid photocatalysts show remarkably active hydrogen evolution under visible light irradiation as compared to CdS and UiO-66 alone. The optimum hybrid with 16 wt% CdS loading shows a hydrogen production rate of 235 μmol h{sup −1}, corresponding to 1.2% quantum efficiency at 420 nm. The improved photocatalytic hydrogen production over hybrid CdS/UiO-66 is ascribed to the efficient interfacial charge transfer from CdS to UiO-66, which effectively suppresses the recombination of photogenerated electron-hole pairs and thereby enhancing the photocatalytic efficiency.

  6. Synthesis and Ultraviolet Visible Spectroscopy Studies of Chitosan Capped Gold Nanoparticles and Their Reactions with Analytes

    Directory of Open Access Journals (Sweden)

    Norfazila Mohd Sultan

    2014-01-01

    Full Text Available Gold nanoparticles (AuNPs had been synthesized with various molarities and weights of reducing agent, monosodium glutamate (MSG, and stabilizer chitosan, respectively. The significance of chitosan as stabilizer was distinguished through transmission electron microscopy (TEM images and UV-Vis absorption spectra in which the interparticles distance increases whilst retaining the surface plasmon resonance (SPR characteristics peak. The most stable AuNPs occurred for composition with the lowest (1 g weight of chitosan. AuNPs capped with chitosan size stayed small after 1 month aging compared to bare AuNPs. The ability of chitosan capped AuNPs to uptake analyte was studied by employing amorphous carbon nanotubes (α-CNT, copper oxide (Cu2O, and zinc sulphate (ZnSO4 as the target material. The absorption spectra showed dramatic intensity increased and red shifted once the analyte was added to the chitosan capped AuNPs.

  7. Investigation of thermal stability of TiO2 nanoparticles using 1-thioglycerol as capping agent

    Science.gov (United States)

    Kumari, Yogita; Jangir, Lokesh Kumar; Kumar, Anil; Kumar, Manoj; Awasthi, Kamlendra

    2017-09-01

    Thermal stability for TiO2 nanoparticles with and without caping agent has been systematically investigated in present study. TiO2 nanoparticles have been synthesized by sol-gel route without and with capping agent 1-thioglycerol. X-ray diffraction pattern revealed the formation of TiO2 nanoparticles and confirmed transformation from anatase to rutile by thermal annealing with temperature range from 500 °C to 800 °C for both the cases. It was observed that nanoparticles synthesized with 1-thioglycerol were more stable and phase transformation begins at higher temperature than that of without 1-thioglycerol. The particle size was found to be reduced by using the capping agent as it prevents the agglomeration and increased with increasing the annealing temperature. However, the morphology of the nanoparticles remains unaffected as observed by Transmission Electron Microscopy (TEM). Raman spectroscopy also supports the phase transformation with thermal annealing for both the cases. The binding of 1-thioglycerol with TiO2 was evidenced by Fourier transform infrared (FTIR) spectroscopy and X-ray photoelectron spectroscopy (XPS).

  8. Synthesis and characterization of CdS quantum dots stabilized with poly(vinyl alcohol): effect of molar fraction of precursors; Sintese e caracterizacao de pontos quanticos de CdS estabilizados com poli(alcool vinilico): efeito da fracao molar dos precursores

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    Semiconductor nanoparticles (quantum dots) with size lower than Bohr radius present quantum confinement effect, and properties dependent on particle diameter. The use of these nanoparticles for biological applications is highly promising, however this kind of use requires biocompatible systems. In this sense, the choice of poly(vinyl alcohol), PVA, as stabilizing agent has been investigated. The main goal of this work was synthesize and characterize CdS nanoparticles using PVA as capping agent varying the molar ratio of cadmium and sulfur precursors. The results revealed that absorption and emission properties, as well as nanoparticle size, were function of Cd/S ratio. (author)

  9. Production of putrescine-capped stable silver nanoparticle: its characterization and antibacterial activity against multidrug-resistant bacterial strains

    Science.gov (United States)

    Saha, Saswati; Gupta, Bhaskar; Gupta, Kamala; Chaudhuri, Mahua Ghosh

    2016-11-01

    Integration of biology with nanotechnology is now becoming attention-grabbing area of research. The antimicrobial potency of silver has been eminent from antiquity. Due to the recent desire for the enhancement of antibacterial efficacy of silver, various synthesis methods of silver in their nano dimensions are being practiced using a range of capping material. The present work highlights a facile biomimetic approach for production of silver nanoparticle being capped and stabilized by putrescine, possessing a diameter of 10-25 ± 1.5 nm. The synthesized nanoparticles have been analyzed spectrally and analytically. Morphological studies are carried out by high-resolution transmission electron microscopy and crystallinity by selected area electron diffraction patterns. Moreover, the elemental composition of the capped nanoparticles was confirmed by energy-dispersive X-ray spectroscopy analysis. A comparative study (zone of inhibition and minimum inhibitory concentration) regarding the interactions and antibacterial potentiality of the capped silver nanoparticles with respect to the bare ones reveal the efficiency of the capped one over the bare one. The bacterial kinetic study was executed to monitor the interference of nanoparticles with bacterial growth rate. The results also highlight the efficacy of putrescine-capped silver nanoparticles as effective growth inhibitors against multi-drug resistant human pathogenic bacterial strains, which may, thus, potentially be applicable as an effective antibacterial control system to fight diseases.

  10. Production of putrescine-capped stable silver nanoparticle: its characterization and antibacterial activity against multidrug-resistant bacterial strains

    Directory of Open Access Journals (Sweden)

    Saswati Saha

    2016-04-01

    Full Text Available Abstract Integration of biology with nanotechnology is now becoming attention-grabbing area of research. The antimicrobial potency of silver has been eminent from antiquity. Due to the recent desire for the enhancement of antibacterial efficacy of silver, various synthesis methods of silver in their nano dimensions are being practiced using a range of capping material. The present work highlights a facile biomimetic approach for production of silver nanoparticle being capped and stabilized by putrescine, possessing a diameter of 10–25 ± 1.5 nm. The synthesized nanoparticles have been analyzed spectrally and analytically. Morphological studies are carried out by high-resolution transmission electron microscopy and crystallinity by selected area electron diffraction patterns. Moreover, the elemental composition of the capped nanoparticles was confirmed by energy-dispersive X-ray spectroscopy analysis. A comparative study (zone of inhibition and minimum inhibitory concentration regarding the interactions and antibacterial potentiality of the capped silver nanoparticles with respect to the bare ones reveal the efficiency of the capped one over the bare one. The bacterial kinetic study was executed to monitor the interference of nanoparticles with bacterial growth rate. The results also highlight the efficacy of putrescine-capped silver nanoparticles as effective growth inhibitors against multi-drug resistant human pathogenic bacterial strains, which may, thus, potentially be applicable as an effective antibacterial control system to fight diseases.

  11. Size Selective Green Synthesis of Silver and Gold Nanoparticles: Enhanced Antibacterial Efficacy of Resveratrol Capped Silver Sol.

    Science.gov (United States)

    Shukla, Shashi P; Roy, Mainak; Mukherjee, Poulomi; Das, Laboni; Neogy, Suman; Srivastava, Dinesh; Adhikari, Soumyakanti

    2016-03-01

    In view of potential biomedical application of the noble metal nanoparticles, we report a size controlled yet simple and green synthesis of resveratrol stabilized silver and gold nanoparticles having low polydispersity of size. Here, resveratrol plays two simultaneous roles, reducing the metal ions and providing efficient capping of the small nanoparticles. This gives rise to specific size of silver and gold nanoparticles at specific ratios of metal to resveratrol. The particles have been characterized by XRD and transmission electron microscopy. The nanoparticle sols are stable for months. The UV Visible absorption spectra of the silver sol show the plasmon peak of spherical nanoparticles, presence of which is further reflected in the TEM images. Size of the silver particles obtained is in between 11 to 21 nm depending on the ratio of resveratrol to metal ion used. Resveratrol capped silver nanoparticles exhibit high antibacterial activity against Gram negative wild type E coli BW (25113). The minimum inhibitory concentration (MIC) of nano-silver against the bacterium has been estimated to be 6.48 μg/ml, which is significantly lower than that reported in some earlier as well as recent publications. Reaction of gold ions with resveratrol, on the other hand, produces gold nanoparticles of sizes varying from 7 to 29 nm at different ratios of resveratrol to the metal ions. Particles with higher size and aspect ratio are formed at lower concentration of the capping agent whereas particles with very small size and pseudo-spherical morphology are formed at higher capping concentration. Difference in the formation kinetics of silver and gold nanoparticles has been attributed to the different growth mechanisms in the two cases. Possible modes of anchorage of resveratrol to silver nanoparticles have been investigated using surface enhanced resonance Raman spectroscopy (SERS) which shows that the silver nanoparticles are capped by resveratrol molecule primarily through O

  12. Effect of CdS nanoparticles on photoluminescence spectra of Tb in ...

    Indian Academy of Sciences (India)

    Keywords. Glasses; sol–gel technique; nanoparticles; semiconductors; photoluminescence. 1. Introduction. Rare earth ions doped in glasses find uses in a wide vari- ety of applications (Kelvin 1990; Lifshitz et al 1998). Lumi- nescent nanomaterials in the form of nanoparticles or bulk nanocrystals are of interest not only for ...

  13. ZnS, CdS and HgS Nanoparticles via Alkyl-Phenyl Dithiocarbamate Complexes as Single Source Precursors

    Directory of Open Access Journals (Sweden)

    Peter A. Ajibade

    2011-08-01

    Full Text Available The synthesis of II-VI semiconductor nanoparticles obtained by the thermolysis of certain group 12 metal complexes as precursors is reported. Thermogravimetric analysis of the single source precursors showed sharp decomposition leading to their respective metal sulfides. The structural and optical properties of the prepared nanoparticles were characterized by means of X-ray diffraction (XRD, transmission electron microscopy (TEM, scanning electron microscopy (SEM UV-Vis and photoluminescence spectroscopy. The X-ray diffraction pattern showed that the prepared ZnS nanoparticles have a cubic sphalerite structure; the CdS indicates a hexagonal phase and the HgS show the presence of metacinnabar phase. The TEM image demonstrates that the ZnS nanoparticles are dot-shaped, the CdS and the HgS clearly showed a rice and spherical morphology respectively. The UV-Vis spectra exhibited a blue-shift with respect to that of the bulk samples which is attributed to the quantum size effect. The band gap of the samples have been calculated from absorption spectra and werefound to be about 4.33 eV (286 nm, 2.91 eV (426 nm and 4.27 eV (290 nm for the ZnS, CdS and HgS samples respectively.

  14. Direct observation of time-dependent photoluminescence spectral shift in CdS nanoparticles synthesized in polymer solutions.

    Science.gov (United States)

    Mandal, Debabrata; Hosoi, Haruko; Chatterjee, Uma; Tahara, Tahei

    2009-01-21

    Direct observation of time-resolved emission spectra (TRESs) of cadmium sulfide nanoparticles in polymer solutions was carried out with picosecond resolution using a streak camera. The TRESs were found to undergo a pronounced time-dependent Stokes shift, eventually coinciding with the steady-state photoluminescence spectra within an approximately 40 ns delay time. Moreover, approximately 90% of the shift was complete within the first 1 ns after excitation, in contrast to the fact that overall photoluminescence involves very long time constants of 10-100 ns. The observed Stokes shift dynamics was very similar in CdS nanoparticles stabilized in two very different types of polymer solutions. Thus the solvent and/or polymeric stabilizer appeared to have a minimal effect on the shift. We propose that the relaxation proceeds through an internal mechanism involving the fast decay of high-energy traps into relatively slow-decaying low-energy traps. Time-dependent photoluminescence anisotropy experiments also revealed an approximately 1 ns decay component appearing only in the higher-energy end of the photoluminescence spectrum. Because this time constant is too short to represent rotational diffusion of the nanometer-sized particles, it was associated with the rapid relaxation of the high-energy trap states.

  15. Gold Nanoparticle Assemblies on Surfaces: Reactivity Tuning through Capping-Layer and Cross-Linker Design.

    Science.gov (United States)

    Shankar, Sreejith; Orbach, Meital; Kaminker, Revital; Lahav, Michal; van der Boom, Milko E

    2016-01-26

    The immobilization of metal nanoparticles (NPs) with molecular control over their organization is challenging. Herein, we report the formation of molecularly cross-linked AuNP assemblies using a layer-by-layer approach. We observed four types of assemblies: 1) small aggregates of individual AuNPs, 2) large aggregates of individual AuNPs, 3) networks of fused AuNPs, and 4) gold islands. Interestingly, these assemblies with the different cross-linkers and capping layers represent different stages in the complete fusion of AuNPs to afford islands of continuous gold. We demonstrate that the stability toward fusion of the nanoparticles of the on-surface structures can be controlled by the reactivity of the cross-linkers and the hydrophilicity/hydrophobicity of the nanoparticles. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. The influence of the capping agent on the oxidation of silver nanoparticles: nano-impacts versus stripping voltammetry.

    Science.gov (United States)

    Toh, Her Shuang; Jurkschat, Kerstin; Compton, Richard G

    2015-02-09

    The influence of capping agents on the oxidation of silver nanoparticles was studied by using the electrochemical techniques of anodic stripping voltammetry and anodic particle coulometry ("nano-impacts"). Five spherical silver nanoparticles each with a different capping agent (branched polyethylenimine (BPEI), citrate, lipoic acid, polyethylene glycol (PEG) and polyvinylpyrrolidone (PVP)) were used to perform comparative experiments. In all cases, regardless of the capping agent, complete oxidation of the single nanoparticles was seen in anodic particle coulometry. The successful quantitative detection of the silver nanoparticle size displays the potential application of anodic particle coulometry for nanoparticle characterisation. In contrast, for anodic stripping voltammetry using nanoparticles drop casting, it was observed that the capping agent has a very significant effect on the extent of silver oxidation. All five samples gave a low oxidative charge corresponding to partial oxidation. It is concluded that the use of anodic stripping voltammetry to quantify nanoparticles is unreliable, and this is attributed to nanoparticle aggregation. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Characterization of citrate capped gold nanoparticle-quercetin complex: Experimental and quantum chemical approach

    Science.gov (United States)

    Pal, Rajat; Panigrahi, Swati; Bhattacharyya, Dhananjay; Chakraborti, Abhay Sankar

    2013-08-01

    Quercetin and several other bioflavonoids possess antioxidant property. These biomolecules can reduce the diabetic complications, but metabolize very easily in the body. Nanoparticle-mediated delivery of a flavonoid may further increase its efficacy. Gold nanoparticle is used by different groups as vehicle for drug delivery, as it is least toxic to human body. Prior to search for the enhanced efficacy, the gold nanoparticle-flavonoid complex should be prepared and well characterized. In this article, we report the interaction of gold nanoparticle with quercetin. The interaction is confirmed by different biophysical techniques, such as Scanning Electron Microscope (SEM), Circular Dichroism (CD), Fourier-Transform InfraRed (FT-IR) spectroscopy and Thermal Gravimetric Analysis (TGA) and cross checked by quantum chemical calculations. These studies indicate that gold clusters are covered by citrate groups, which are hydrogen bonded to the quercetin molecules in the complex. We have also provided evidences how capping is important in stabilizing the gold nanoparticle and further enhances its interaction with other molecules, such as drugs. Our finding also suggests that gold nanoparticle-quercetin complex can pass through the membranes of human red blood cells.

  18. Reversible Thermochromic Nanocomposites Based on Thiolate-Capped Silver Nanoparticles Embedded in Amorphous Polystyrene

    Directory of Open Access Journals (Sweden)

    Francesca Nicolais

    2009-09-01

    Full Text Available Technologically useful reversible thermochromic materials can be prepared using very simple polymer-embedded nanostructures. In particular, silver nanoparticles capped by long-chain alkyl-thiolate molecules (i.e., Agx(SCnH2n+1y, with n > 10 spontaneously organize in aggregates because of the interdigitation phenomenon involving the linear alkyl chains bonded at surfaces of neighboring nanoparticles. Owing to the alkylchain interdigitation, nanoparticles very close to each other result and an interaction among their surface plasmon resonances may take place. Surface plasmon interaction causes a splitting of the absorption band whose characteristics depend on the aggregate shape. Since shape-less aggregates are generated, a multiple-splitting of the silver surface plasmon absorption band is observed, which causes a broad absorption spreading on the whole visible spectral region. Amorphous polystyrene containing interdigitated silver nanoparticles has a dark-brown or black coloration, depending on the nanoparticle numerical density, but since the inter-particle distance slightly increases at melting point of interdigitation crystallites a reversible termochromic effect is observed at this special temperature. In particular, the material coloration changes from dark-brown to yellow which is the coloration produced by the surface plasmon absorption of isolated silver nanoparticles. This reversible thermochromism can be finely controlled by modifying the structure of thiolate groups, and precisely, the strength of interactions acting inside the interdigitation crystallites.

  19. Cytotoxicity evaluation and antimicrobial studies of starch capped water soluble copper nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Valodkar, Mayur; Rathore, Puran Singh [Department of Chemistry, Faculty of Science, The Maharaja Sayajirao University of Baroda, Vadodara 390002, Gujarat (India); Jadeja, Ravirajsinh N.; Thounaojam, Menaka; Devkar, Ranjitsinh V. [Department of Zoology, Faculty of Science, The Maharaja Sayajirao University of Baroda, Vadodara 390002, Gujarat (India); Thakore, Sonal, E-mail: chemistry2797@yahoo.com [Department of Chemistry, Faculty of Science, The Maharaja Sayajirao University of Baroda, Vadodara 390002, Gujarat (India)

    2012-01-30

    Highlights: Black-Right-Pointing-Pointer Bactericidal action of water soluble starch copper nanoconjugate was investigated. Black-Right-Pointing-Pointer Mode of action comparable to ampicillin and MIC as low as 1.6 {mu}g/ml. Black-Right-Pointing-Pointer The SCuNPs were non-toxic to mouse embryonic fibroblasts. Black-Right-Pointing-Pointer Cell viability was higher than uncapped CuNPs and cupric ions. Black-Right-Pointing-Pointer Promising biomedical applications due to high therapeutic index. - Abstract: Water soluble monodisperse copper nanoparticles of about 10 nm diameter were prepared by microwave irradiation using starch as green capping agent. The resulting Cu-starch conjugate were characterized by FTIR and energy dispersive X-ray analysis (EDX). The study confirmed the presence of copper embedded in polysaccharide matrix. The aqueous solution of starch capped copper nanoparticles (SCuNPs) exhibited excellent bactericidal action against both gram negative and gram positive bacteria. The in vitro cytotoxicity evaluation of the nanoparticles was carried out using mouse embryonic fibroblast (3T3L1) cells by MTT cell viability assay, extracellular lactate dehydrogenase (LDH) release and dark field microscopy imaging. The capped nanoparticles exhibited cytotoxicity at much higher concentration compared to cupric ions. Minimum bactericidal concentration (MBC) of SCuNPs was well below the in vitro cytotoxic concentration. Statistical analysis demonstrated p < 0.05 for significant results and p > 0.05 for non-significant ones as compared to untreated cells. The non-cytotoxic green Cu-starch conjugate offers a rational approach towards antimicrobial application and for integration to biomedical devices.

  20. Chitosan Capped Silver Nanoparticles as Colorimetric Sensor for the Determination of Iron(III

    Directory of Open Access Journals (Sweden)

    Javad Tashkhourian

    2017-12-01

    Full Text Available A selective, simple and low-cost method for the colorimetric determination of Fe3+ ions based on chitosan capped silver nanoparticles (Chit-AgNPs was presented. Chitosan is a cationic polyelectrolyte and possesses amino and hydroxy groups which make it widely used as a capping agent for Ag NPs. The synthesized chitosan capped silver nanoparticles with excellent colloidal stability were characterized by UV–Visible spectrometry, transmission electron microscopy, Fourier transform infrared, X-ray diffraction. Chit-AgNPs exhibit a strong surface plasmon resonance band which disappears in the presence of increasing concentrations of Fe3+ ions. This system showed a visually detectable color change from brownish-yellow to colorless for the selective determination of Fe3+. The method can be applied for the determination of Fe3+ ions in the concentration range of 1.0×10-6 to 5.0×10-4 M. The detection limit was determined from three times the standard deviation of the blank signal (3σ/slope as 5.3 × 10−7 M. The developed method was successfully applied for the determination of Fe3+in real samples

  1. In-situ synthesis of reduced graphene oxide decorated with highly dispersed ferromagnetic CdS nanoparticles for enhanced photocatalytic activity under UV irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sumeet; Ojha, Animesh K., E-mail: animesh198@gmail.com

    2016-03-01

    A facile one step in-situ solvothermal synthesis method has been used to synthesize CdS nanoparticles (NPs), graphene oxide (GO), reduced graphene oxide (rGO) and rGO decorated with highly dispersed CdS NPs. The optical properties of synthesized samples have been investigated using ultraviolet–visible (UV–VIS) spectroscopy, photoluminescence (PL) spectroscopy and Raman spectroscopy (RS) techniques and a comparative analysis of the results obtained by these techniques have been done. The CdS NPs decorated over rGO sheet act as an external perturbation that causes to split 2D Raman band into two distinct Raman peaks. The presence of two distinct Raman peaks in 2D band indicates that the synthesized rGO could be composed by double layers. The room temperature ferromagnetism (RTFM) of CdS NPs decorated over rGO is decreased compared to pure CdS NPs. The rGO-CdS nanocomposites show enhanced photocatalytic activity for the degradation of methylene blue (MB) dye than that of the pure CdS NPs. The improved photocatalytic activity of rGO-CdS nanocomposites could be attributed to the transfer of electron from conduction band (CB) of CdS NPs to the rGO sheets. It causes to increase the amount of ·OH and O{sub 2}·{sup −} radicals in the aqueous solution of dye, which react with MB dye and degrade it. Due to enhanced photocatalytic activity and coercivity, the rGO-CdS nanocomposites may be used for many practical applications in future nanotechnology. - Highlights: • rGO decorated with highly dispersed CdS NPs is synthesized by in-situ solvothermal method. • CdS NPs decorated over rGO surface act as an external perturbation for splitting of 2D band. • Two distinct Raman peaks in 2D band indicates that the rGO may be composed of double layers. • rGO-CdS nanocomposites show enhanced photocatalytic activity. • The rGO-CdS nanocomposites revealed RTFM.

  2. Structural, optical, XPS and magnetic properties of Zn particles capped by ZnO nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Morozov, Iu.G., E-mail: yugmor@hotmail.com [Institute of Structural Macrokinetics and Materials Science, Russian Academy of Sciences, Academician Osipyan Street 8, Chernogolovka, Moscow Region 142432 (Russian Federation); Belousova, O.V. [Institute of Structural Macrokinetics and Materials Science, Russian Academy of Sciences, Academician Osipyan Street 8, Chernogolovka, Moscow Region 142432 (Russian Federation); Ortega, D., E-mail: daniel.ortega@imdea.org [Instituto Madrileño de Estudios Avanzados en Nanociencia (IMDEA-Nanociencia), Cantoblanco 28049, Madrid (Spain); Mafina, M.-K., E-mail: m.k.mafina@qmul.ac.uk [School of Engineering and Materials Science, Queen Mary University of London, Mile End, Eng, 231, London E1 4NS (United Kingdom); Kuznetcov, M.V., E-mail: maxim1968@mail.ru [Department of Chemistry, Materials Chemistry Research Centre, University College London, 20 Gordon Street, London WC1H 0AJ (United Kingdom)

    2015-06-05

    Highlights: • Levitation-jet aerosol synthesis of Zn particles capped by ZnO nanoparticles (NPs). • TEM, XRD, UV–vis, FT-IR, Raman, XPS and magnetic characterization of the NPs. • Correlation between unit-cell volume of crystal lattice and maximum magnetization. - Abstract: Spherical zinc particles ranging from 42 to 760 nm in average size and capped with plate-like zinc oxide particles of 10–30 nm in sizes have been prepared by levitation-jet aerosol synthesis through condensation of zinc vapor in an inert/oxidizer gas flow. The nanoparticles have been characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), BET measurements, ultra violet visible (UV–vis) spectroscopy, Fourier transform infrared (FT-IR) spectroscopy, Raman spectroscopy, X-ray electron spectroscopy (XPS), superconducting quantum interference device (SQUID), and vibrating-sample magnetometer (VSM). Magnetic and XRD data indicate that the observed ferromagnetic ordering related to the changes in unit-cell volume of Zn in the Zn/ZnO interface of the nanoparticles. These results are in good correlation with the optical measurements data.

  3. Solvent-assisted in situ synthesis of cysteamine-capped silver nanoparticles

    Science.gov (United States)

    Oliva, José M.; Ríos de la Rosa, Julio M.; Sayagués, María J.; Sánchez-Alcázar, José A.; Merkling, Patrick J.; Zaderenko, Ana P.

    2018-03-01

    Silver nanoparticles offer a huge potential for biomedical applications owing to their exceptional properties and small size. Specifically, cysteamine-capped silver nanoparticles could form the basis for new anticancer therapies combining the cytotoxic effect of the silver core with the inherent antitumor activity of cysteamine, which inhibit cancer cell proliferation and suppress invasion and metastasis. In addition, the capability of the cysteamine coating monolayer to couple a variety of active principles and targeting (bio)molecules of interest proves key to the tailoring of this platform in order to exploit the pathophysiology of specific tumor types. Nevertheless, the chain length and conformational flexibility of cysteamine, together with its ability to attach to the surface of silver nanoparticles via both the thiol and the amine group, have made the in situ synthesis of these particles an especially challenging task. Herein we report a solvent-assisted in situ synthesis method that solves this problem. The obtained nanoparticles have been fully characterized by UV–visible absorption spectroscopy, Fourier transform infrared spectroscopy, transmission electron microscopy, electron diffraction measurement, high resolution transmission electron microscopy, scanning transmission electron microscopy, energy dispersive x-ray spectroscopy nanoanalysis, and dynamic light scattering measurement. Our synthesis method achieves extremely high yield and surface coating ratio, and colloidal stability over a wide range of pH values including physiological pH. Additionally, we have demonstrated that cysteamine-capped nanoparticles obtained by this method can be conjugated to an antibody for active targeting of the epidermal growth factor receptor, which plays an important role in the pathogenesis and progression of a wide variety of tumors, and induce cell death in human squamous carcinoma cells. We believe this method can be readily extended to combinations of noble

  4. Nanoparticles at fluid interfaces: exploiting capping ligands to control adsorption, stability and dynamics.

    Science.gov (United States)

    Garbin, Valeria; Crocker, John C; Stebe, Kathleen J

    2012-12-01

    Nanoparticle self-assembly at fluid-fluid interfaces has been traditionally exploited in emulsification, encapsulation and oil recovery, and more recently in emerging applications including functional nanomaterials and biphasic catalysis. We provide a review of the literature focusing on the open challenges that still hamper the broader applicability of this potentially transformative technology, and we outline strategies to achieve improved control over interfacial self-assembly of nanoparticles. First, we discuss means to promote spontaneous adsorption by tuning the interfacial energies of the nanoparticles with the fluids using capping ligands, and the occurrence of energy barriers. We then examine the interactions between interfacial nanoparticles and how they affect the formation of equilibrium interfacial suspensions versus non-equilibrium two-dimensional phases, such as weakly attractive glasses and gels. Important differences with colloidal interactions in a bulk suspension arise due to the discontinuity in solvent properties at the interface. For instance, ligand brushes rearrange in asymmetric configurations, and thus play a significant role in determining interparticle interactions. Finally, we briefly discuss the link between interfacial microstructure and the dynamic response of particle-laden interfaces, including interfacial rheology and the fate of nanoparticle monolayers upon out-of-plane deformation. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. Luminescent behavior of CdTe quantum dots: Neodymium(III) complex-capped nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Margarida S. [Centro de Geologia do Porto, Faculdade de Ciencias, Universidade do Porto, Rua do Campo Alegre s/n, 4169-007 Porto (Portugal); Algarra, Manuel, E-mail: magonzal@fc.up.pt [Centro de Geologia do Porto, Faculdade de Ciencias, Universidade do Porto, Rua do Campo Alegre s/n, 4169-007 Porto (Portugal); Jimenez-Jimenez, Jose; Rodriguez-Castellon, Enrique [Departamento de Quimica Inorganica, Facultad de Ciencias, Universidad de Malaga, Campus de Teatinos s/n 29071, Malaga (Spain); Campos, Bruno B.; Esteves da Silva, Joaquim C.G. [Centro de Investigacao em Quimica (CIQ-UP), Faculdade de Ciencias, Universidade do Porto, Rua do Campo Alegre s/n, 4169-007 Porto (Portugal)

    2013-02-15

    A water soluble complex of neodymium(III) with CdTe quantum dots nanoparticles was synthesized. The obtained homogeneous solutions were characterized by fluorescence, X-ray photoelectron and energy dispersive X-ray spectroscopies. The effect of the refluxing time of the reaction on the fluorescence intensity and emission wavelength has been studied. It was found that the emission wavelength of the solutions of neodymium(III) complex capped CdTe QDs nanoparticles shifted from about 540 to 735 nm. For an emission wavelength of 668 nm, the most reproducible nanoparticles obtained, the pH effect over the fluorescence emission and its intensity were studied. The purified and lyophilized solid obtained was morphologically characterized by transmission electron microscopy (TEM). The quantitative composition was determined by fluorescence X-ray spectroscopy (EDAX) and the X-ray photoelectron analysis (XPS) confirmed the presence of neodymium(III) at the surface of the CdTe nanoparticles forming a complex with the carboxylate groups from 3-mercaptopropanoic acid of the CdTe QDs. Due to the optical behavior of this complex, it could be of potential interest as a light source in optical devices. - Highlights: Black-Right-Pointing-Pointer CdTe quantum dots nanoparticles. Black-Right-Pointing-Pointer Neodymium(III) complexed quantum dots. Black-Right-Pointing-Pointer Strong red fluorescent emission nanomaterial soluble in water.

  6. Facile method to synthesize dopamine-capped mixed ferrite nanoparticles and their peroxidase-like activity

    Science.gov (United States)

    Mumtaz, Shazia; Wang, Li-Sheng; Abdullah, Muhammad; Zajif Hussain, Syed; Iqbal, Zafar; Rotello, Vincent M.; Hussain, Irshad

    2017-03-01

    A facile single-step strategy to prepare stable and water-dispersible dopamine-functionalized ultra-small mixed ferrite nanoparticles MFe2O4-DOPA (where M is a bivalent metal atom i.e. Fe, Co Cu, Mn and Ni) at room temperature is described. The nanoparticles formed have narrow size distribution as indicated by their characterization using transmission electron microscopy (TEM) and dynamic light scattering. The surface chemistry of these nanoparticles was probed by FTIR spectroscopy indicating their successful capping with dopamine ligands, which was further confirmed using zetapotential measurements and thermogravimetric analysis. The comparative horseradish peroxidase (HRP)—like activity of these cationic mixed ferrites nanoparticles was studied at pH 4.6 using a negatively-charged 2, 2‧-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt (ABTS) as a chromogenic substrate in the presence of hydrogen peroxide. A time-dependent relative peroxidase-like activity follows the following order CoFe2O4-DOPA  >  MnFe2O4-DOPA  >  CuFe2O4-DOPA  >  NiFe2O4-DOPA  >  Fe3O4-DOPA. This diversity in HRP-like activity may be attributed to the different redox properties of ferrite nanoparticles when doped with M (Fe, Co Cu, Mn and Ni).

  7. CdS nanoparticles/CeO{sub 2} nanorods composite with high-efficiency visible-light-driven photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    You, Daotong; Pan, Bao; Jiang, Fan; Zhou, Yangen; Su, Wenyue, E-mail: suweny@fzu.edu.cn

    2016-02-15

    Graphical abstract: Coupling CdS with CeO{sub 2} can effectively improve the light-harvesting ability of wide-band gap CeO{sub 2} NRs as the photoinduced electrons on the conduction band of CdS are transfered to the conduction band of CeO{sub 2}. - Highlights: • Coupling CdS can effectively improve the light-harvesting ability of wide-band gap CeO{sub 2}. • CdS/CeO{sub 2} composites show high photocatalytic activity under visible light irradiation. • The mechanism of photocatalytic H{sub 2} evolution over CdS/CeO{sub 2} was proposed. - Abstract: Different mole ratios of CdS nanoparticles (NPs)/CeO{sub 2} nanorods (NRs) composites with effective contacts were synthesized through a two-step hydrothermal method. The crystal phase, microstructure, optical absorption properties, electrochemical properties and photocatalytic H{sub 2} production activity of these composites were investigated. It was concluded that the photogenerated charge carriers in the CdS NPs/CeO{sub 2} NRs composite with a proper mole ratio (1:1) exhibited the longest lifetime and highest separation efficiency, which was responsible for the highest H{sub 2}-production rate of 8.4 mmol h{sup −1} g{sup −1} under visible-light irradiation (λ > 420 nm). The superior photocatalytic H{sub 2} evolution properties are attributed to the transfer of visible-excited electrons of CdS NPs to CeO{sub 2} NRs, which can effectively extend the light absorption range of wide-band gap CeO{sub 2} NRs. This work provides feasible routes to develop visible-light responsive CeO{sub 2}-based nanomaterial for efficient solar utilization.

  8. Chemical Capping Synthesis of Nickel Oxide Nanoparticles and their Characterizations Studies

    CERN Document Server

    rifaya, M Nowsath; Alagar, M; 10.5923/j.nn.20120205.01

    2012-01-01

    This work reports aspect related to chemical capping synthesis of nano-sized particles of nickel oxide. It is a simple, novel and cost effective method. The average particle size, specific surface area, crystallinity index are estimated from XRD analysis. The structural, functional groups and optical characters are analyzed with using of SEM, FTIR and UV- visible techniques. XRD studies confirm the presence of high degree of crystallinity nature of nickel oxide nanoparticles. Their particle size is found to be 12 nm and specific surface area (SSA) is 74m2 g-1. The optical band gap energy value 3.83ev has also been determined from UV-vis spectrum.

  9. Zinc-doped CdS nanoparticles synthesized by microwave-assisted deposition

    Science.gov (United States)

    Ibiyemi, Abideen A.; Awodugba, Ayodeji O.; Akinrinola, Olusola; Faremi, Abass A.

    2017-09-01

    Cd1-x Zn x S nanoparticles were grown on pre-cleaned glass substrates using microwave-assisted chemical bath deposition technique. Nanoparticles obtained by this method were smooth, uniform, good adherent, brownish yellow in color where the brightness of the yellow color nature decreases with increasing Zn2+ content. The elemental composition analysis confirmed that the nanoparticles comprise of Cd2+, Zn2+ and S2-. Scanning electron microscope images confirmed the surface uniformity of the Cd1-x Zn x S nanoparticles devoid of any void, pinhole or cracks and covered the substrate well. The particle size also decreases with increasing Zn ion content. X-ray diffraction (XRD) indicates the hexagonal structure (002) without phase transition. The grain size decreases from 36.45 to 9.60 nm, dislocation density increases from 0.000745 to 0.01085 Line2/m2 and lattice parameter decreased from 6.868 to 6.155 nm with increasing Zn2+ content. The best transmittance of about 95% was achieved for x = 1.0. The nanoparticles showed reduction in the absorbance as Zn ion content increased. Four point probe revealed that the electrical resistivity increased from 1.51 × 1010 to 6.67× {10}10 {{Ω }}\\cdot {cm} while electrical conductivity decreases from 6.62 × 10-11 to 1.49× {10}-11{({{Ω }}\\cdot {cm})}-1 with increasing Zn2+ content. The other electrical properties such as sheet resistance increased from 1.52 × 108 to 1.58× {10}8 {{Ω }}, charge carrier mobility decreased from 0.777 to 0.0105 cm2/(V \\cdot s) and charge carrier density increased from 1.06 × 1012 to 3.95 × 1012 cm-3.

  10. Interaction and UV-Stability of Various Organic Capping Agents on the Surface of Anatase Nanoparticles

    Directory of Open Access Journals (Sweden)

    Mohsin Raza

    2014-04-01

    Full Text Available Anatase nanoparticles synthesized by the sol-gel method were surface-functionalized with long alkyl chain coupling agents as compatibilizers for a nonpolar environment, containing different anchor groups for surface interaction namely phosphonate (dodecyl phosphonate, carboxylate (dodecanoic acid, sulfate (sodium dodecyl sulphate, and amine (dodecyl amine. It was shown that the surface of the nanoparticles can be functionalized with the various surface groups applying similar reaction conditions. The kind of surface interaction was analyzed applying FTIR spectroscopy. The phosphonate and the carboxylate groups interact with the surface via quite strong covalent or coordinative interactions, respectively. The sulfate and amine based coupling agents on the other hand exhibit electrostatic interactions. UV stability studies of the surface bound groups revealed different degradation mechanisms for the various functionalities and moreover showed that phosphonates are the most stable among the investigated surface capping groups.

  11. MoS{sub 2}/reduced graphene oxide hybrid with CdS nanoparticles as a visible light-driven photocatalyst for the reduction of 4-nitrophenol

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Wen-chao, E-mail: wenchao.peng@tju.edu.cn [School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Environmental Engineering Research Centre, Department of Civil Engineering, The University of Hong Kong, Pokfulam, Hong Kong (China); Chen, Ying [School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Li, Xiao-yan, E-mail: xlia@hkucc.hku.hk [Environmental Engineering Research Centre, Department of Civil Engineering, The University of Hong Kong, Pokfulam, Hong Kong (China)

    2016-05-15

    Highlights: • MoS{sub 2}/rGO hybrid is synthesized using a one-step hydrothermal method. • MoS{sub 2}/rGO hybrid is used as the support and cocatalyst for CdS nanoparticles. • CdS-MoS{sub 2}/rGO composite is effective photocatalyst for 4-NP reduction in visible light. • Ammonium formate is an effective sacrificial agent for 4-NP photocatalytic reduction. - Abstract: Photocatalytic reduction of nitroaromatic compounds to aromatic amines using visible light is an attractive process that utilizes sunlight as the energy source for the chemical conversions. Herewith we synthesized a composite material consisting of CdS nanoparticles grown on the surface of MoS{sub 2}/reduced graphene oxide (rGO) hybrid as a novel photocatalyst for the reduction of 4-nitrophenol (4-NP). The CdS-MoS{sub 2}/rGO composite is shown as a high-performance visible light-driven photocatalyst. Even without a noble-metal cocatalyst, the catalyst exhibited a great activity under visible light irradiation for the reduction of 4-NP to much less toxic 4-aminophenol (4-AP) with ammonium formate as the sacrificial agent. Composite CdS-0.03(MoS{sub 2}/0.01rGO) was found to be the most effective photocatalyst for 4-NP reduction. The high photocatalytic performance is apparently resulted from the synergetic functions of MoS{sub 2} and graphene in the composite, i.e. the cocatalysts serve as both the active adsorption sites for 4-NP and electron collectors for the separation of electron-hole pairs generated by CdS nanoparticles. The laboratory results show that the CdS-MoS{sub 2}/rGO composite is a low-cost and stable photocatalyst for effective reduction and detoxification of nitroaromatic compounds using solar energy.

  12. One-pot synthesis of CdS nanoparticles exhibiting quantum size effect prepared within a sol-gel derived ureasilicate matrix

    Science.gov (United States)

    Gonçalves, Luis F. F. F.; Kanodarwala, Fehmida K.; Stride, John A.; Silva, Carlos J. R.; Gomes, Maria J. M.

    2013-12-01

    This paper describes a novel single-pot synthesis process based on sol-gel for the production of a highly transparent hybrid matrix containing CdS nanoparticles (NPs). The reaction between cadmium and sulphide ions in the presence of 3-mercaptopropyltrimethoxysilane (MPTMS) that originates the formation of quantum confined CdS NPs occurs simultaneously with the condensation and polymerization of the gel precursors that evolves to a macromolecular hybrid organic-inorganic network. The obtained xerogel matrix is based on the reaction of organically modified alkoxysilane (3-isocyanatepropyltriethoxysilane) and a di-amine functionalized oligopolyoxyethylene (Jeffamine ED-600). The final material is characterized as highly transparent, homogeneous and flexible xerogel incorporating stabilized and high crystalline CdS NPs that exhibit size-dependent optical properties due to quantum confinement of photogenerated e-h pairs as observed from UV-visible and photoluminescence spectroscopy and HRTEM microscopy measurements. The developed approach has obvious advantages comparatively to the alternative and more complex routes of production of composite materials with embedded semiconductor NPs because of the simplified one-pot preparative procedure used. The developed sol-gel process allows the control of the optical characteristics of the obtained CdS NPs embedded within the network by adjusting the molar ratio between cadmium ion and MPTMS and between cadmium and sulphide ions.

  13. "Use of acidophilic bacteria of the genus Acidithiobacillus to biosynthesize CdS fluorescent nanoparticles (quantum dots) with high tolerance to acidic pH".

    Science.gov (United States)

    Ulloa, G; Collao, B; Araneda, M; Escobar, B; Álvarez, S; Bravo, D; Pérez-Donoso, J M

    2016-12-01

    The use of bacterial cells to produce fluorescent semiconductor nanoparticles (quantum dots, QDs) represents a green alternative with promising economic potential. In the present work, we report for the first time the biosynthesis of CdS QDs by acidophilic bacteria of the Acidithiobacillus genus. CdS QDs were obtained by exposing A. ferrooxidans, A. thiooxidans and A. caldus cells to sublethal Cd(2+) concentrations in the presence of cysteine and glutathione. The fluorescence of cadmium-exposed cells moves from green to red with incubation time, a characteristic property of QDs associated with nanocrystals growth. Biosynthesized nanoparticles (NPs) display an absorption peak at 360nm and a broad emission spectra between 450 and 650nm when excited at 370nm, both characteristic of CdS QDs. Average sizes of 6 and 10nm were determined for green and red NPs, respectively. The importance of cysteine and glutathione on QDs biosynthesis in Acidithiobacillus was related with the generation of H2S. Interestingly, QDs produced by acidophilic bacteria display high tolerance to acidic pH. Absorbance and fluorescence properties of QDs was not affected at pH 2.0, a condition that totally inhibits the fluorescence of QDs produced chemically or biosynthesized by mesophilic bacteria (stable until pH 4.5-5.0). Results presented here constitute the first report of the generation of QDs with improved properties by using extremophile microorganisms. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Metal and Metal Carbide Nanoparticle Synthesis Using Electrical Explosion of Wires Coupled with Epoxide Polymerization Capping.

    Science.gov (United States)

    Abdelkader, Elseddik M; Jelliss, Paul A; Buckner, Steven W

    2015-06-15

    In this study, metal-containing nanoparticles (NPs) were produced using electrical explosion of wires (EEW) in organic solvents. The explosion chamber was constructed from Teflon to withstand the shockwave, allow growth and reaction of the incipient NPs in various organic solvents containing dissolved ligands, and allow a constant flow of argon to maintain an inert environment. A survey of different transition d-block metals was conducted with metals from groups 4-8, affording metal carbide NPs, while metals from groups 9-12 gave elemental metallic NPs. Tungsten carbide phase WC1-x, which has not been previously isolated as a single-phase material, was exclusively formed during EEW. We used polymerization initiation by electron-rich metallic nanoparticles (PIERMEN) as a capping technique for the nascent NPs with an alkyl epoxide employed as the monomers. Transmission electron microscopy showed spherical particles with the metallic core embedded in a polymer matrix with predominantly smaller particles (100 nm). Powder X-ray diffraction (PXRD) was used to confirm the identity of the metallic NPs. The capping agents were characterized using ATR-FTIR spectroscopy. No evidence is observed for the formation of crystalline oxides during EEW for any metals used. Differential scanning calorimetry/thermal gravimetric analysis was used to study the NP's behavior upon heating under an air flow up to 800 °C with the product oxides characterized by PXRD. The bifurcation between metal-carbide NPs and metal NPs correlates with the enthalpy of formation of the product carbides. We observed PIERMEN capping of elemental metal NPs only when the metal has negative standard electrode potentials (relative to a bis(biphenyl) chromium(I)/(0) reference electrode).

  15. Poly(styrene-b-2-(N,N-dimethylamino)ethyl methacrylate) diblock copolymers: Micellization and application in the synthesis of photoluminescent CdS nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Basu, Saswati; Mondal, Samiran [Department of Chemistry, Visva-Bharati University, Santiniketan 731 235 (India); Chatterjee, Uma, E-mail: uma_cin@yahoo.co.in [Polymer Science Unit, Indian Association for the Cultivation of Sciences, Kolkata 700 032 (India); Mandal, Debabrata, E-mail: dmandal.chemistry@gmail.com [Department of Chemistry, Visva-Bharati University, Santiniketan 731 235 (India)

    2009-08-15

    Fluorescence studies on amphiphilic diblock copolymers of styrene and 2-(N,N-dimethylamino)ethyl methacrylate using 1,8-anilinonaphthalenesulfonate (ANS) as fluorescent probe revealed the formation of stable micelles at extremely low polymer concentrations of {approx}0.05%. The micellar microenvironment was characterized by an average polarity of E{sub T}(30) = 44-48 kcal mol{sup -1}, similar to the moderately polar solvents, and extremely high microviscosity. Increase in hydrophilic: hydrophobic ratio of the copolymers resulted in an increase in the average polarity and decrease in microviscosity. The micelles proved to be excellent hosts for the synthesis and stabilization of photoluminescent CdS nanoparticles with a high degree of quantum confinement and broad photoluminescence, dominated by trap-state emission. Moreover, the size and size-related steady-state optical properties of CdS nanoparticles were significantly dependent on the microenvironment of the host micelle. In contrast, the photoluminescence dynamics of the nanoparticles, involving time-scales from 100 ps to 100 ns, are similar in all cases. Interestingly, the nanoparticles exhibit a large time-dependent Stokes shift, 75% of which is complete within the first {approx}100 ps after the excitation. The extremely rapid Stokes shift is attributed to the decay of the initially formed band-edge excitons in a time-scale too fast to be affected by the microenvironment surrounding the particle.

  16. Ultrasensitive optical detection of trinitrotoluene by ethylenediamine-capped gold nanoparticles.

    Science.gov (United States)

    Lin, Dongyue; Liu, Honglin; Qian, Kai; Zhou, Xia; Yang, Liangbao; Liu, Jinhuai

    2012-09-26

    This study found that 1,2-ethylenediamine (EDA) as a primary amine could be modified onto the surface of citrate-stabilized gold nanoparticles (Au NPs), and the EDA-capped Au NPs were successfully used as an ultrasensitive optical probe for TNT detection. The strong donor-acceptor (D-A) interactions between EDA and trinitrotoluene (TNT) at the Au NP/solution interface induced significant aggregation of the EDA-capped Au NPs, and enabled to easily realize the direct colorimetric detection of ultratrace TNT. The results showed that such a color change was readily seen by the naked eye, and the colorimetric detection could be down to 400 pM level of TNT with excellent discrimination against other nitro compounds. UV-vis absorption spectroscopy was used to examine the TNT-induced changes in local surface plasmon resonance (LSPR) of EDA-capped Au NPs, and a new LSPR band at ca. 630 nm arose along with the addition of TNT, which produced a detection limit of TNT down to ca. 40 pM. Furthermore, dynamic light scattering measurements evidenced the ultratrace TNT-induced small changes in the size of the EDA-capped Au NPs, and realized the quick and accurate detection of TNT in 0.4 pM level. These results demonstrated the ultrahigh sensitivity of this optical probe for TNT detection. Moreover, this optical probe is sample, stable, low-cost, and these excellent properties make it quite promising for infield and rapid detection of TNT. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Resistivity, photoresistivity and magnetoresistance in sharp zincblende-wurtzite phase transition in CdS nanoparticles

    Science.gov (United States)

    Marquez-Marín, J.; Torres-Castanedo, C. G.; Torres-Delgado, G.; Castanedo-Pérez, R.; Zelaya-Ángel, O.

    2017-11-01

    Cadmium sulfide nanoparticles were deposited by microwaves assisted chemical bath synthesis on glass substrates at bath temperatures (Tb) in the range 60 ≤ Tb ≤ 97 °C. The films are formed of nanocrystals with a size of 6-20 nm. The crystalline phase depends on Tb, for 60 °C ≤ Tb ≤ 93 °C the lattice is cubic zinc blende and for Tb ≥ 95 °C hexagonal wurtzite. The critical temperature of phase transition is Tbc = 94 °C. Interplanar spacing calculated values, along the preferred orientation of growth, indicate that the lattice experiences a uniaxial contraction in the vicinity of Tbc, which is reflected in the thickness of the films. In this work, the electrical properties of these films are discussed and correlated with their structural ones for the whole temperature range. The electrical resistivity decreases as the nanoparticle size increases. Majority carrier density, mobility, and magnetoresistance experience strong variations around Tbc, similar to the behavior of the film thickness. As well as, resistivity measurements as function of (1/kT) show a change in the activation energy at Tbc.

  18. {sup 6}LiF oleic acid capped nanoparticles entrapment in siloxanes for thermal neutron detection

    Energy Technology Data Exchange (ETDEWEB)

    Carturan, S., E-mail: sara.carturan@lnl.infn.it; Maggioni, G., E-mail: Gianluigi.maggioni@lnl.infn.it [Department of Physics and Astronomy, University of Padova, Via Marzolo 8, 35100 Padova (Italy); INFN, Laboratori Nazionali di Legnaro, Viale dell’Università 2, 35020 Legnaro (Italy); Marchi, T.; Gramegna, F.; Cinausero, M. [INFN, Laboratori Nazionali di Legnaro, Viale dell’Università 2, 35020 Legnaro (Italy); Quaranta, A. [Department of Industrial Engineering, University of Trento, Trento (Italy); INFN, Tifpa, Trento (Italy); Palma, M. Dalla [INFN, Laboratori Nazionali di Legnaro, Viale dell’Università 2, 35020 Legnaro (Italy); Department of Industrial Engineering, University of Trento, Trento (Italy)

    2016-07-07

    The good light output of siloxane based scintillators as displayed under γ-rays and α particles has been exploited here to obtain clear and reliable response toward thermal neutrons. Sensitization towards thermal neutrons has been pursued by adding {sup 6}LiF, in form of nanoparticles. Aiming at the enhancement of compatibility between the inorganic nanoparticles and the low polarity, siloxane based surrounding medium, oleic acid-capped {sup 6}LiF nanoparticles have been synthesized by thermal decomposition of Li trifluoroacetate. Thin pellets siloxane scintillator maintained their optical transmittance up to weight load of 2% of {sup 6}Li. Thin samples with increasing {sup 6}Li concentration and thicker ones with fixed {sup 6}Li amount have been prepared and tested with several sources (α, γ-rays, moderated neutrons). Light output as high as 80% of EJ212 under α irradiation was measured with thin samples, and negligible changes have been observed as a result of {sup 6}LiF addition. In case of thick samples, severe light loss has been observed, as induced by opacity. Nevertheless, thermal neutrons detection has been assessed and the data have been compared with GS20, based on Li glass, taken as a reference material.

  19. Preparation and characterization of chitosan-capped radioactive gold nanoparticles. Neutron irradiation impact on structural properties

    Energy Technology Data Exchange (ETDEWEB)

    Aboudzadeh, Mohammad Reza; Moassesi, Mohammad Esmaeil; Amiri, Mojtaba; Shams, Hadi; Alirezapour, Behrooz; Sadeghi, Mehdi; Sari, Mehdi Fakhraei [Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of). Radiation Application Research School; Keyvani, Mehdi [Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of). Reactor Research School

    2016-02-15

    Gold-198 nanoparticles ({sup 198}AuNPs) can be engineered with precise size, shape, composition, surface chemistry, radioactivity and radionuclide purity for clinical applications in nuclear medicine. In the present work, chitosan-capped AuNPs were prepared by exposing HAuCl{sub 4} to acidic chitosan solution under appropriate conditions and then irradiated in Tehran Research Reactor (TRR). After that, UV-Vis spectroscopy, FTIR, SEM and DLS were used for irradiated and non-irradiated sample characterization. FTIR studies were performed for controlling radiation-induced degradation of AuNPs rate at chitosan. From these results, it is concluded that the chemical bonds and backbone structure of chitosan does not change after the irradiation in a neutron flux of 3 x 10{sup 12} n cm{sup -2} s{sup -1} for 30 min. The SEM photograph clearly indicated that gold nanoparticles were spherical with an average size of ∝62 and 63 nm before and after neutron irradiation, respectively. So, there was no significant difference in the size of irradiated and non-irradiated nanoparticles. {sup 198}AuNPs rate at chitosan with high radionuclide purity produced using the epithermal neutron-capture reaction, {sup 197}Au (n, γ) {sup 198}Au, are especially useful for cancer treatment and imaging.

  20. Ethylenediaminetetraacetic acid capped superparamagnetic iron oxide (Fe3O4) nanoparticles: A novel preparation method and characterization

    Science.gov (United States)

    Aghazadeh, Mustafa; Karimzadeh, Isa; Ganjali, Mohammad Reza

    2017-10-01

    A novel and facile strategy is introduced for the preparation of ethylenediaminetetraacetic acid (EDTA) capped magnetite nanoparticles (MNPs). In this strategy, Fe3O4 nanoparticles were electrodeposited from a deposition bath containing 0.005 M Fe2+/Fe3+ nitrate and chlorides alts and 1 g/L EDTA. A simple deposition mode i.e. constant current and two-electrode set-up was used in the electro-synthesis procedure. The magnetite phase of the deposited nanoparticles was confirmed through XRD and FT-IR analyses. Morphological observations through FE-SEM and TEM confirmed the formation of spherical MNP particles with an average size of 10 nm. The EDTA layer on the surface of the electro-synthesized magnetite nanoparticles was proved based on FT-IR, DLS and TG data. Vibrating sample magnetometer (VSM) measurements confirmed the EDTA capped iron oxide nanoparticles to have a super-paramagnetic nature, since they exhibit a high saturation magnetization (Ms = 51.9 emu g-1), as well as, negligible remnant magnetization (Mr = 0.59 emu g-1) and coercivity (Hc = 0.85 Oe). Based on the obtained results, the proposed platform can be considered as a fast, simple and efficient method for the preparation of the EDTA capped magnetite nanoparticles.

  1. Antifungal activity of wide band gap Thioglycolic acid capped ZnS:Mn semiconductor nanoparticles against some pathogenic fungi.

    Science.gov (United States)

    Ibrahim, Isam M; Ali, Iftikhar M; Dheeb, Batol Imran; Abas, Qayes A; Asmeit Ramizy; Eisa, M H; Aljameel, A I

    2017-04-01

    The manganese doped zinc sulfide nanoparticles were synthesized by simple aqueous chemical reaction of manganese chloride, zinc acetate and thioacitamide in aqueous solution. Thioglycolic acid is used as capping agent for controlling the nanoparticle size. The main advantage of the ZnS:Mn nanoparticles of diameter ~2.73nm is that the sample is prepared by using non-toxic precursors in a cost effective and eco-friendly way. The structural, morphological and chemical composition of the nanoparticles have been investigated by X-ray diffraction (XRD), Scanning Electron Microscopy (SEM) with energy dispersion spectroscopy (EDS) and Fourier transform infrared (FTIR) spectroscopy. The nanosize of the prepared nanoparticles was elucidated by Scanning Electron Microscopy (SEM). FTIR result ensures that Thioglycolic acid is well bonded on the surface of ZnS:Mn NPs. The antifungal effects of Thioglycolic acid capped ZnS:Mn nanoparticles exhibited a potent antifungal activity against tested fungal strains, so deserving further investigation for clinical applications. The antifungal property of manganese doped zinc sulphide nanoparticles is attributed to the generation of reactive oxygen species due to the interaction of nanoparticles with water. Additionally, the presence of Zn and S in the zone of inhibition area leads to perturbation of fungi cell membranes resulting in growth inhibition. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Nanosecond laser irradiation synthesis of CdS nanoparticles in a PVA system

    Energy Technology Data Exchange (ETDEWEB)

    Onwudiwe, Damian C. [Chemical Resource Beneficiation (CRB) Research Focus Area, North-West University, Private Bag X6001, Potchefstroom 2520 (South Africa); Krüger, Tjaart P.J. [Department of Physics, University of Pretoria, Private Bag X20, Hatfield 0028 (South Africa); Oluwatobi, Oluwafemi S. [Department of Chemistry, Cape Peninsula University of Technology, Cape Town (South Africa); Strydom, Christien A., E-mail: christien.strydom@nwu.ac.za [Chemical Resource Beneficiation (CRB) Research Focus Area, North-West University, Private Bag X6001, Potchefstroom 2520 (South Africa)

    2014-01-30

    We herein report a modified, in situ photolytic process for the nucleation and growth of cadmium sulphide nanoparticles in the presence of an optically transparent and semicrystalline polyvinyl alcohol (PVA) polymer matrix. The laser causes a localized decomposition of the precursor species in the immediate vicinity of the polymer leading to highly confined nanocrystals. The as-synthesized PVA-CdS nanocomposite were characterized using UV–vis absorption and photoluminescence spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), high resolution TEM (HRTEM) and powdered X-ray diffraction (XRD). Strong blue shift in the band gap was observed in UV visible absorption spectrum indicating the size confinement. The influence of deposition temperature (25–200 °C) on the optical properties, microstructure, and thermal stability was also investigated. Thermal decomposition behaviors of these composites exhibit decreased thermal stability as indicated by the shift in the decomposition temperature of the pure PVA. XRD patterns revealed a reduction in the crystallinity of the polymer due to the entrapped particles. The nanocomposites showed the existence of both cubic and hexagonal phases.

  3. RSM optimized Moringa oleifera peel extract for green synthesis of M. oleifera capped palladium nanoparticles with antibacterial and hemolytic property.

    Science.gov (United States)

    Surendra, T V; Roopan, Selvaraj Mohana; Arasu, Mariadhas Valan; Al-Dhabi, Naif Abdullah; Rayalu, G Mokesh

    2016-09-01

    Palladium nanoparticles (Pd NPs) are the very good catalytic agents in many coupling reactions, also these are very well biological agents against bacteria and fungus. M. oleifera capped Pd NPs were synthesized from microwave assisted methanolic extract of M. oleifera peel. To optimize the extraction process RSM (Response Surface Methodology) was applied. To get a good extraction yield BBD (Box-Behnken Design) was employed. The better optimized conditions for the extraction was found as 400W, 25mL of CH3OH at 65°C for 2min. We observed 61.66mg of extract yield from this method. Eco-friendly M. oleifera capped Pd NPs were synthesized using M. oleifera peel extract and confirmed using the different characterization techniques like UV- Vis spectroscopy, XRD, SEM and HR-TEM analysis. We found the size of the M. oleifera capped Pd NPs nanoparticles as 27±2nm and shape of the particles as spherical through the TEM analysis. M. oleifera capped Pd NPs exhibits good antibacterial activity against S. aureus (Staphylococcus aureus) and E. coli (Escherichia coli) bacterial strains and we found the zone inhibition as 0.6 and 0.7mm. The synthesized M. oleifera capped Pd NPs are screened for hemolytic activity and it proved the M. oleifera capped Pd NPs are non-toxic on RBCs cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Porous TiO{sub 2} nanofibers decorated CdS nanoparticles by SILAR method for enhanced visible-light-driven photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Fengyu; Hou, Dongfang, E-mail: dfhouok@126.com; Hu, Fuchao; Xie, Kui; Qiao, Xiuqing; Li, Dongsheng, E-mail: lidongsheng1@126.com

    2017-01-01

    Graphical abstract: A heterojunction photocatalyst with CdS Nanoparticles self-assembled via SILAR Method at surfaces of electrospun TiO2 nanofibers shows enhanced visible-light photocatalytic activities. - Highlights: • Combined electrospinning and successive ionic layer adsorption and reaction process. • Pouous TiO{sub 2} nanofibers decorated CdS nanoparticles. • Synergetic effect of photosensitization and heterojunction. - Abstract: 1D porous CdS nanoparticles/TiO{sub 2} nanofibers heterostructure has been fabricated via simple electrospinning and a successive ionic layer adsorption and reaction (SILAR) process. The morphology, composition, and optical properties of the resulting CdS/TiO{sub 2} heterostructures can be rationally tailored through changing the SILAR cycles. The photocatalytic hydrogen evolution and decomposition of rhodamine B (RhB) of the as-synthesized heterostructured photocatalysts were investigated under visible light irradiation. Compared to TiO{sub 2} nanofibers,the as-obtained CdS/TiO{sub 2} heterostructures exhibit enhanced photocatalytic activity for hydrogen production and decomposition of RhB under visible-light irradiation. The heterojunction system performs best with H{sub 2} generation rates of 678.61 μmol h{sup −1} g{sup −1} under visible light irradiation which benefits from the two effects: (a) the 1D porous nanofibrous morphology contributes to not only more active sites but also more efficient transfer of the photogenerated charges (b) the synergetic effect of heterojunction and photosensitization reducing the recombination of photogenerated electrons and holes.

  5. Determination of gold nanoparticles in environmental water samples by second-order optical scattering using dithiotreitol-functionalized CdS quantum dots after cloud point extraction

    Energy Technology Data Exchange (ETDEWEB)

    Mandyla, Spyridoula P.; Tsogas, George Z.; Vlessidis, Athanasios G.; Giokas, Dimosthenis L., E-mail: dgiokas@cc.uoi.gr

    2017-02-05

    Highlights: • A new method has been developed to determine gold nanoparticles in water samples. • Extraction was achieved by cloud point extraction. • A nano-hybrid assembly between AuNPs and dithiol-coated quantum dots was formulated. • Detection was accomplished at pico-molar levels by second-order light scattering. • The method was selective against ionic gold and other nanoparticle species. - Abstract: This work presents a new method for the sensitive and selective determination of gold nanoparticles in water samples. The method combines a sample preparation and enrichment step based on cloud point extraction with a new detection motif that relies on the optical incoherent light scattering of a nano-hybrid assembly that is formed by hydrogen bond interactions between gold nanoparticles and dithiotreitol-functionalized CdS quantum dots. The experimental parameters affecting the extraction and detection of gold nanoparticles were optimized and evaluated to the analysis of gold nanoparticles of variable size and surface coating. The selectivity of the method against gold ions and other nanoparticle species was also evaluated under different conditions reminiscent to those usually found in natural water samples. The developed method was applied to the analysis of gold nanoparticles in natural waters and wastewater with satisfactory results in terms of sensitivity (detection limit at the low pmol L{sup −1} levels), recoveries (>80%) and reproducibility (<9%). Compared to other methods employing molecular spectrometry for metal nanoparticle analysis, the developed method offers improved sensitivity and it is easy-to-operate thus providing an additional tool for the monitoring and the assessment of nanoparticles toxicity and hazards in the environment.

  6. Cyclic Peptide-Capped Gold Nanoparticles for Enhanced siRNA Delivery

    Directory of Open Access Journals (Sweden)

    Amir Nasrolahi Shirazi

    2014-08-01

    Full Text Available Previously, we have reported the synthesis of a homochiral l-cyclic peptide [WR]5 and its use for delivery of anti-HIV drugs and biomolecules. A physical mixture of HAuCl4 and the peptide generated peptide-capped gold nanoparticles. Here, [WR]5 and [WR]5-AuNPs were tested for their efficiency to deliver a small interfering RNA molecule (siRNA in human cervix adenocarcinoma (HeLa cells. Flow cytometry investigation revealed that the intracellular uptake of a fluorescence-labeled non-targeting siRNA (200 nM was enhanced in the presence of [WR]5 and [WR]5-AuNPs by 2- and 3.8-fold when compared with that of siRNA alone after 24 h incubation. Comparative toxicity results showed that [WR]5 and [WR]5-AuNPs were less toxic in cells compared to other available carrier systems, such as Lipofectamine.

  7. Capping-agent-free synthesis of substrate-supported porous icosahedral gold nanoparticles

    Science.gov (United States)

    Wu, Ji Hong; Guan, Zhenping; Yang, Su Ke; Yuan, Peiyan; Xu, Qing-Hua; Xu, Guo Qin

    2013-03-01

    We report a new capping-agent-free strategy for the synthesis of substrate-supported porous icosahedral Au nanoparticles (NPs) with rough naked surfaces, based on the crystallization from substrate-supported thin solution layers followed by solid-phase thermolysis. The plasmonic properties of icosahedral Au NPs have been studied using single particle dark-field scattering microscopy and spectroscopy. The two distinct localized surface plasmon resonance (LSPR) bands observed in the single particle dark-field spectra can be ascribed to the quadrupole resonance at ca. 425 nm and the size-dependent dipole resonance in the red region (645-708 nm). The unique rough naked surface, the facile synthesis, together with the ability to control the nanoparticle size and to vary the LSPR frequency in the red region, would make the substrate-supported porous icosahedral Au NPs promising on multiple levels in the applications of catalysis, ultrasensitive biosensors, and in surface-enhanced Raman scattering (SERS).We report a new capping-agent-free strategy for the synthesis of substrate-supported porous icosahedral Au nanoparticles (NPs) with rough naked surfaces, based on the crystallization from substrate-supported thin solution layers followed by solid-phase thermolysis. The plasmonic properties of icosahedral Au NPs have been studied using single particle dark-field scattering microscopy and spectroscopy. The two distinct localized surface plasmon resonance (LSPR) bands observed in the single particle dark-field spectra can be ascribed to the quadrupole resonance at ca. 425 nm and the size-dependent dipole resonance in the red region (645-708 nm). The unique rough naked surface, the facile synthesis, together with the ability to control the nanoparticle size and to vary the LSPR frequency in the red region, would make the substrate-supported porous icosahedral Au NPs promising on multiple levels in the applications of catalysis, ultrasensitive biosensors, and in surface

  8. Green synthesis of chondroitin sulfate-capped silver nanoparticles: characterization and surface modification.

    Science.gov (United States)

    Cheng, Kuang-ming; Hung, Yao-wen; Chen, Cheng-cheung; Liu, Cheng-che; Young, Jenn-jong

    2014-09-22

    A one-step route for the green synthesis of highly stable and nanosized silver metal particles with narrow distribution is reported. In this environmentally friendly synthetic method, silver nitrate was used as silver precursor and biocompatible chondroitin sulfate (ChS) was used as both reducing agent and stabilizing agent. The reaction was carried out in a stirring aqueous medium at the room temperature without any assisted by microwave, autoclave, laser irradiation, γ-ray irradiation or UV irradiation. The transparent colorless solution was converted to the characteristics light red then deep red-brown color as the reaction proceeds, indicating the formation of silver nanoparticles (Ag NPs). The Ag NPs were characterized by UV-visible spectroscopy (UV-vis), photon correlation spectroscopy, laser Doppler anemometry, transmission electron microscopy (TEM), and Fourier-transform infrared spectroscopy (FT-IR). The results demonstrated that the obtained metallic nanoparticles were Ag NPs capped with ChS. In this report, dynamic light scattering (DLS) was used as a routinely analytical tool for measuring size and distribution in a liquid environment. The effects of the reaction time, reaction temperature, concentration and the weight ratio of ChS/Ag+ on the particle size and zeta potential were investigated. The TEM image clearly shows the morphology of the well-dispersed ChS-capped Ag NPs are spherical in shape, and the average size (Ag NPs coated with N-[(2-hydroxy-3-trimethylammonium) propyl] chitosan chloride (HTCC) were prepared by an ionic gelation method and the surface charge of Ag NPs was switched from negative to positive. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Vancomycin Capped with Silver Nanoparticles as an Antibacterial Agent against Multi-Drug Resistance Bacteria.

    Science.gov (United States)

    Esmaeillou, Mahsa; Zarrini, Gholamreza; Ahangarzadeh Rezaee, Mohammad; Shahbazi Mojarrad, Javid; Bahadori, Ali

    2017-09-01

    Purpose: Many antimicrobial medications are available to combat infections. However, the indiscriminate use of antibiotics has produced antibiotic resistance in the case of many bacterial pathogens. This study focuses on the development of nanoparticles (NPs) that enhance the in vitro antibiotic activity of vancomycin against multi-drug resistant (MDR) organisms. Methods: Spherical shaped thioglycolic acid-stabilized silver nanoparticles (TGA-AgNPs) were prepared by using a simple chemical reduction method. Then, vancomycin was conjugated to the terminal carboxyl of TGA in the presence of N-Hydroxysuccinimide (NHS) and N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride (EDC). Afterwards, the antibacterial activity of these nanoconjugates was examined by using the minimum inhibitory concentration (MIC) assay against MDR bacteria. Results: The rate of vancomycin bound to the AgNPs was 19.6%. The MIC values of vancomycin (Van)-capped AgNPs against tested pathogens were in the range of (3.2, 1.6, 0.8, 0.4, 0.2, 0.1, 0.05, and 0.025 µl/ml). The MIC was 0.1 µg/ml for VRE, MIC≤0.02 µg/ml for MRSE, and 0.05 µg/ml for S. aureus. The MIC corresponded to the MBC for all bacterial species. Conclusion: This study indicated that some antimicrobial agents like vancomycin can be conjugated with AgNPs. This can lead to increased antimicrobial activity against MDR microorganisms.

  10. Synthesis of oleic acid capped copper nano-particles via reduction of copper salt by SFS

    Energy Technology Data Exchange (ETDEWEB)

    Khanna, P.K. [Nanoscience Group, Centre for Materials for Electronics Technology (C-MET), Off Dr. Homi Bhabha Road, Panchawati, Pune 411008 (India)], E-mail: pkkhanna@cmet.gov.in; Kale, Trupti S.; Shaikh, Mushtaq [Nanoscience Group, Centre for Materials for Electronics Technology (C-MET), Off Dr. Homi Bhabha Road, Panchawati, Pune 411008 (India); Rao, N. Koteswar; Satyanarayana, C.V.V. [National Chemical Laboratory, Dr. Homi Bhabha Road, Pune 411008 (India)

    2008-07-15

    Synthesis of oleic acid capped copper nano-particles has been carried out by use of sodium formaldehyde sulfoxylate (SFS) in aqueous medium. Nano-copper can be effectively coated with polyvinyl alcohol (PVA). Phase-pure nano-Cu can be obtained when water/acetone was used as aqueous medium. It is observed that the surface plasmon resonance (SPR) phenomena can be controlled during synthesis by the use of suitable reagent system, e.g. absorption band in presence of PVA can be blue shifted. As-prepared copper nano-particles were characterized by X-ray diffraction measurements (XRD), Scanning electron microscopy (SEM), energy dispersive analysis of X-rays (EDAX), thermo gravimetric analysis (TGA) and Fourier transform infra-red spectroscopy (FTIR). XRD analysis revealed broad pattern for fcc crystal structure of copper metal. The particle size by use of Scherrer's equation was calculated to be about 20 nm. TGA revealed {approx}10% weight loss due to the presence of surfactant. FTIR spectroscopy confirmed the presence of oleic acid around the particles.

  11. Sum frequency generation and catalytic reaction studies of the removal of the organic capping agents from Pt nanoparticles by UV-ozone treatment

    Energy Technology Data Exchange (ETDEWEB)

    Aliaga, Cesar; Park, Jeong Y.; Yamada, Yusuke; Lee, Hyun Sook; Tsung, Chia-Kuang; Yang, Peidong; Somorjai, Gabor A.

    2009-12-10

    We report the structure of the organic capping layers of platinum colloid nanoparticles and their removal by UV-ozone exposure. Sum frequency generation vibrational spectroscopy (SFGVS) studies identify the carbon-hydrogen stretching modes on poly(vinylpyrrolidone) (PVP) and tetradecyl tributylammonium bromide (TTAB)-capped platinum nanoparticles. We found that the UV-ozone treatment technique effectively removes the capping layer on the basis of several analytical measurements including SFGVS, X-ray photoelectron spectroscopy, and diffuse reflectance infrared Fourier transform spectroscopy (DRIFTS). The overall shape of the nanoparticles was preserved after the removal of capping layers, as confirmed by transmission electron microscopy (TEM). SFGVS of ethylene hydrogenation on the clean platinum nanoparticles demonstrates the existence of ethylidyne and di-{sigma}-bonded species, indicating the similarity between single-crystal and nanoparticle systems.

  12. Supramolecular Gel-Templated In Situ Synthesis and Assembly of CdS Quantum Dots Gels

    Science.gov (United States)

    Zhu, Lili; He, Jie; Wang, Xiaoliang; Li, Dawei; He, Haibing; Ren, Lianbing; Jiang, Biwang; Wang, Yong; Teng, Chao; Xue, Gi; Tao, Huchun

    2017-01-01

    Although many studies have attempted to develop strategies for spontaneously organizing nanoparticles (NPs) into three-dimensional (3D) geometries, it remains a fascinating challenge. In this study, a method for in situ synthesis and self-assembly of a CdS quantum dots (QDs) gel using a Cd supramolecular gel as a scaffold was demonstrated. During the QDs formation process, the Cd ions that constituted the Cd gels served as the precursors of the CdS QDs, and the oleic acid (OA) that ligated with the Cd in the supramolecular gels was capped on the surface of the CdS QDs in the form of carboxylate. The OA-stabilized CdS QDs were in situ synthesized in the entangled self-assembled fibrillar networks (SAFIN) of the Cd gels through reactions between the gelator and H2S. As a result, the QDs exactly replicated the framework of the SAFIN in the CdS QD gels instead of simply assembling along the SAFIN of the supramolecular gels. Moreover, the CdS QDs showed extraordinary sensitivity in the fluorescence detection of IO4 - anions. The facile one-step method developed here is a new approach to assembling nanostructured materials into 3D architectures and has general implications for the design of low molecular mass gelators to bring desired functionality to the developed supramolecular gels.

  13. Synthesis, characterization and comparison of antimicrobial activity of PEG/TritonX-100 capped silver nanoparticles on collagen scaffold.

    Science.gov (United States)

    Mandal, A; Meda, V; Zhang, W J; Farhan, K M; Gnanamani, A

    2012-02-01

    Silver nanoparticles have received attention as novel antimicrobial agents. In order to study the effects of silver nanoparticles on both Gram positive and negative bacteria, the nanoparticles were synthesized via chemical reduction method using different concentrations (0.3, 0.6 and 0.9 mM) of poly(ethylene) glycol (PEG) and TritonX-100 (TX). Also, mixed PEG/TX systems with equimolar concentrations capped silver nanoparticles were synthesized and confirmed by UV-vis, fluorescence spectroscopy and particle size analysis. These coated silver nanoparticles were incorporated into collagen, lyophilized to form scaffolds and characterized by SEM, XRD, ATR-FTIR, DSC, TGA and zeta potential. Results on mechanical property of all the scaffolds displayed no significant difference in the percentage elongation at break. However, the maximum percentage of 46.67% was observed with the combinations (0.9 mM PEG+0.9 mM TX). This implies that the combinations of surfactants increase the elasticity, which is useful for biomedical applications, e.g., heart-valve preparations. Furthermore, the antimicrobial activities of these capped silver nanoparticles homogenized with collagen were tested against both Gram positive and negative bacteria. Minimum inhibitory concentration values obtained for the combination (0.9 mM PEG+0.9 mM TX) were found to be better than others and thus provide strong antibacterial property to the collagen scaffolds prepared for tissue regeneration applications. Copyright © 2011 Elsevier B.V. All rights reserved.

  14. Effect of Organic Capping Layers over Monodisperse Platinum Nanoparticles upon Activity for Ethylene Hydrogenation and Carbon Monoxide Oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Kuhn, John N.; Tsung, Chia-Kuang; Huang, Wenyu; Somorjai, Gabor A.

    2009-03-24

    The influence of oleylamine (OA), trimethyl tetradecyl ammonium bromide (TTAB), and polyvinlypyrrolidone (PVP) capping agents upon the catalytic properties of Pt/silica catalysts was evaluated. Pt nanoparticles that were 1.5 nm in size were synthesized by the same procedure (ethylene glycol reduction under basic conditions) with the various capping agents added afterward for stabilization. Before examining catalytic properties for ethylene hydrogenation and CO oxidation, the Pt NPs were deposited onto mesoporous silica (SBA-15) supports and characterized by transmission electron microscopy (TEM), H{sub 2} chemisorption, and elemental analysis (ICP-MS). PVP- and TTAB-capped Pt yielded mass-normalized reaction rates that decreased with increasing pretreatment temperature, and this trend was attributed to the partial coverage of the Pt surface with decomposition products from the organic capping agent. Once normalized to the Pt surface area, similar intrinsic activities were obtained regardless of the pretreatment temperature, which indicated no influence on the nature of the active sites. Consequently, a chemical probe technique using intrinsic activity for ethylene hydrogenation was demonstrated as an acceptable method for estimating the metallic surface areas of Pt. Amine (OA) capping exhibited a detrimental influence on the catalytic properties as severe deactivation and low activity were observed for ethylene hydrogenation and CO oxidation, respectively. These results were consistent with amine groups being strong poisons for Pt surfaces, and revealed the need to consider the effects of capping agents on the catalytic properties.

  15. Electrochemistry of ATP-capped silver nanoparticles in layer-by-layer multilayer films

    Science.gov (United States)

    Singh, Poonam; Solomon, Virgil C.; Buttry, Daniel A.

    2014-07-01

    Colloidal silver nanoparticles (Ag NPs) capped with adenosine triphosphate (ATP) were prepared using borohydride reduction of Ag+ in the presence of ATP. Subsequent characterization was done using transmission electron microscopy/high-resolution transmission electron microscopy, energy-dispersive X-ray spectroscopy, and non-contact atomic force microscopy (NcAFM) confirming the size and composition of the Ag NPs. This report focuses on two topics: (1) the change in NP size and properties as a function of molar ratios of Ag+ to ATP capping ligand to BH4 - reductant, and (2) the electrochemical behavior of the NPs in layer-by-layer (LbL) multilayer films. On the basis of electrostatic interaction between negatively charged phosphate groups on Ag NPs and positively charged poly(diallyldimethylammonium) hydrochloride, NPs were immobilized on 3-mercaptopropionic acid (MCP)-functionalized gold electrodes using LbL assembly method followed by characterization of the film using NcAFM. Furthermore, the redox chemistry for phase transformations of immobilized Ag NPs to AgCl or Ag2O in multilayer films was examined using cyclic voltammetry (CV) in NaOH and NaCl solutions. A non-linear increase of charge with an increase in the number of bilayers in the film was observed up to five layers. Underpotential deposition of Pb on multilayer film of Ag NPs confirmed the presence of Ag in multilayer films. The stability of the LbL film toward electrochemical cycling to higher potentials (i.e., +0.8 V) in NaOH solutions was evaluated.

  16. X-ray magnetic circular dichroism and small angle neutron scattering studies of thiol capped gold nanoparticles.

    Energy Technology Data Exchange (ETDEWEB)

    de la Venta, J.; Bouzas, V.; Pucci, A.; Laguna-Marco, M. A.; Haskel, D.; te Velthuis, S. G. E; Hoffmann, A.; Lal, J.; Bleuel, M.; Ruggeri, G.; de Julian Fernandez, C.; Garcia, M. A.; Univ.Complutense de Madrid; Inst. de Magnetismo Aplicado; Univ. of Pisa; Lab. di Magnetismo Molecolare

    2009-01-01

    X-ray magnetic circular dichroism (XMCD) and Small Angle Neutron Scattering (SANS) measurements were performed on thiol capped Au nanoparticles (NPs) embedded into polyethylene. An XMCD signal of 0.8 {center_dot} 10{sup -4} was found at the Au L{sub 3} edge of thiol capped Au NPs embedded in a polyethylene matrix for which Superconducting Quantum Interference Device (SQUID) magnetometry yielded a saturation magnetization, M{sub s}, of 0.06 emu/g{sub Au}. SANS measurements showed that the 3.2 nm average-diameter nanoparticles are 28% polydispersed, but no detectable SANS magnetic signal was found with the resolution and sensitivity accessible with the neutron experiment. A comparison with previous experiments carried out on Au NPs and multilayers, yield to different values between XMCD signals and magnetization measured by SQUID magnetometer. We discuss the origin of those differences.

  17. X-ray magnetic circular dichroism and small angle neutron scattering study of thiol capped gold nanoparticles.

    Energy Technology Data Exchange (ETDEWEB)

    de la Venta, J.; Bouzas, V.; Pucci, A.; Laguna-Marco, M. A.; Haskel, D.; Pinel, E. F.; te Velthuis, S. G. E.; Hoffmann, A.; Lal, J.; Bleuel, M.; Ruggeri, G.; de Julian, C.; Garcia, M. A.; Univ. Complutense de Madrid; Inst. de Magnetismo Aplicado UCM; Univ. Pisa; Univ. di Padova

    2009-11-01

    X-ray magnetic circular dichroism (XMCD) and Small Angle Neutron Scattering (SANS) measurements were performed on thiol capped Au nanoparticles (NPs) embedded into polyethylene. An XMCD signal of 0.8 {center_dot} 10{sup -4} was found at the Au L{sub 3} edge of thiol capped Au NPs embedded in a polyethylene matrix for which Superconducting Quantum Interference Device (SQUID) magnetometry yielded a saturation magnetization, M{sub s}, of 0.06 emu/g{sub Au}. SANS measurements showed that the 3.2 nm average-diameter nanoparticles are 28% polydispersed, but no detectable SANS magnetic signal was found with the resolution and sensitivity accessible with the neutron experiment. A comparison with previous experiments carried out on Au NPs and multilayers, yield to different values between XMCD signals and magnetization measured by SQUID magnetometer. We discuss the origin of those differences.

  18. Green synthesis of biocompatible carboxylic curdlan-capped gold nanoparticles and its interaction with protein.

    Science.gov (United States)

    Yan, Jing-Kun; Liu, Jin-Lin; Sun, Yu-Jia; Tang, Shuang; Mo, Zheng-Ying; Liu, Yuan-Shuai

    2015-03-06

    This study demonstrates a facile, green strategy for the preparation of gold nanoparticles (AuNPs) from chloroauric acid (HAuCl4) using carboxylic curdlan (Cc) as both reducing and stabilizing agent. The as-prepared AuNPs are characterized by UV-vis spectroscopy, high resolution transmission electron microscopy, X-ray diffraction, energy dispersive X-ray spectrometry and Fourier transform infrared spectroscopy. The results indicated that the particle size of the AuNPs changes with variations in the reaction time and concentrations of Cc and HAuCl4. The spherical AuNPs are well dispersed, exhibiting high stability even after six months storage. The carboxylic groups (COO(-)) in the Cc molecules tend to adsorb and stabilize the surface of the AuNPs. The interaction between BSA and the Cc-capped AuNPs was investigated using fluorescence and circular dichroism spectroscopies. The results indicated that the BSA molecules adsorb on the surface of the AuNPs, without significant change in its helical structure even after conjugation with the AuNPs. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Deposition of CdS nanoparticles on MIL-53(Fe) metal-organic framework with enhanced photocatalytic degradation of RhB under visible light irradiation

    Science.gov (United States)

    Hu, Longxing; Deng, Guihua; Lu, Wencong; Pang, Siwei; Hu, Xing

    2017-07-01

    A novel composite, CdS/MIL-53(Fe), was successfully fabricated via a facile solvothermal method and characterized with XRD, SEM, TEM, XPS, FT-IR and UV-vis DRS. The results showed that the fabrication was able to result in a good dispersion of CdS nanoparticles onto MIL-53(Fe). The photocatalytic activities of the as-synthesized composite were investigated through the degradation of Rhodamine B (RhB) in water under visible light irradiation. It was found that the composite prepared at the mass ratio of CdS to MIL-53(Fe) of 1.5:1 displayed the highest photocatalytic activity. An approximately 92.5% of photocatalytic degradation of RhB was achieved at 0.5 g/L of 1.5-CdS/MIL dosage, 10 mg/L of initial RhB concentration and 23 °C of reaction temperature under visible light irradiation. The RhB photocatalytic degradation followed well the first-order kinetics equation and the increased catalyst dosage and optimal initial RhB concentration were responsible for the enhanced photocatalytic degradation. Quenching tests revealed that the predominant free radicals in the CdS/MIL-(53)-RhBaq-visible light system was O2-rad ; nevertheless, h+ and rad OH also contributed to a certain degree. The enhanced photocatalytic performance was ascribed to the formation of heterojunction structure between CdS and MIL-53(Fe) which significantly suppressed the recombination of photogenerated electron-hole pairs. Moreover, the reusability of 1.5-CdS/MIL composite was also studied.

  20. Effect of capping agents on the cytotoxicity of silver nanoparticles in human normal and cancer skin cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Netchareonsirisuk, Ponsawan [Chulalongkorn University, Program in Biotechnology, Faculty of Science (Thailand); Puthong, Songchan [Chulalongkorn University, Antibody Production Research Unit, Institute of Biotechnology and Genetic Engineering (Thailand); Dubas, Stephan [Chulalongkorn University, Petroleum and Petrochemical College (Thailand); Palaga, Tanapat [Chulalongkorn University, Department of Microbiology, Faculty of Science (Thailand); Komolpis, Kittinan, E-mail: kittinan.k@chula.ac.th [Chulalongkorn University, Antibody Production Research Unit, Institute of Biotechnology and Genetic Engineering (Thailand)

    2016-11-15

    Silver nanoparticles (AgNPs) are among the most widely used nanomaterials in medical and consumer products. However, safety in the uses of AgNPs is still controversial. The toxicity of AgNPs toward various cell types has been reported to depend on the surface properties of the nanoparticles. In this study, the effect of AgNPs with the average size of 5–15 nm on the viability of the CCD-986SK human normal skin fibroblast cell line and A375 human malignant melanoma cell line was evaluated. Comparative toxicity studies, based on MTT assay, were performed by using either sodium alginate or poly (4-styrenesulfonic acid-co-maleic acid) sodium salt (PSSMA) as capping agent in the nanoparticle preparation. The cytotoxicity tests revealed that AgNO{sub 3} alone was highly toxic to both cell types while both alginate and PSSMA alone were not toxic. AgNPs capped with alginate were selectively toxic to the cancer cell line but not to the normal cell line while AgNPs capped with PSSMA were toxic to both cancer and normal cell lines. Judging from the 50 % inhibition concentration (IC{sub 50}), it was found that the cancer cell line was more sensitive to AgNPs than the normal cell line. Study on the mode of cell death by annexin V and propidium iodide staining revealed that AgNPs induced more apoptotic cell death (84–90 %) than necrosis (8–12 %) in the skin cancer cell line. These results suggest that the toxicity of AgNPs depended on the type of capping agent and the type of cell line.

  1. A New Smart Surface-Enhanced Raman Scattering Sensor Based on pH-Responsive Polyacryloyl Hydrazine Capped Ag Nanoparticles

    Science.gov (United States)

    Yuan, Shuai; Ge, Fengyan; Zhou, Man; Cai, Zaisheng; Guang, Shanyi

    2017-08-01

    A novel pH-responsive Ag@polyacryloyl hydrazide (Ag@PAH) nanoparticle for the first time as a surface-enhanced Raman scattering (SERS) substrate was prepared without reducing agent and end-capping reagent. Ag@PAH nanoparticles exhibited an excellent tunable detecting performance in the range from pH = 4 to pH = 9. This is explained that the swelling-shrinking behavior of responsive PAH can control the distance between Ag NPs and the target molecules under external pH stimuli, resulting in the tunable LSPR and further controlled SERS. Furthermore, Ag@PAH nanoparticles possessed an ultra-sensitive detecting ability and the detection limit of Rhodamine 6G reduced to 10-12 M. These advantages qualified Ag@PAH NP as a promising smart SERS substrate in the field of trace analysis and sensors.

  2. Synthesis of PEG-Iodine-Capped Gold Nanoparticles and Their Contrast Enhancement in In Vitro and In Vivo for X-Ray/CT

    Directory of Open Access Journals (Sweden)

    Sun-Hee Kim

    2012-01-01

    Full Text Available We designed gold nanoparticles (AuNPs capped with iodine and polyethylene glycol (PEG to provide effective enhancement for X-ray CT imaging. The methoxy PEG-iodine-capped AuNPs were prepared through the chemisorption of iodine and substitution of methoxy PEG-SH onto the surface of gold nanoparticles, and severe aggregation in TEM was not observed. The binding energies of Au 4f7/2 and I 3d5/2 of the methoxy PEG-iodine-capped AuNPs were obtained as 84.1 eV and 619.3 eV, respectively. The binding energy shift of methoxy PEG-iodine-capped AuNPs would be resulted from the chemisorption between gold nanoparticles and iodine atoms. The methoxy PEG-iodine-capped AuNPs have higher enhancement compared to PEG-capped gold nanoparicles in the same amount of gold in vitro. After postinjection of methoxy PEG-iodine-capped AuNPs into the mice, dramatic contrast enhancement at the heart, aorta, liver, and kidney was observed, this was maintained up to 5 days, and there was no evidence of apparent toxicity. In conclusion, methoxy PEG-iodine-capped AuNPs might be a good candidate as a CT contrast agent for blood pool imaging, and this will also contribute to the prolongation of a blood circulation time for X-ray CT imaging.

  3. The effect of reducing agents on the electronic, magnetic and electrocatalytic properties of thiol-capped Pt/Co and Pt/Ni nanoparticles

    CSIR Research Space (South Africa)

    Mathe, NR

    2015-05-01

    Full Text Available The electronic, magnetic and electrocatalytic properties of bimetallic thiol-capped Pt/Co and Pt/Ni nanoparticles were synthesised using two reducing agents, NaBH(sub4) and N(sub2)H(sub4). X-ray diffraction analysis of the nanoparticles showed Pt...

  4. Size-related cytotoxicological aspects of polyvinylpyrrolidone-capped platinum nanoparticles.

    Science.gov (United States)

    Buchtelova, Hana; Dostalova, Simona; Michalek, Petr; Krizkova, Sona; Strmiska, Vladislav; Kopel, Pavel; Hynek, David; Richtera, Lukas; Ridoskova, Andrea; Adam, Pavlina; Kynicky, Jindrich; Brtnicky, Martin; Heger, Zbynek; Adam, Vojtech

    2017-07-01

    The nanotechnological concept is based on size-dependent properties of particles in the 1-100 nm range. Nevertheless, the connection between their size and effect is still not clear. Thus, we focused on reductive colloidal synthesis, characterization and biological testing of Pt nanoparticles (PtNPs) capped with biocompatible polymer polyvinylpyrrolidone (PVP). Synthesized PtNPs were of 3 different primary sizes (approx. ∼10; ∼14 and > 20 nm) and demonstrated exceptional haemocompatibility. In vitro treatment of three different types of malignant cells (prostate - LNCaP, breast - MDA-MB-231 and neuroblastoma - GI-ME-N) revealed that even marginal differences in PtNPs diameter resulted in changes in their cytotoxicity. The highest cytotoxicity was observed using the smallest PtNPs-10, where 24IC50 was lower (3.1-6.2 μg/mL) than for cisplatin (8.1-19.8 μg/mL). In contrast to MDA-MB-231 and LNCaP cells, in GI-ME-N cells PtNPs caused noticeable changes in their cellular structure without influencing their viability. Post-exposure analyses revealed that PtNPs-29 and PtNPs-40 were capable of forming considerably higher amount of reactive oxygen species with consequent stimulation of expression of metallothionein (MT1/2 and MT3), at both mRNA and protein level. Overall, our pilot study demonstrates that in the nanoscaled world even the smallest differences can have crucial biological effect. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Effects of successive additions of two capping ligands on the structural properties of PbO nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Bangi, Uzma K. H.; Han, Wooje [Yonsei University, Department of Materials Science and Engineering (Korea, Republic of); Yoo, Byungwook [Korea Electronics Technology Institute, Flexible Display Research Center (Korea, Republic of); Park, Hyung-Ho, E-mail: hhpark@yonsei.ac.kr [Yonsei University, Department of Materials Science and Engineering (Korea, Republic of)

    2013-11-15

    A cost-effective approach to the synthesis of lead oxide (PbO) nanoparticles by successive additions of two capping ligands using a simple method of precipitation is reported herein. The successive additions of polyvinyl pyrrolidone (PVP) and cetyltrimethyl ammonium bromide (CTAB) cap the Pb(OH){sub 2} with a primary layer of PVP and a secondary layer of CTAB, forming a bilayer system around Pb(OH){sub 2}. PVP controls the PbO particle size, while CTAB enhances the particle size of the PVP-treated PbO by seeding growth process. The effects of the successive additions of these two capping ligands were studied by varying the relative percentages of PVP and CTAB from 0 to 100 %. From transmission electron microscopy and X-ray diffraction results, it was confirmed that the size of the PbO nanoparticles decreased with a relative increase in the percentage of PVP (and corresponding decrease in the percentage of CTAB). Furthermore, X-ray diffraction results demonstrated the formation of a pure α-PbO phase. Field emission scanning electron microscopy images showed the increase in grain size with the decrease in the percentage of PVP. Infrared spectroscopy depicted the formation of PbO along with the presence of PVP and CTAB covering the particle surface. Thermogravimetric analysis and differential thermal analysis revealed the decomposition of lead oxalate to α-PbO at around 370 °C.

  6. Comparison of ZnS semiconductor nanoparticles capped with various functional groups as the matrix and affinity probes for rapid analysis of cyclodextrins and proteins in surface-assisted laser desorption/ionization time-of-flight mass spectrometry.

    Science.gov (United States)

    Kailasa, Suresh Kumar; Kiran, Kamatam; Wu, Hui-Fen

    2008-12-15

    Zinc sulfide (ZnS) semiconductor nanoparticles (NPs) capped with a variety of functional groups including bare ZnS NPs, 3-mercaptopropanoic acid (ZnS-3-MPA), sodium citrate (ZnS-citrate), cysteamine (ZnS-Cys), and 2-mercaptoethane sulfonate (ZnS-2-MES) have been investigated as the matrix and affinity probes for analysis of alpha-, beta-, and gamma-cyclodextrins (CDs), ubiquitin, and insulin in biological samples by using surface-assisted laser desorption/ionization time-of-flight mass spectrometry (SALDI-TOF-MS). Various parameters that would influence the ionization efficiency and sensitivity of these ZnS NPs in SALDI-TOF-MS were examined including the effect of capping agents, sample pH, ion abundance, and concentration of ZnS NPs. Among these ZnS NPs, our results have demonstrated that ZnS-3-MPA exhibited the highest efficiency toward CDs, ubiquitin, and insulin for high-sensitivity detection in SALDI-TOF-MS. The detection limits were 20-55 nM for CDs, 91 nM for ubiquitin, and 85 nM for insulin. The applicability of the present method is demonstrated by detection of ubiquitin-like proteins in oyster mushroom and also in the analysis of analytes in biological samples such as human urine and plasma. To our best knowledge, this is the first time semiconductor NPs were used as the matrix and affinity probes for high-sensitivity detection of organic and biomolecules in SALDI-TOF-MS. This approach exhibits the advantages of being simple, rapid, efficient, and straightforward for direct analysis of organic and biological samples in SALDI-TOF-MS without the need for time-consuming separation processes, tedious washing steps, or further laborious purification. In addition, it also can provide a sensitive and reliable quantitative assay for small- and large-molecule analysis with the detectable mass up to 8500 Da. We believe that this novel ZnS nanoprobe is simple, efficient, lower cost (compared with Au, Ag, and Pt NPs), fast, and with the potential for high

  7. Gold nanoparticles capped by a GC-containing peptide functionalized with an RGD motif for integrin targeting.

    Science.gov (United States)

    Scarì, Giorgio; Porta, Francesca; Fascio, Umberto; Avvakumova, Svetlana; Dal Santo, Vladimiro; De Simone, Mariarosaria; Saviano, Michele; Leone, Marilisa; Del Gatto, Annarita; Pedone, Carlo; Zaccaro, Laura

    2012-03-21

    Gold nanoparticles were obtained by reduction of a tetrachloroaurate aqueous solution in the presence of a RGD-(GC)(2) peptide as stabilizer. As comparison, the behavior of the (GC)(2) peptide has been studied. The (GC)(2) and RGD-(GC)(2) peptides were prepared ad hoc by Fmoc synthesis. The colloidal systems have been characterized by UV-visible, TGA, ATR-FTIR, mono and bidimensional NMR techniques, confocal and transmission (TEM) microscopy, ζ-potential, and light scattering measurements. The efficient cellular uptake of Au-RGD-(GC)(2) and Au-(GC)(2) stabilized gold nanoparticles into U87 cells (human glioblastoma cells) were investigated by confocal microscopy and compared with the behavior of (GC)(2) capped gold nanoparticles. A quantitative determination of the nanoparticles taken up has been carried out by measuring the pixel brightness of the images, a measure that highlighted the importance of the RGD termination of the peptide. Insight in the cellular uptake mechanism was investigated by TEM microscopy. Various important evidences indicated the selective uptake of RGD-(GC)(2) gold nanoparticles into the nucleus.

  8. Effect of capping agent on the morphology, size and optical properties of In{sub 2}O{sub 3} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Latha, Ch. Kanchana; Aparna, Y. [Department of Physics, Jawaharlal Nehru Technological University Hyderabad (JNTUH), College of Engineering Hyderabad (CEH), Telangana (India); Raghasudha, Mucherla; Veerasomaiah, P., E-mail: raghasudha_m@yahoo.co.in [Department of Chemistry, University College of Science, Osmania University, Hyderabad, Telangana (India); Ramchander, M. [Department of Bio Chemistry, Mahatma Gandhi University, Nalgonda, Telangana (India); Ravinder, D. [Department of Physics, Osmania University, Hyderabad, Telangana (India); Jaipal, K. [Inorganic & Physical Chemistry Division, Indian Institute of Chemical Technology (IICT), Hyderabad, Telangana (India); Shridhar, D. [Department of Physics, Khairatabad Government Degree College, Hyderabad, Telangana (India)

    2017-01-15

    The Indium Oxide (In{sub 2}O{sub 3}) nanoparticles were synthesized through Acacia gum mediated method with the surfactants CTAB (Cetyl Trimethyl Ammonium Bromide) and SDBS (Sodium Docecyl Benzene Sulfonate). The characterization of the synthesized In{sub 2}O{sub 3} nanoparticles was carried out by XRD, FTIR, RAMAN, TEM, SEM, EDAX, UV-Vis and PL techniques. TG-DTA analysis was performed to know the calcination temperature of In{sub 2}O{sub 3} nanoparticles. XRD analysis confirmed the crystalline nature of the synthesized In{sub 2}O{sub 3} nanoparticles. The morphology and chemical composition were characterized by TEM, SEM and EDAX respectively. It was observed that morphology and size of synthesized nanoparticles measured by TEM and SEM analysis were dependent on the type of capping agent (surfactant) used. Raman and UV-Vis spectral analysis confirmed that the band gap value of CTAB capped In{sub 2}O{sub 3} particles were larger than the SDBS capped In{sub 2}O{sub 3} particles. FTIR analysis indicated that the bands were stretched in In{sub 2}O{sub 3} particles capped by SDBS than by CTAB. From the photoluminescence studies (PL technique), a blue shift in the emission peaks of CTAB and SDBS capped In{sub 2}O{sub 3} particles was observed that indicates larger optical band gap than the bulk. (author)

  9. Effects of metal-bearing nanoparticles (Ag, Au, CdS, ZnO, SiO2) on developing zebrafish embryos

    Science.gov (United States)

    María Lacave, José; Retuerto, Ander; Vicario-Parés, Unai; Gilliland, Douglas; Oron, Miriam; Cajaraville, Miren P.; Orbea, Amaia

    2016-08-01

    Due to the increasing commercialization of consumer and industrial products containing nanoparticles (NPs), an increase in the introduction of these materials into the environment is expected. NP toxicity to aquatic organisms depends on multiple biotic and abiotic factors, resulting in an unlimited number of combinations impossible to test in practice. The zebrafish embryo model offers a useful screening tool to test and rank the toxicity of nanomaterials according to those diverse factors. This work aims to study the acute and sublethal toxicity of a set of metal-bearing NPs displaying different properties, in comparison to that of the ionic and bulk forms of the metals, in order to establish a toxicity ranking. Soluble NPs (Ag, CdS and ZnO) showed the highest acute and sublethal toxicity, with LC50 values as low as 0.529 mg Ag l-1 for Ag NPs of 20 nm, and a significant increase in the malformation prevalence in embryos exposed to 0.1 mg Cd l-1 of CdS NPs of ˜4 nm. For insoluble NPs, like SiO2 NPs, acute effects were not observed during early embryo development due to the protective effect of the chorion. But effects on larvae could be expected, since deposition of fluorescent SiO2 NPs over the gill lamella and excretion through the intestine were observed after hatching. In other cases, such as for gold NPs, the toxicity could be attributed to the presence of additives (sodium citrate) in the NP suspension, as they displayed a similar toxicity when tested separately. Overall, the results indicated that toxicity to zebrafish embryos depends primarily on the chemical composition and, thus, the solubility of the NPs. Other characteristics, such as size, played a secondary role. This was supported by the observation that ionic forms of the metals were always more toxic than the nano forms, and bulk forms were the least toxic to the developing zebrafish embryos.

  10. Deposition of CdS nanoparticles on MIL-53(Fe) metal-organic framework with enhanced photocatalytic degradation of RhB under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Longxing, E-mail: hulxhhhb@shu.edu.cn [School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Deng, Guihua [School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Lu, Wencong [College of Sciences, Shanghai University, Shanghai 200444 (China); Pang, Siwei; Hu, Xing [School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China)

    2017-07-15

    Graphical abstract: The CdS/MIL-53(Fe) photocatalyst has been synthesized by a facile two-step solvothermal method and applied for photocatalytic degradation of organic pollutant RhB under visible light irradiation. - Highlights: • A novel CdS/MIL-53(Fe) photocatalyst was successfully synthesized via a facile two-step solvothermal method. • CdS/MIL-53(Fe) exhibited an enhanced visible-light photocatalytic degradation of RhB in water. • The mechanisms for the formation of CdS/MIL-53(Fe) and photocatalytic degradation of RhB were proposed. - Abstract: A novel composite, CdS/MIL-53(Fe), was successfully fabricated via a facile solvothermal method and characterized with XRD, SEM, TEM, XPS, FT-IR and UV–vis DRS. The results showed that the fabrication was able to result in a good dispersion of CdS nanoparticles onto MIL-53(Fe). The photocatalytic activities of the as-synthesized composite were investigated through the degradation of Rhodamine B (RhB) in water under visible light irradiation. It was found that the composite prepared at the mass ratio of CdS to MIL-53(Fe) of 1.5:1 displayed the highest photocatalytic activity. An approximately 92.5% of photocatalytic degradation of RhB was achieved at 0.5 g/L of 1.5-CdS/MIL dosage, 10 mg/L of initial RhB concentration and 23 °C of reaction temperature under visible light irradiation. The RhB photocatalytic degradation followed well the first-order kinetics equation and the increased catalyst dosage and optimal initial RhB concentration were responsible for the enhanced photocatalytic degradation. Quenching tests revealed that the predominant free radicals in the CdS/MIL-(53)-RhB{sub aq}-visible light system was O{sub 2}{sup −}·; nevertheless, h{sup +} and ·OH also contributed to a certain degree. The enhanced photocatalytic performance was ascribed to the formation of heterojunction structure between CdS and MIL-53(Fe) which significantly suppressed the recombination of photogenerated electron-hole pairs

  11. Efficient pH Dependent Drug Delivery to Target Cancer Cells by Gold Nanoparticles Capped with Carboxymethyl Chitosan

    Directory of Open Access Journals (Sweden)

    Alle Madhusudhan

    2014-05-01

    Full Text Available Doxorubicin (DOX was immobilized on gold nanoparticles (AuNPs capped with carboxymethyl chitosan (CMC for effective delivery to cancer cells. The carboxylic group of carboxymethyl chitosan interacts with the amino group of the doxorubicin (DOX forming stable, non-covalent interactions on the surface of AuNPs. The carboxylic group ionizes at acidic pH, thereby releasing the drug effectively at acidic pH suitable to target cancer cells. The DOX loaded gold nanoparticles were effectively absorbed by cervical cancer cells compared to free DOX and their uptake was further increased at acidic conditions induced by nigericin, an ionophore that causes intracellular acidification. These results suggest that DOX loaded AuNPs with pH-triggered drug releasing properties is a novel nanotheraputic approach to overcome drug resistance in cancer.

  12. Melanoma-Targeted Chemothermotherapy and In Situ Peptide Immunotherapy through HSP Production by Using Melanogenesis Substrate, NPrCAP, and Magnetite Nanoparticles

    Directory of Open Access Journals (Sweden)

    Kowichi Jimbow

    2013-01-01

    Full Text Available Exploitation of biological properties unique to cancer cells may provide a novel approach to overcome difficult challenges to the treatment of advanced melanoma. In order to develop melanoma-targeted chemothermoimmunotherapy, a melanogenesis substrate, N-propionyl-4-S-cysteaminylphenol (NPrCAP, sulfur-amine analogue of tyrosine, was conjugated with magnetite nanoparticles. NPrCAP was exploited from melanogenesis substrates, which are expected to be selectively incorporated into melanoma cells and produce highly reactive free radicals through reacting with tyrosinase, resulting in chemotherapeutic and immunotherapeutic effects by oxidative stress and apoptotic cell death. Magnetite nanoparticles were conjugated with NPrCAP to introduce thermotherapeutic and immunotherapeutic effects through nonapoptotic cell death and generation of heat shock protein (HSP upon exposure to alternating magnetic field (AMF. During these therapeutic processes, NPrCAP was also expected to provide melanoma-targeted drug delivery system.

  13. Synthesis of functionalized gold nanoparticles capped with 3-mercapto-1-propansulfonate and 1-thioglucose mixed thiols and "in vitro" bioresponse.

    Science.gov (United States)

    Porcaro, F; Battocchio, C; Antoccia, A; Fratoddi, I; Venditti, I; Fracassi, A; Luisetto, I; Russo, M V; Polzonetti, G

    2016-06-01

    The synthesis, characterization and assessment of biological behavior of innovative negatively charged functionalized gold nanoparticles is herein reported, for potential applications in the field of radiotherapy and drug delivery. Gold nanoparticles (AuNPs) functionalized with two capping agents, i.e., the 3-mercapto-1-propansulfonate (3-MPS) and 1-β-thio-D-glucose (TG), have been on purpose synthesized and fully characterized. Advanced characterization techniques including X-Ray Photoelectron Spectroscopy (XPS) were applied to probe the chemical structure of the synthesized nanomaterials. Z-potential and Dynamic Light Scattering measurements allowed assessing the nanodimension, dispersity, surface charge and stability of AuNPs. Transmission Electron Microscopy (TEM) and Flame Atomic Absorption Spectroscopy (FAAS) were applied to the "in vitro" HSG cell model, to investigate the nanoparticles-cells interaction and to evaluate the internalization efficiency, whereas short term cytotoxicity and long term cell killing were evaluated by means of MTT and SRB assays, respectively. In conclusion, in order to increase the amount of gold atoms inside the cell we have optimized the synthesis for a new kind of biocompatible and very stable negatively charged TG-functionalized nanoparticles, with diameters in a range that maximize the uptake in cells (i.e., ∼15nm). Such particles are very promising for radiotherapy and drug delivery application. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Study of the synthesis of copper nanoparticles: the role of capping and kinetic towards control of particle size and stability

    Science.gov (United States)

    Granata, Giuseppe; Yamaoka, Taishi; Pagnanelli, Francesca; Fuwa, Akio

    2016-05-01

    The synthesis of copper nanoparticles (CuNPs) by surfactant-assisted chemical reduction method was studied aiming to identify and quantify the role of kinetic and capping on particle size distribution. The use of a strong and a mild reducing agent (hydrazine, d-glucose) has been investigated as well as the use of three different capping agents: cetyl trimethyl ammonium bromide (CTAB), sodium dodecyl sulfate (SDS) and polyvinylpyrrolidone (PVP). Experimental tests were arranged according to factorial designs. CuNPs were characterized by XRD, FE-SEM and UV-Vis spectrophotometry. Particle size distribution was determined by image analysis and significance of investigated factors was statistically assessed by analysis of variance. Under the investigated conditions, CTAB was found capable of preventing oxidation but it had a significant positive effect on nanoparticle size (about 40 and 30 nm); SDS determined a good size control but no stabilization, whilst PVP could provide both size control (significant negative effect of about 15 and 25 nm) and stability. Average size of CuNPs can be significantly reduced of about 50 nm by replacing d-glucose with hydrazine.

  15. Eco-friendly synthesis of gelatin-capped bimetallic Au-Ag nanoparticles for chemiluminescence detection of anticancer raloxifene hydrochloride.

    Science.gov (United States)

    Alarfaj, Nawal A; El-Tohamy, Maha F

    2016-09-01

    This study described the utility of green analytical chemistry in the synthesis of gelatin-capped silver, gold and bimetallic gold-silver nanoparticles (NPs). The preparation of nanoparticles was based on the reaction of silver nitrate or chlorauric acid with a 1.0 wt% aqueous gelatin solution at 50°C. The gelatin-capped silver, gold and bimetallic NPs were characterized using transmission electron microscopy, UV-vis, X-ray diffraction and Fourier transform infrared spectroscopy, and were used to enhance a sensitive sequential injection chemiluminescence luminol-potassium ferricyanide system for determination of the anticancer drug raloxifene hydrochloride. The developed method is eco-friendly and sensitive for chemiluminescence detection of the selected drug in its bulk powder, pharmaceutical injections and biosamples. After optimizing the conditions, a linear relationship in the range of 1.0 × 10(-9) to 1.0 × 10(-1)  mol/L was obtained with a limit of detection of 5.0 × 10(-10)  mol/L and a limit of quantification of 1.0 × 10(-9)  mol/L. Statistical treatment and method validation were performed based on ICH guidelines. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  16. Enhanced antimicrobial efficacy by co-delivery of PGA capped silver nanoparticles and ascorbic acid with poly(lactide-co-glycolide)

    OpenAIRE

    Stevanović, Magdalena; M. Milenković; Petković, Jana; Filipič, Metka; Uskoković, Dragan

    2012-01-01

    Silver nanoparticles (AgNps) were prepared by modified chemical reduction with poly (Lglutamic acid) (PGA) as capping agent. These Ag/PGA nanoparticles (AgNpPGAs) were highly stable over the long periods of time without signs of precipitation. Ascorbic acid, a water soluble antioxidant, was encapsulated together with these stable AgNpPGAs within poly(DL-lactide-coglycolide) polymeric matrix and their synergistic antimicrobial effect was studied. The antimicrobial activity of the samples was i...

  17. Hydrophilic poly (ethylene glycol) capped poly (lactic-co-glycolic) acid nanoparticles for subcutaneous delivery of insulin in diabetic rats.

    Science.gov (United States)

    S, Saravanan; S, Malathi; P S L, Sesh; S, Selvasubramanian; S, Balasubramanian; V, Pandiyan

    2017-02-01

    The aim of the present study is to evaluate the effect of insulin loaded poly(ethylene glycol) capped poly(lactic-co-glycolic)acid nanoparticles (ISPPLG NPs) by subcutaneous administration in diabetic rats. A series of biodegradable low molecular weight PLGA [90/10 (PLG2) and 80/20 (PLG4)] copolymers were synthesized by melt polycondensation and their ISPPLG NPs were synthesized by water-oil-water (W/O/W) emulsion solvent evaporation method. The PLGA copolymers and their nanoparticles were characterized. The maximum encapsulation efficiency of ISPPLG4 NPs is 66% and the diameter of the nanoparticles is about 140nm. The in-vivo studies of ISPPLG NPs carried out in diabetic rats by subcutaneous administration show considerable reduction in serum glucose level along with partial restoration of tissue defense systems. Histopathological studies reveal that ISPPLG NPs could restore the damages caused by oxidants during hyperglycaemia. The subcutaneous administration of ISPPLG4 NPs is thus an effective method of reducing hyperglycaemia associated complications. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Genetically designed biomolecular capping system for mesoporous silica nanoparticles enables receptor-mediated cell uptake and controlled drug release

    Science.gov (United States)

    Datz, Stefan; Argyo, Christian; Gattner, Michael; Weiss, Veronika; Brunner, Korbinian; Bretzler, Johanna; von Schirnding, Constantin; Torrano, Adriano A.; Spada, Fabio; Vrabel, Milan; Engelke, Hanna; Bräuchle, Christoph; Carell, Thomas; Bein, Thomas

    2016-04-01

    Effective and controlled drug delivery systems with on-demand release and targeting abilities have received enormous attention for biomedical applications. Here, we describe a novel enzyme-based cap system for mesoporous silica nanoparticles (MSNs) that is directly combined with a targeting ligand via bio-orthogonal click chemistry. The capping system is based on the pH-responsive binding of an aryl-sulfonamide-functionalized MSN and the enzyme carbonic anhydrase (CA). An unnatural amino acid (UAA) containing a norbornene moiety was genetically incorporated into CA. This UAA allowed for the site-specific bio-orthogonal attachment of even very sensitive targeting ligands such as folic acid and anandamide. This leads to specific receptor-mediated cell and stem cell uptake. We demonstrate the successful delivery and release of the chemotherapeutic agent Actinomycin D to KB cells. This novel nanocarrier concept provides a promising platform for the development of precisely controllable and highly modular theranostic systems.Effective and controlled drug delivery systems with on-demand release and targeting abilities have received enormous attention for biomedical applications. Here, we describe a novel enzyme-based cap system for mesoporous silica nanoparticles (MSNs) that is directly combined with a targeting ligand via bio-orthogonal click chemistry. The capping system is based on the pH-responsive binding of an aryl-sulfonamide-functionalized MSN and the enzyme carbonic anhydrase (CA). An unnatural amino acid (UAA) containing a norbornene moiety was genetically incorporated into CA. This UAA allowed for the site-specific bio-orthogonal attachment of even very sensitive targeting ligands such as folic acid and anandamide. This leads to specific receptor-mediated cell and stem cell uptake. We demonstrate the successful delivery and release of the chemotherapeutic agent Actinomycin D to KB cells. This novel nanocarrier concept provides a promising platform for the

  19. Influence of Capping Ligand and Synthesis Method on Structure and Morphology of Aqueous Phase Synthesized CuInSe2 Nanoparticles

    Science.gov (United States)

    Ram Kumar, J.; Ananthakumar, S.; Moorthy Babu, S.

    2017-01-01

    A facile route to synthesize copper indium diselenide (CuInSe2) nanoparticles in aqueous medium was developed using mercaptoacetic acid (MAA) as capping agent. Two different mole ratios (5 and 10) of MAA were used to synthesize CuInSe2 nanoparticles at room temperature, as well as hydrothermal (high temperature) method. Powder x-ray diffraction analysis reveals that the nanoparticles exhibit chalcopyrite phase and the crystallinity increases with increasing the capping ratio. Raman analysis shows a strong band at 233 cm-1 due to the combination of B2 (E) modes. Broad absorption spectra were observed for the synthesized CuInSe2 nanoparticles. The effective surface capping by MAA on the nanoparticles surface was confirmed through attenuated total reflection-Fourier transform infrared spectral analysis. The thermal stability of the synthesized samples was analyzed through thermogravimetric analysis-differential scanning calorimetry. The change in morphology of the synthesized samples was analyzed through scanning electron microscope and it shows that the samples prepared at room temperature are spherical in shape, whereas hydrothermally synthesized samples were found to have nanorod- and nanoflake-like structures. Transmission electron microscope analysis further indicates larger grains for the hydrothermally prepared samples with 10 mol ratio of MAA. Comparative analyses were made for synthesizing CuInSe2 nanoparticles by two different methods to explore the role of ligand and influence of temperature.

  20. Transmission electron microscopy of unstained hybrid Au nanoparticles capped with PPAA (plasma-poly-allylamine)

    DEFF Research Database (Denmark)

    Gontard, Lionel C.; Fernández, Asunción; Dunin-Borkowski, Rafal E.

    2014-01-01

    of the organic molecular components remains largely unknown. Here, we apply TEM to the physico-chemical characterization of Au nanoparticles that are coated with plasma-polymerized-allylamine, an organic compound with the formula C3H5NH2. We discuss the use of energy-filtered TEM in the low-energy-loss range......Hybrid (organic shell-inorganic core) nanoparticles have important applications in nanomedicine. Although the inorganic components of hybrid nanoparticles can be characterized readily using conventional transmission electron microscopy (TEM) techniques, the structural and chemical arrangement...

  1. Green synthesis of protein capped silver nanoparticles from phytopathogenic fungus Macrophomina phaseolina (Tassi) Goid with antimicrobial properties against multidrug-resistant bacteria

    Science.gov (United States)

    Chowdhury, Supriyo; Basu, Arpita; Kundu, Surekha

    2014-07-01

    In recent years, green synthesis of nanoparticles, i.e., synthesizing nanoparticles using biological sources like bacteria, algae, fungus, or plant extracts have attracted much attention due to its environment-friendly and economic aspects. The present study demonstrates an eco-friendly and low-cost method of biosynthesis of silver nanoparticles using cell-free filtrate of phytopathogenic fungus Macrophomina phaseolina. UV-visible spectrum showed a peak at 450 nm corresponding to the plasmon absorbance of silver nanoparticles. Scanning electron microscopy (SEM), atomic force microscopy (AFM), and transmission electron microscopy (TEM) revealed the presence of spherical silver nanoparticles of the size range 5 to 40 nm, most of these being 16 to 20 nm in diameter. X-ray diffraction (XRD) spectrum of the nanoparticles exhibited 2 θ values corresponding to silver nanoparticles. These nanoparticles were found to be naturally protein coated. SDS-PAGE analysis showed the presence of an 85-kDa protein band responsible for capping and stabilization of the silver nanoparticles. Antimicrobial activities of the silver nanoparticles against human as well as plant pathogenic multidrug-resistant bacteria were assayed. The particles showed inhibitory effect on the growth kinetics of human and plant bacteria. Furthermore, the genotoxic potential of the silver nanoparticles with increasing concentrations was evaluated by DNA fragmentation studies using plasmid DNA.

  2. The role of aqueous leaf extract of Tinospora crispa as reducing and capping agents for synthesis of gold nanoparticles

    Science.gov (United States)

    Apriandanu, D. O. B.; Yulizar, Y.

    2017-04-01

    Environmentally friendly method for green synthesis of Au nanoparticles (AuNP) using aqueous leaf extract of Tinospora crispa (TLE) was reported. TLE has the ability for reducing and capping AuNP. Identification of active compounds in aqueous leaf extract was obtained by phytochemical analysis and Fourier transform infrared spectroscopy (FTIR). The AuNP-TLE growth was characterized using UV-Vis spectrophotometer. The particle size and the distribution of AuNP were confirmed by particle size analyzer (PSA). AuNP-TLE formation was optimized by varying the extract concentration and time of the synthesis process. UV-Vis absorption spectrum of optimum AuNP formation displayed by the surface plasmon resonance at maximum wavelength of λmax 536 nm. The PSA result showed that AuNP has size distribution of 80.60 nm and stable up to 21 days. TEM images showed that the size of the AuNP is ± 25 nm.

  3. Revisiting magnetism of capped Au and ZnO nanoparticles: Surface band structure and atomic orbital with giant magnetic moment

    Energy Technology Data Exchange (ETDEWEB)

    Hernando, Antonio; Crespo, Patricia [Instituto de Magnetismo Aplicado, UCM-CSIC-ADIF, Las Rozas. P.O. Box 155, 28230 Madrid (Spain); Dept. Fisica de Materiales, Universidad Complutense, Madrid (Spain); Garcia, Miguel Angel [Instituto de Ceramica y Vidrio, CSIC, C/ Kelsen, 5, Madrid 28049 (Spain); Coey, Michael [Trinity College Dublin, Dublin (Ireland); Ayuela, Andres; Echenique, Pedro Miguel [Centro de Fisica de Materiales, CFM-MPC CSIC-UPV/EHU, Donostia International Physics Center (DIPC), 20018 San Sebastian (Spain); Departamento de Fisica de Materiales, Fac. de Quimicas, Universidad del Pais Vasco UPV-EHU, 20018 San Sebastian (Spain)

    2011-10-15

    In this article we review the exotic magnetism of nanoparticles (NPs) formed by substances that are not magnetic in bulk as described with generality in Section 1. In particular, the intrinsic character of the magnetism observed on capped Au and ZnO NPs is analysed. X-ray magnetic circular dichroism (XMCD) analysis has shown that the magnetic moments are intrinsic and lie in the Au and Zn atoms, respectively, as analysed in Section 2, where the general theoretical ideas are also revisited. Since impurity atoms bonded to the surface act as donor or acceptor of electrons that occupy the surface states, the anomalous magnetic response is analysed in terms of the surface band in Section 3. Finally, Section 4 summarizes our last theoretical proposal. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Effects of size and ligand density on the chirality transfer from chiral-ligand-capped nanoparticles to nematic liquid crystals

    Science.gov (United States)

    Mori, Taizo; Sharma, Anshul; Nemati, Ahlam; Bergquist, Leah; Hegmann, Torsten

    2017-08-01

    Studies of chiroptical effects of chiral ligand-capped gold nanoparticles (Au NPs) are a fascinating and rapidly evolving field in nanomaterial research with promising applications of such chiral metal NPs in catalysis and metamaterials as well as chiral sensing and separation. The aim of our studies was to seek out a system that not only allows the detection and understanding of Au NP chirality but also permits visualization and ranking — considering size, shape and nature as well as density of the ligand shell — of the extent of chirality transfer to a surrounding medium. Nematic liquid crystal (N-LC) phases are an ideal platform to examine these effects, exhibiting characteristic defect textures upon doping with a chiral additive. To test this, we synthesized series of Au NPs capped with two structurally different chiral ligands and studied well-dispersed mixtures in two nematic liquid crystal hosts. Induced circular dichroism (ICD) spectropolarimetry and polarized light optical microscopy (POM) confirmed that all Au NPs induce chiral nematic (N*-LC) phases, and measurements of the helical pitch as well as calculation of the helical twisting power (HTP) in various cell geometries allowed for an insightful ranking of the efficiency of chirality transfer of all Au NPs as well as their free ligands.

  5. CERN Document Server (CDS): Introduction

    CERN Document Server

    CERN. Geneva; Costa, Flavio

    2017-01-01

    A short online tutorial introducing the CERN Document Server (CDS). Basic functionality description, the notion of Revisions and the CDS test environment. Links: CDS Production environment CDS Test environment  

  6. A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

    Energy Technology Data Exchange (ETDEWEB)

    Padmaja, S. [Thin film centre, PSG College of Technology, Coimbatore (India); Jayakumar, S., E-mail: s_jayakumar_99@yahoo.com [Department of Physics, PSG Institute of Technology and Applied Research, Coimbatore (India); Balaji, R.; Vaideki, K. [Thin film centre, PSG College of Technology, Coimbatore (India)

    2016-08-15

    Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

  7. Thiol-Capped Gold Nanoparticles Swell-Encapsulated into Polyurethane as Powerful Antibacterial Surfaces Under Dark and Light Conditions

    Science.gov (United States)

    MacDonald, Thomas J.; Wu, Ke; Sehmi, Sandeep K.; Noimark, Sacha; Peveler, William J.; Du Toit, Hendrik; Voelcker, Nicolas H.; Allan, Elaine; MacRobert, Alexander J.; Gavriilidis, Asterios; Parkin, Ivan P.

    2016-12-01

    A simple procedure to develop antibacterial surfaces using thiol-capped gold nanoparticles (AuNPs) is shown, which effectively kill bacteria under dark and light conditions. The effect of AuNP size and concentration on photo-activated antibacterial surfaces is reported and we show significant size effects, as well as bactericidal activity with crystal violet (CV) coated polyurethane. These materials have been proven to be powerful antibacterial surfaces against both Gram-positive and Gram-negative bacteria. AuNPs of 2, 3 or 5 nm diameter were swell-encapsulated into PU before a coating of CV was applied (known as PU-AuNPs-CV). The antibacterial activity of PU-AuNPs-CV samples was tested against Staphylococcus aureus and Escherichia coli as representative Gram-positive and Gram-negative bacteria under dark and light conditions. All light conditions in this study simulated a typical white-light hospital environment. This work demonstrates that the antibacterial activity of PU-AuNPs-CV samples and the synergistic enhancement of photoactivity of triarylmethane type dyes is highly dependent on nanoparticle size and concentration. The most powerful PU-AuNPs-CV antibacterial surfaces were achieved using 1.0 mg mL-1 swell encapsulation concentrations of 2 nm AuNPs. After two hours, Gram-positive and Gram-negative bacteria were reduced to below the detection limit (>4 log) under dark and light conditions.

  8. CdS Nanoparticle-Modified α-Fe2O3/TiO2 Nanorod Array Photoanode for Efficient Photoelectrochemical Water Oxidation.

    Science.gov (United States)

    Yin, Ruiyang; Liu, Mingyang; Tang, Rui; Yin, Longwei

    2017-09-02

    In this work, we demonstrate a facile successive ionic layer adsorption and reaction process accompanied by hydrothermal method to synthesize CdS nanoparticle-modified α-Fe2O3/TiO2 nanorod array for efficient photoelectrochemical (PEC) water oxidation. By integrating CdS/α-Fe2O3/TiO2 ternary system, light absorption ability of the photoanode can be effectively improved with an obviously broadened optical-response to visible light region, greatly facilitates the separation of photogenerated carriers, giving rise to the enhancement of PEC water oxidation performance. Importantly, for the designed abnormal type-II heterostructure between Fe2O3/TiO2, the conduction band position of Fe2O3 is higher than that of TiO2, the photogenerated electrons from Fe2O3 will rapidly recombine with the photogenerated holes from TiO2, thus leads to an efficient separation of photogenerated electrons from Fe2O3/holes from TiO2 at the Fe2O3/TiO2 interface, greatly improving the separation efficiency of photogenerated holes within Fe2O3 and enhances the photogenerated electron injection efficiency in TiO2. Working as the photoanodes of PEC water oxidation, CdS/α-Fe2O3/TiO2 heterostucture electrode exhibits improved photocurrent density of 0.62 mA cm- 2 at 1.23 V vs. reversible hydrogen electrode (RHE) in alkaline electrolyte, with an obviously negatively shifted onset potential of 80 mV. This work provides promising methods to enhance the PEC water oxidation performance of the TiO2-based heterostructure photoanodes.

  9. Permanent magnetism in phosphine- and chlorine-capped gold: from clusters to nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Munoz-Marquez, Miguel A., E-mail: miguel.angel@icmse.csic.es; Guerrero, Estefania; Fernandez, Asuncion [Instituto de Ciencia de Materiales de Sevilla (CSIC-US) (Spain); Crespo, Patricia; Hernando, Antonio [Instituto de Magnetismo Aplicado (UCM-ADIF-CSIC) (Spain); Lucena, Raquel; Conesa, Jose C. [Instituto de Catalisis y Petroleoquimica (CSIC) (Spain)

    2010-05-15

    Magnetometry results have shown that gold NPs ({approx}2 nm in size) protected with phosphine and chlorine ligands exhibit permanent magnetism. When the NPs size decreases down to the subnanometric size range, e.g. undecagold atom clusters, the permanent magnetism disappears. The near edge structure of the X-ray absorption spectroscopy data points out that charge transfer between gold and the capping system occurs in both cases. These results strongly suggest that nearly metallic Au bonds are also required for the induction of a magnetic response. Electron paramagnetic resonance observations indicate that the contribution to magnetism from eventual iron impurities can be disregarded.

  10. Effect of poly-α, γ, L-glutamic acid as a capping agent on morphology and oxidative stress-dependent toxicity of silver nanoparticles

    Science.gov (United States)

    Stevanović, Magdalena; Kovačević, Branimir; Petković, Jana; Filipič, Metka; Uskoković, Dragan

    2011-01-01

    Highly stable dispersions of nanosized silver particles were synthesized using a straightforward, cost-effective, and ecofriendly method. Nontoxic glucose was utilized as a reducing agent and poly-α, γ, L-glutamic acid (PGA), a naturally occurring anionic polymer, was used as a capping agent to protect the silver nanoparticles from agglomeration and render them biocompatible. Use of ammonia during synthesis was avoided. Our study clearly demonstrates how the concentration of the capping agent plays a major role in determining the dimensions, morphology, and stability, as well as toxicity of a silver colloidal solution. Hence, proper optimization is necessary to develop silver colloids of narrow size distribution. The samples were characterized by Fourier transform infrared spectroscopy, ultraviolet-visible spectroscopy, field-emission scanning electron microscopy, transmission electron microscopy, and zeta potential measurement. MTT assay results indicated good biocompatibility of the PGA-capped silver nanoparticles. Formation of intracellular reactive oxygen species was measured spectrophotometrically using 2,7-dichlorofluorescein diacetate as a fluorescent probe, and it was shown that the PGA-capped silver nanoparticles did not induce intracellular formation of reactive oxygen species. PMID:22131829

  11. Protein corona over silver nanoparticles triggers conformational change of proteins and drop in bactericidal potential of nanoparticles: Polyethylene glycol capping as preventive strategy.

    Science.gov (United States)

    Ban, Deependra Kumar; Paul, Subhankar

    2016-10-01

    Here, we demonstrated that starch-capped silver nanoparticles (AgNPST) with a size range of 10-15nm could readily interact with a small protein bovine α-lactalbumin (BLA) through the formation of protein corona. We further observed that such phenomena not only caused structural change of BLA but drastic drop in the bactericidal potential of AgNP. To design a strategy towards minimizing protein adsorption and maximizing the retention of bactericidal potential of AgNP, we developed stable polyethylene glycol (PEG)-capped AgNP (AgNPPEG) that clearly demonstrated reduced conformational changes of protein and retention of substantial bactericidal potential of AgNPPEG, compared to AgNPST. Moreover, AgNPPEG also showed excellent hemocompatibility. A relatively larger protein bovine serum albumin (BSA) and human blood serum solution containing serum proteins were also used in this study to validate our hypotheses. Overall, our study established that protein coated AgNP losses its inherent bactericidal potential substantially; however, when functionalized with a suitable material such as PEG, it could reduce such drop in substantial amount. Moreover, it achieved improved biocompatibility in actual physiological condition that might find a better therapeutic avenue in many bacteria-mediated disorders. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. The Synthesis of Alginate-Capped Silver Nanoparticles under Microwave Irradiation

    Directory of Open Access Journals (Sweden)

    Foliatini

    2015-03-01

    Full Text Available Synthesis of silver nanoparticles (Ag-NP was successfully performed within a few minutes by microwave irradiation of the precursor salt (AgNO3 and alginate mixed solution in one pot. Herein, alginate molecules acted as both a reducing and stabilizing agent for the preparation of the silver nanoparticles. The obtained nanoparticles were characterized by ultraviolet-visible (UV-Vis spectroscopy, particle size analysis (PSA, Fourier transform infrared spectroscopy (FTIR, and transmission electron microscopy (TEM. The pH and concentration ratio of the alginate/metal precursor salt greatly influenced the particle size and its distribution of Ag-NP. The higher the pH the higher the nucleation rate and the larger the electrostatic stabilization, while both of them were responsible for producing a smaller particle size and a narrower size distribution. A higher concentration ratio also yielded a smaller particle size and a narrower size distribution, but above the optimum ratio, the trend was conversely changed due to the reducing capability of the alginate, which was dominant above the optimum ratio, thus creating a high density of nuclei, allowing aggregation to occur. A lower ratio not only led to a higher tendency to produce larger particles, but also a higher probability of anisotropic particle shape formation due to the lack of reducing capability of the alginates.

  13. From oleic acid-capped iron oxide nanoparticles to polyethyleneimine-coated single-particle magnetofectins

    Energy Technology Data Exchange (ETDEWEB)

    Cruz-Acuña, Melissa [University of Florida, J. Crayton Pruitt Family Department of Biomedical Engineering (United States); Maldonado-Camargo, Lorena [University of Florida, Department of Chemical Engineering (United States); Dobson, Jon; Rinaldi, Carlos, E-mail: carlos.rinaldi@bme.ufl.edu [University of Florida, J. Crayton Pruitt Family Department of Biomedical Engineering (United States)

    2016-09-15

    Various inorganic nanoparticle designs have been developed and used as non-viral gene carriers. Magnetic gene carriers containing polyethyleneimine (PEI), a well-known transfection agent, have been shown to improve DNA transfection speed and efficiency in the presence of applied magnetic field gradients that promote particle–cell interactions. Here we report a method to prepare iron oxide nanoparticles conjugated with PEI that: preserves the narrow size distribution of the nanoparticles, conserves magnetic properties throughout the process, and results in efficient transfection. We demonstrate the ability of the particles to electrostatically bind with DNA and transfect human cervical cancer (HeLa) cells by the use of an oscillating magnet array. Their transfection efficiency is similar to that of Lipofectamine 2000™, a commercial transfection reagent. PEI-coated particles were subjected to acidification, and acidification in the presence of salts, before DNA binding. Results show that although these pre-treatments did not affect the ability of particles to bind DNA they did significantly enhanced transfection efficiency. Finally, we show that these magnetofectins (PEI-MNP/DNA) complexes have no effect on the viability of cells at the concentrations used in the study. The systematic preparation of magnetic vectors with uniform physical and magnetic properties is critical to progressing this non-viral transfection technology.

  14. The antimicrobial effects and metabolomic footprinting of carboxyl-capped bismuth nanoparticles against Helicobacter pylori.

    Science.gov (United States)

    Nazari, P; Dowlatabadi-Bazaz, R; Mofid, M R; Pourmand, M R; Daryani, N E; Faramarzi, M A; Sepehrizadeh, Z; Shahverdi, A R

    2014-01-01

    Organic salts of bismuth are currently used as antimicrobial agents against Helicobacter pylori. This study evaluated the antibacterial effect of elemental bismuth nanoparticles (Bi NPs) using a serial agar dilution method for the first time against different clinical isolates and a standard strain of H. pylori. The Bi NPs were biologically prepared and purified by a recently described method and subjected to further characterization by infrared spectroscopy and anti-H. pylori evaluation. Infrared spectroscopy results showed the presence of carboxyl functional groups on the surface of biogenic Bi NPs. These biogenic nanoparticles showed good antibacterial activity against all tested H. pylori strains. The resulting MICs varied between 60 and 100 μg/ml for clinical isolates of H. pylori and H. pylori (ATCC 26695). The antibacterial effect of bismuth ions was also tested against all test strains. The antimicrobial effect of Bi ions was lower than antimicrobial effect of bismuth in the form of elemental NPs. The effect of Bi NPs on metabolomic footprinting of H. pylori was further evaluated by (1)H NMR spectroscopy. Exposure of H. pylori to an inhibitory concentration of Bi NPs (100 μg/ml) led to release of some metabolites such as acetate, formic acid, glutamate, valine, glycine, and uracil from bacteria into their supernatant. These findings confirm that these nanoparticles interfere with Krebs cycle, nucleotide, and amino acid metabolism and shows anti-H. pylori activity.

  15. Optical properties and extinction spectroscopy to characterize the synthesis of amine capped silver nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Roldan, Maria Virginia [Laboratorio de Materiales Ceramicos, FCEIyA, IFIR, UNR, Rosario (Argentina)], E-mail: vroldan@fceia.unr.edu.ar; Scaffardi, Lucia B. [CIOp - CONICET, CIC, c.c. 124, 1900 La Plata (Argentina) and Area Departamental de Ciencias Basicas, Facultad de Ingenieria, Universidad Nacional de La Plata, La Plata (Argentina); Sanctis, Oscar de [Laboratorio de Materiales Ceramicos, FCEIyA, IFIR, UNR, Rosario (Argentina); Pellegri, Nora [Laboratorio de Materiales Ceramicos, FCEIyA, IFIR, UNR, Rosario (Argentina)], E-mail: pellegri@fceia.unr.edu.ar

    2008-12-20

    The present work describes a method for preparation of Ag nanoparticles from chemical reduction of AgNO{sub 3} in ethanol with ATS [N-[3-(trimethoxysilyl)propyl] diethylenetriamine] as surface modifier. We study the influence of different parameters such as concentration, time, temperature and reductor agents on the size and shape of the nanoparticles. We present the morphologic and structural characterization of samples by UV-vis extinction spectroscopy, Atomic Force Microscopy (AFM) and X-ray diffraction (XRD). Particularly, using optical extinction spectroscopy, the present work shows the analysis of size evolution in the fabrication process of spherical silver nanoparticles. This evolution is studied as a function of the time elapsed between the beginning of the reaction and the extraction of the sample (temporal delayed synthesis), and as a function of the temperature during the chemical reaction. In both the cases, we propose the study of the plasmon width as a useful, simple and inexpensive method for analysis of the mean radius, specially, for values below 6 nm.

  16. CuO-induced signal amplification strategy for multiplexed photoelectrochemical immunosensing using CdS sensitized ZnO nanotubes arrays as photoactive material and AuPd alloy nanoparticles as electron sink.

    Science.gov (United States)

    Sun, Guoqiang; Zhang, Yan; Kong, Qingkun; Zheng, Xiaoxiao; Yu, Jinghua; Song, Xianrang

    2015-04-15

    In this work, multiplexed photoelectrochemical (PEC) immunoassays are introduced into an indium tin oxide (ITO) device. Firstly, the ITO device is fabricated using a simple acid etch treatment method. Secondly, AuPd alloy nanoparticles are electro-deposited on ITO working electrodes as electron sink to construct the immunosensor platform. After that, ZnO nanotubes (ZNTs) arrays are synthesized via chemical etching of ZnO nanorods that are grown on AuPd surface by electrochemical deposition method. Subsequently, CdS is electro-deposited on ZNTs arrays and used as photoactive material. Then, CuO nanoseeds are labeled with signal antibodies and firstly used as PEC signal amplification label. The introduction of CuO brings signal amplification because of the conduction band (CB) of both CuO and ZnO are lower than that of CdS, CuO will compete the photo-induced electrons in CB of CdS with ZnO, leading to the decrease of the photocurrent intensity. Using cancer antigen 125, prostate specific antigen and α-fetoprotein as model analytes, the proposed immunoassay exhibits excellent precision and sensitivity. Meanwhile, this work provides a promising, addressable and simple strategy for the multi-detection of tumor markers. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Preparation and Characterization of ZnS, CdS and HgS/Poly(methyl methacrylate Nanocomposites

    Directory of Open Access Journals (Sweden)

    Johannes Z. Mbese

    2014-09-01

    Full Text Available The synthesis and characterization of ZnS/PMMA (poly(methyl methacrylate, CdS/PMMA and HgS/PMMA nanocomposites are presented. Hexadecylamine (HDA-capped ZnS, CdS and HgS nanoparticles were synthesized using dithiocarbamate single molecule precursors at 180 °C. FTIR (Fourier transform infrared spectroscopy spectra measurement confirmed the dispersion of the metal sulfide nanoparticles in the PMMA matrices to form the metal sulfides/PMMA nanocomposites. Powder X-ray diffraction confirmed the presence of the amorphous PMMA in the nanocomposites. The ZnS and HgS particles were indexed to the cubic phase, while the HgS particles correspond to the hexagonal phase. Thermogravimetric analyses showed that the metal sulfide nanocomposites are thermally more stable than their corresponding precursor complexes. The TEM (Transmission electron microscope analyses revealed that the ZnS nanoparticles have a particle size of 3–5 nm; the crystallite size of the CdS nanoparticles is 6–12 nm, and HgS nanoparticles are 6–12 nm.

  18. Chitosan and carboxymethyl-chitosan capping ligands: Effects on the nucleation and growth of hydroxyapatite nanoparticles for producing biocomposite membranes.

    Science.gov (United States)

    Dumont, Vitor C; Mansur, Alexandra A P; Carvalho, Sandhra M; Medeiros Borsagli, Fernanda G L; Pereira, Marivalda M; Mansur, Herman S

    2016-02-01

    Synthetic biomaterials based on calcium phosphates (CaP) have been widely studied for bone tissue reconstruction therapies, but no definitive solution that fulfills all of the required properties has been identified. Thus, this study reports the synthesis of composite membranes based on nanohydroxyapatite particles (nHA) embedded in chitosan (CHI) and O-carboxymethyl chitosan (CMC) matrices produced using a one-step co-precipitation method in water media. Biopolymers were used as capping ligands for simultaneously controlling the nucleation and growth of the nHA particles during the precipitation process and also to form the polymeric network of the biocomposites. The bionanocomposites were extensively characterized using light microscopy (LM), scanning and transmission electron microscopy (SEM/TEM), energy-dispersive X-ray spectroscopy (EDX), Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD), atomic force microscopy (AFM), X-ray micro-CT analysis (μCT), andMTT (3-(4,5-dimethylthiazolyl-2)-2,5-diphenyltetrazoliumbromide) cell proliferation assays for cell cytotoxicity. The results demonstrated that the ligands used during the synthesis highly affected the composites produced, primarily due the changes in the mechanisms and kinetics of nucleation and growth of the HA particles at the nanoscale level. The SEMimages revealed that the use of carboxyl-functionalized chitosan (CMC) ligands significantly reduced the average size of theHA nanoparticles and caused the formation of a narrower size distribution (90±20nm) compared to theHAnanoparticles producedwith chitosan ligands (220±50nm). The same trend was verified by the AFM analysis,where the nHA particles were formed evenly dispersed in the polymer matrix. However, the CMC-based composites were more homogeneously distributed, which was endorsed by the images collected via X-ray micro-CT. The FTIR spectra and the XRD analysis indicated that nanosized hydroxyapatite was the predominant calcium

  19. Citrate-coated silver nanoparticles interactions with effluent organic matter: influence of capping agent and solution conditions

    KAUST Repository

    Gutierrez, Leonardo

    2015-07-31

    Fate and transport studies of silver nanoparticles (AgNPs) discharged from urban wastewaters containing effluent organic matter (EfOM) into natural waters represent a key knowledge gap. In this study, EfOM interfacial interactions with AgNPs and their aggregation kinetics were investigated by atomic force microscopy (AFM) and time-resolved dynamic light scattering (TR-DLS), respectively. Two well-characterized EfOM isolates, i.e., wastewater humic (WW humic) and wastewater colloids (WW colloids, a complex mixture of polysaccharides-proteins-lipids), and a River humic isolate of different characteristics were selected. Citrate-coated AgNPs were selected as representative capped-AgNPs. Citrate-coated AgNPs showed a considerable stability in Na+ solutions. However, Ca2+ ions induced aggregation by cation bridging between carboxyl groups on citrate. Although the presence of River humic increased the stability of citrate-coated AgNPs in Na+ solutions due to electrosteric effects, they aggregated in WW humic-containing solutions, indicating the importance of humics characteristics during interactions. Ca2+ ions increased citrate-coated AgNPs aggregation rates in both humic solutions, suggesting cation bridging between carboxyl groups on their structures as a dominant interacting mechanism. Aggregation of citrate-coated AgNPs in WW colloids solutions was significantly faster than those in both humic solutions. Control experiments in urea solution indicated hydrogen bonding as the main interacting mechanism. During AFM experiments, citrate-coated AgNPs showed higher adhesion to WW humic than to River humic, evidencing a consistency between TR-DLS and AFM results. Ca2+ ions increased citrate-coated AgNPs adhesion to both humic isolates. Interestingly, strong WW colloids interactions with citrate caused AFM probe contamination (nanoparticles adsorption) even at low Na+ concentrations, indicating the impact of hydrogen bonding on adhesion. These results suggest the importance

  20. Citrate-Coated Silver Nanoparticles Interactions with Effluent Organic Matter: Influence of Capping Agent and Solution Conditions.

    Science.gov (United States)

    Gutierrez, Leonardo; Aubry, Cyril; Cornejo, Mauricio; Croue, Jean-Philippe

    2015-08-18

    Fate and transport studies of silver nanoparticles (AgNPs) discharged from urban wastewaters containing effluent organic matter (EfOM) into natural waters represent a key knowledge gap. In this study, EfOM interfacial interactions with AgNPs, and their aggregation kinetics were investigated by atomic force microscopy (AFM) and time-resolved dynamic light scattering (TR-DLS), respectively. Two well-characterized EfOM isolates, i.e., wastewater humic (WW humic) and wastewater colloids (WW colloids, a complex mixture of polysaccharides-proteins-lipids), and a River humic isolate of different characteristics were selected. Citrate-coated AgNPs were selected as representative capped-AgNPs. Citrate-coated AgNPs showed a considerable stability in Na(+) solutions. However, Ca(2+) ions induced aggregation by cation bridging between carboxyl groups on citrate. Although the presence of River humic increased the stability of citrate-coated AgNPs in Na(+) solutions due to electrosteric effects, they aggregated in WW humic-containing solutions, indicating the importance of humics characteristics during interactions. Ca(2+) ions increased citrate-coated AgNPs aggregation rates in both humic solutions, suggesting cation bridging between carboxyl groups on their structures as a dominant interacting mechanism. Aggregation of citrate-coated AgNPs in WW colloids solutions was significantly faster than those in both humic solutions. Control experiments in urea solution indicated hydrogen bonding as the main interacting mechanism. During AFM experiments, citrate-coated AgNPs showed higher adhesion to WW humic than to River humic, evidencing a consistency between TR-DLS and AFM results. Ca(2+) ions increased citrate-coated AgNPs adhesion to both humic isolates. Interestingly, strong WW colloids interactions with citrate caused AFM probe contamination (nanoparticles adsorption) even at low Na(+) concentrations, indicating the impact of hydrogen bonding on adhesion. These results suggest

  1. Folic acid-capped PEGylated magnetic nanoparticles enter cancer cells mostly via clathrin-dependent endocytosis.

    Science.gov (United States)

    Allard-Vannier, Emilie; Hervé-Aubert, Katel; Kaaki, Karine; Blondy, Thibaut; Shebanova, Anastasia; Shaitan, Konstantin V; Ignatova, Anastasia A; Saboungi, Marie-Louise; Feofanov, Alexey V; Chourpa, Igor

    2017-06-01

    This work is focused on mechanisms of uptake in cancer cells of rationally designed, covalently assembled nanoparticles, made of superparamagnetic iron oxide nanoparticles (SPIONs), fluorophores (doxorubicin or Nile Blue), polyethylene glycol (PEG) and folic acid (FA), referred hereinafter as SFP-FA. SFP-FA were characterized by DLS, zetametry and fluorescence spectroscopy. The SFP-FA uptake in cancer cells was monitored using fluorescence-based methods like fluorescence-assisted cell sorting, CLSM with single-photon and two-photon excitation. The SFP-FA endocytosis was also analyzed with electron microscopy approaches: TEM, HAADF-STEM and EELS. The SFP-FA have zeta potential below -6mW and stable hydrodynamic diameter close to 100nm in aqueous suspensions of pH range from 5 to 8. They contain ca. 109 PEG-FA, 480 PEG-OCH 3 and 22-27 fluorophore molecules per SPION. The fluorophores protected under the PEG shell allows a reliable detection of intracellular NPs. SFP-FA readily enter into all the cancer cell lines studied and accumulate in lysosomes, mostly via clathrin-dependent endocytosis, whatever the FR status on the cells. The present study highlights the advantages of rational design of nanosystems as well as the possible involvement of direct molecular interactions of PEG and FA with cellular membranes, not limited to FA-FR recognition, in the mechanisms of their endocytosis. Composition, magnetic and optical properties of the SFP-FA as well their ability to enter cancer cells are promising for their applications in cancer theranosis. Combination of complementary analytical approaches is relevant to understand the nanoparticles behavior in suspension and in contact with cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Chitosan and carboxymethyl-chitosan capping ligands: Effects on the nucleation and growth of hydroxyapatite nanoparticles for producing biocomposite membranes

    Energy Technology Data Exchange (ETDEWEB)

    Dumont, Vitor C.; Mansur, Alexandra A.P.; Carvalho, Sandhra M.; Medeiros Borsagli, Fernanda G.L.; Pereira, Marivalda M.; Mansur, Herman S., E-mail: hmansur@demet.ufmg.br

    2016-02-01

    Synthetic biomaterials based on calcium phosphates (CaP) have been widely studied for bone tissue reconstruction therapies, but no definitive solution that fulfills all of the required properties has been identified. Thus, this study reports the synthesis of composite membranes based on nanohydroxyapatite particles (nHA) embedded in chitosan (CHI) and O-carboxymethyl chitosan (CMC) matrices produced using a one-step co-precipitation method in water media. Biopolymers were used as capping ligands for simultaneously controlling the nucleation and growth of the nHA particles during the precipitation process and also to form the polymeric network of the biocomposites. The bionanocomposites were extensively characterized using light microscopy (LM), scanning and transmission electron microscopy (SEM/TEM), energy-dispersive X-ray spectroscopy (EDX), Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD), atomic force microscopy (AFM), X-ray micro-CT analysis (μCT), and MTT (3-(4,5-dimethylthiazolyl-2)-2,5-diphenyltetrazolium bromide) cell proliferation assays for cell cytotoxicity. The results demonstrated that the ligands used during the synthesis highly affected the composites produced, primarily due the changes in the mechanisms and kinetics of nucleation and growth of the HA particles at the nanoscale level. The SEM images revealed that the use of carboxyl-functionalized chitosan (CMC) ligands significantly reduced the average size of the HA nanoparticles and caused the formation of a narrower size distribution (90 ± 20 nm) compared to the HA nanoparticles produced with chitosan ligands (220 ± 50 nm). The same trend was verified by the AFM analysis, where the nHA particles were formed evenly dispersed in the polymer matrix. However, the CMC-based composites were more homogeneously distributed, which was endorsed by the images collected via X-ray micro-CT. The FTIR spectra and the XRD analysis indicated that nanosized hydroxyapatite was the

  3. Toxicity of Citrate-Capped Silver Nanoparticles in Common Carp (Cyprinus carpio

    Directory of Open Access Journals (Sweden)

    Byoungcheun Lee

    2012-01-01

    Full Text Available Juvenile common carp (Cyprinus carpio were used as a model to investigate acute toxicity and oxidative stress caused by silver nanoparticles (Ag-NPs. The fish were exposed to different concentrations of Ag-NPs for 48 h and 96 h. After exposure, antioxidant enzyme levels were measured, including glutathione-S-transferase (GST, superoxidase dismutase, and catalase (CAT. Other biochemical parameters and histological abnormalities in different tissues (i.e., the liver, gills, and brain were also examined. The results showed that Ag-NPs agglomerated in freshwater used during the exposure experiments, with particle size remaining <100 nm. Ag-NPs had no lethal effect on fish after 4 days of exposure. Biochemical analysis showed that enzymatic activities in the brain of the fish exposed to 200 g/L of Ag-NPs were significantly reduced. Varied antioxidant enzyme activity was recorded in the liver and gills. Varied antioxidant enzyme activity was recorded for CAT in the liver and GST in the gills of the fish. However, the recovery rate of fish exposed to 200 g/L of Ag-NPs was slower than when lower particle concentrations were used. Other biochemical indices showed no significant difference, except for NH3 and blood urea nitrogen concentrations in fish exposed to 50 g/L of Ag-NPs. This study provides new evidence about the effects of nanoparticles on aquatic organisms.

  4. Toxicity of Citrate-Capped Silver Nanoparticles in Common Carp (Cyprinus carpio)

    Science.gov (United States)

    Lee, Byoungcheun; Duong, Cuong Ngoc; Cho, Jaegu; Lee, Jaewoo; Kim, Kyungtae; Seo, Youngrok; Kim, Pilje; Choi, Kyunghee; Yoon, Junheon

    2012-01-01

    Juvenile common carp (Cyprinus carpio) were used as a model to investigate acute toxicity and oxidative stress caused by silver nanoparticles (Ag-NPs). The fish were exposed to different concentrations of Ag-NPs for 48 h and 96 h. After exposure, antioxidant enzyme levels were measured, including glutathione-S-transferase (GST), superoxidase dismutase, and catalase (CAT). Other biochemical parameters and histological abnormalities in different tissues (i.e., the liver, gills, and brain) were also examined. The results showed that Ag-NPs agglomerated in freshwater used during the exposure experiments, with particle size remaining <100 nm. Ag-NPs had no lethal effect on fish after 4 days of exposure. Biochemical analysis showed that enzymatic activities in the brain of the fish exposed to 200 μg/L of Ag-NPs were significantly reduced. Varied antioxidant enzyme activity was recorded in the liver and gills. Varied antioxidant enzyme activity was recorded for CAT in the liver and GST in the gills of the fish. However, the recovery rate of fish exposed to 200 μg/L of Ag-NPs was slower than when lower particle concentrations were used. Other biochemical indices showed no significant difference, except for NH3 and blood urea nitrogen concentrations in fish exposed to 50 μg/L of Ag-NPs. This study provides new evidence about the effects of nanoparticles on aquatic organisms. PMID:23093839

  5. Cervical Cap

    Science.gov (United States)

    ... Sport for You Healthy School Lunch Planner Cervical Cap KidsHealth > For Teens > Cervical Cap Print A A ... and a female's egg. How Does a Cervical Cap Work? The cervical cap keeps sperm from entering ...

  6. Charge Transfer at Hybrid Interfaces: Plasmonics of Aromatic Thiol-Capped Gold Nanoparticles.

    Science.gov (United States)

    Goldmann, Claire; Lazzari, Rémi; Paquez, Xavier; Boissière, Cédric; Ribot, François; Sanchez, Clément; Chanéac, Corinne; Portehault, David

    2015-07-28

    Although gold nanoparticles stabilized by organic thiols are the building blocks in a wide range of applications, the role of the ligands on the plasmon resonance of the metal core has been mostly ignored until now. Herein, a methodology based on the combination of spectroscopic ellipsometry and UV-vis spectroscopy is applied to extract dielectric functions of the different components. It is shown that aromatic thiols allow a significant charge transfer at the hybrid interface with the s and d bands of the gold core that yields "giant" red shifts of the plasmon band, up to 40 nm for spherical particles in the size range of 3-5 nm. These results suggest that hybrid nanoplasmonic devices may be designed through the suitable choice of metal core and organic components for optimized charge exchange.

  7. Biocidal activity of plasma modified electrospun polysulfone mats functionalized with polyethyleneimine-capped silver nanoparticles.

    Science.gov (United States)

    Schiffman, Jessica D; Wang, Yue; Giannelis, Emmanuel P; Elimelech, Menachem

    2011-11-01

    The incorporation of silver nanoparticles (AgNPs) into polymeric nanofibers has attracted a great deal of attention due to the strong antimicrobial activity that the resulting fibers exhibit. However, bactericidal efficacy of AgNP-coated electrospun fibrous mats has not yet been demonstrated. In this study, polysulfone (PSf) fibers were electrospun and surface-modified using an oxygen plasma treatment, which allowed for facile irreversible deposition of cationically charged polyethyleneimine (PEI)-AgNPs via electrostatic interactions. The PSf-AgNP mats were characterized for relative silver concentration as a function of plasma treatment time using ICP-MS and changes in contact angle. Plasma treatment of 60 s was the shortest time required for maximum loss of bacteria (Escherichia coli) viability. Time-dependent bacterial cytotoxicity studies indicate that the optimized PSf-AgNP mats exhibit a high level of inactivation against both gram negative bacteria, Escherichia coli, and gram positive bacteria, Bacillus anthracis and Staphylococcus aureus.

  8. Improving SERS Detection of Bacillus thuringiensis Using Silver Nanoparticles Reduced with Hydroxylamine and with Citrate Capped Borohydride

    Directory of Open Access Journals (Sweden)

    Hilsamar Félix-Rivera

    2011-01-01

    Full Text Available The development of techniques that could be useful in fields other than biological warfare agents countermeasures such as medical diagnostics, industrial microbiology, and environmental applications have become a very important subject of research. Raman spectroscopy can be used in near field or at long distances from the sample to obtain fingerprinting information of chemical composition of microorganisms. In this research, biochemical components of the cell wall and endospores of Bacillus thuringiensis (Bt were identified by surface-enhanced Raman scattering (SERS spectroscopy using silver (Ag nanoparticles (NPs reduced by hydroxylamine and borohydride capped with sodium citrate. Activation of “hot spots”, aggregation and surface charge modification of the NPs, was studied and optimized to obtain signal enhancements from Bt by SERS. Slight aggregation of the NPs as well as surface charge modification to a more acidic ambient was induced using small-size borohydride-reduced NPs in the form of metallic suspensions aimed at increasing the Ag NP-Bt interactions. Hydroxylamine-reduced NPs required slight aggregation and no pH modifications in order to obtain high spectral quality results in bringing out SERS signatures of Bt.

  9. Harnessing Photovoltage: Effects of Film Thickness, TiO2 Nanoparticle Size, MgO and Surface Capping with DSCs.

    Science.gov (United States)

    Cheema, Hammad; Delcamp, Jared H

    2017-01-25

    High photovoltage dye-sensitized solar cells (DSCs) offer an exceptional opportunity to power electrocatalysts for the production of hydrogen from water and the reduction of CO2 to usable fuels with a relatively cost-effective, low-toxicity solar cell. Competitive recombination pathways such as electron transfer from TiO2 films to the redox shuttle or oxidized dye must be minimized to achieve the maximum possible photovoltage (Voc) from DSC devices. A high Voc of 882 mV was achieved with the iodide/triiodide redox shuttle and a ruthenium NCS-ligated dye, HD-2-mono, by utilizing a combined approach of (1) modulating the TiO2 surface area through film thickness and nanoparticle size selection, (2) addition of a MgO insulating layer, and (3) capping available TiO2 film surface sites post film sensitization with an F-SAM (fluorinated self-assembled monolayer) treatment. The exceptional Voc of 882 mV observed is the highest achieved for the popular NCS containing ruthenium sensitizers with >5% PCE and compares favorably to the 769 mV value observed under common device preparation conditions.

  10. Biocidal Activity of Plasma Modified Electrospun Polysulfone Mats Functionalized with Polyethyleneimine-Capped Silver Nanoparticles

    KAUST Repository

    Schiffman, Jessica D.

    2011-11-01

    The incorporation of silver nanoparticles (AgNPs) into polymeric nanofibers has attracted a great deal of attention due to the strong antimicrobial activity that the resulting fibers exhibit. However, bactericidal efficacy of AgNP-coated electrospun fibrous mats has not yet been demonstrated. In this study, polysulfone (PSf) fibers were electrospun and surface-modified using an oxygen plasma treatment, which allowed for facile irreversible deposition of cationically charged polyethyleneimine (PEI)-AgNPs via electrostatic interactions. The PSf-AgNP mats were characterized for relative silver concentration as a function of plasma treatment time using ICP-MS and changes in contact angle. Plasma treatment of 60 s was the shortest time required for maximum loss of bacteria (Escherichia coli) viability. Time-dependent bacterial cytotoxicity studies indicate that the optimized PSf-AgNP mats exhibit a high level of inactivation against both Gram negative bacteria, Escherichia coli, and Gram positive bacteria, Bacillus anthracis and Staphylococcus aureus. © 2011 American Chemical Society.

  11. Antibacterial activity of biochemically capped iron oxide nanoparticles: A view towards green chemistry.

    Science.gov (United States)

    Irshad, Rabia; Tahir, Kamran; Li, Baoshan; Ahmad, Aftab; R Siddiqui, Azka; Nazir, Sadia

    2017-05-01

    A green approach to fabricate nanoparticles has been evolved as a revolutionary discipline. Eco-compatible reaction set ups, use of non-toxic materials and production of highly active biological and photocatalytic products are few benefits of this greener approach. Here, we introduce a green method to synthesize Fe oxide NPs using Punica granatum peel extract. The formation of Fe oxide NPs was optimized using different concentrations of peel extract (20mL, 40mL and 60mL) to achieve small size and better morphology. The results indicate that the FeNPs, obtained using 40mL concentration of peel extract possess the smallest size. The morphology, size and crystallinity of NPs was confirmed by implementing various techniques i.e. UV-Vis spectroscopy, X-ray diffraction, Scanning Electron Microscopy and Electron Diffraction Spectroscopy. The bio-chemicals responsible for reduction and stabilization of FeNPs were confirmed by FT-IR analysis. The biogenic FeNPs were tested for their size dependent antibacterial activity. The biogenic FeNPs prepared in 40mL extract concentrations exhibited strongest antibacterial activity against Pseudomonas aeruginosa i.e. 22 (±0.5) mm than FeNPs with 20mL and 60mL extract concentrations i.e. 18 (±0.4) mm and 14 (±0.3) mm respectively. The optimized FeNPs with 40mL peel extract are not only highly active for ROS generation but also show no hemolytic activity. Thus, FeNPs synthesized using the greener approach are found to have high antibacterial activity along with biocompatibility. This high antibacterial activity can be referred to small size and large surface area. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Fungus-mediated preferential bioleaching of waste material such as fly - ash as a means of producing extracellular, protein capped, fluorescent and water soluble silica nanoparticles.

    Directory of Open Access Journals (Sweden)

    Shadab Ali Khan

    Full Text Available In this paper, we for the first time show the ability of the mesophilic fungus Fusarium oxysporum in the bioleaching of waste material such as Fly-ash for the extracellular production of highly crystalline and highly stable, protein capped, fluorescent and water soluble silica nanoparticles at ambient conditions. When the fungus Fusarium oxysporum is exposed to Fly-ash, it is capable of selectively leaching out silica nanoparticles of quasi-spherical morphology within 24 h of reaction. These silica nanoparticles have been completely characterized by UV-vis spectroscopy, Photoluminescence (PL, Transmission electron microscopy (TEM, X-ray diffraction (XRD, Fourier transform infrared spectroscopy (FTIR and Energy dispersive analysis of X-rays (EDAX.

  13. The bipyridine adducts of N-phenyldithiocarbamato complexes of Zn(II) and Cd(II); synthesis, spectral, thermal decomposition studies and use as precursors for ZnS and CdS nanoparticles.

    Science.gov (United States)

    Onwudiwe, Damian C; Strydom, Christien A

    2015-01-25

    Bipyridine adducts of N-phenyldithiocarbamato complexes, [ML(1)2L(2)] (M=Cd(II), Zn(II); L(1)=N-phenyldithiocarbamate, L(2)=2,2' bipyridine), have been synthesized and characterised. The decomposition of these complexes to metal sulphides has been investigated by thermogravimetric analysis (TGA). The complexes were used as single-source precursors to synthesize MS (M=Zn, Cd) nanoparticles (NPs) passivated by hexadecyl amine (HDA). The growth of the nanoparticles was carried out at two different temperatures: 180 and 220 °C, and the optical and structural properties of the nanoparticles were studied using UV-Vis spectroscopy, photoluminescence spectroscopy (PL), transmission emission microscopy (TEM) and powdered X-ray diffraction (p-XRD). Nanoparticles, whose average diameters are 2.90 and 3.54 nm for ZnS, and 8.96 and 9.76 nm for CdS grown at 180 and 220 °C respectively, were obtained. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Engineered Inorganic/Organic-Core/Shell Magnetic FexOy Nanoparticles with Oleic Acid and/or Oleylamine As Capping Agents.

    Science.gov (United States)

    Harris, Richard Anthony; van der Walt, Hendriëtte; Shumbula, Poslet Morgan

    2015-01-01

    Magnetic nanoparticles with tailored surface chemistry are widely used for a number of different in vivo applications, ranging from tissue repair and magnetic cell separation through to cancer-hyperthermia, drug delivery and magnetic resonance imaging contrast enhancement. A major requirement for all these biomedical applications is that these nanoparticles must have high magnetization values and sizes smaller than 100 nm with a narrow particle size distribution. Thus nanoparticles must have uniform physical and chemical properties. For these applications, a tailored surface coating/shell needs to be engineered, which has to be non-toxic, biocompatible and make allowance for targetable drug delivery with particle localization in a targeted area. Most work in this field has been done on improving the biocompatibility of the nanoparticles. Only a few scientific investigations have been carried out on improving the quality of magnetic nanoparticles with specific focus on the nanoparticle's surface chemistry, size distribution and shape (which directly influences the magnetic properties). All these particles also need to be properly characterized in order to get a protocol for the quality control of these particles, the nature of the surface coatings and their subsequent geometric arrangement. This will ultimately determine the overall size of the colloids and also plays a significant role in biokinetics and biodistribution of nanoparticles in the body. This review highlights recent advances in the synthetic chemistry, magnetic characterization and biological applications of inorganic/organic - core/shell FexOy based magnetic nanoparticles with specific focus on using the two popular surfactants for producing MNPs namely oleic acid and/or oleylamine as capping agents. Although the main nano-magnets under discussion are magnetite (Fe3O4) nanoparticles, maghemite (γ-Fe2O3) is also briefly mentioned.

  15. Electrostatic-assembly-driven formation of micrometer-scale supramolecular sheets of (3-aminopropyl)triethoxysilane(APTES)-HAuCl4 and their subsequent transformation into stable APTES bilayer-capped gold nanoparticles through a thermal process.

    Science.gov (United States)

    Sun, Xuping; Wei, Wentao

    2010-05-04

    In this letter, we demonstrate for the first time the electrostatically driven assembly of (3-aminopropyl)triethoxysilane (APTES) and HAuCl(4) in aqueous media into novel micrometer-scale supramolecular sheets and their subsequent transformation into small, stable APTES bilayer-capped gold nanoparticles through a thermal process. The nanoparticle formation mechanism is also discussed.

  16. Synergistic influence of polyoxometalate surface corona towards enhancing the antibacterial performance of tyrosine-capped Ag nanoparticles

    Science.gov (United States)

    Daima, Hemant K.; Selvakannan, P. R.; Kandjani, Ahmad E.; Shukla, Ravi; Bhargava, Suresh K.; Bansal, Vipul

    2013-12-01

    We illustrate a new strategy to improve the antibacterial potential of silver nanoparticles (AgNPs) by their surface modification with the surface corona of biologically active polyoxometalates (POMs). The stable POM surface corona was achieved by utilising zwitterionic tyrosine amino acid as a pH-switchable reducing and capping agent of AgNPs. The general applicability of this approach was demonstrated by developing surface coronas of phosphotungstic acid (PTA) and phosphomolybdic acid (PMA) around AgNPs. Our investigations on Gram negative bacterium Escherichia coli demonstrate that in conjugation with AgNPs, the surface corona of POMs enhances the physical damage to the bacterial cells due to synergistic antibacterial action of AgNPs and POMs, and the ability of tyrosine-reduced AgNPs (AgNPsY) to act as an excellent carrier and stabiliser for the POMs. The further extension of this study towards Gram positive bacterium Staphylococcus albus showed a similar toxicity pattern, whereas these nanomaterials were found to be biocompatible for PC3 epithelial mammalian cells, suggesting the potential of these materials towards specific antimicrobial targeting for topical wound healing applications. The outcomes of this work show that facile tailorability of nanostructured surfaces may play a considerable role in controlling the biological activities of different nanomaterials.We illustrate a new strategy to improve the antibacterial potential of silver nanoparticles (AgNPs) by their surface modification with the surface corona of biologically active polyoxometalates (POMs). The stable POM surface corona was achieved by utilising zwitterionic tyrosine amino acid as a pH-switchable reducing and capping agent of AgNPs. The general applicability of this approach was demonstrated by developing surface coronas of phosphotungstic acid (PTA) and phosphomolybdic acid (PMA) around AgNPs. Our investigations on Gram negative bacterium Escherichia coli demonstrate that in conjugation

  17. Colorimetric assay of heparin in plasma based on the inhibition of oxidase-like activity of citrate-capped platinum nanoparticles.

    Science.gov (United States)

    You, Jyun-Guo; Liu, Yao-Wen; Lu, Chi-Yu; Tseng, Wei-Lung; Yu, Cheng-Ju

    2017-06-15

    We report citrate-capped platinum nanoparticles (Pt NPs) as oxidase mimetics for effectively catalyzing the oxidation of 3,3',5,5'-tetramethylbenzidine (TMB), 2,2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid), dopamine, and methylene blue in the presence of O2. To confirm oxidase-like activity of citrate-capped Pt NPs, their activity toward oxygen reduction reaction was studied using cyclic voltammetry and rotating ring-disk electrode method. The results obtained showed that Pt NP NPs can catalyze the oxidation of organic substrates to the colored product and the reduction of oxygen to water through a four-electron exchange process. Because the aggregation of Pt NPs can inhibit their oxidase-like activity and protamine can recognize heparin, we prepared the protamine-modified Pt NPs through direct adsorption on the surface of citrate-capped Pt NPs. The electrostatic attraction between heparin and protamine-stabilized Pt NPs induced nanoparticle aggregation, inhibiting their catalytic activity. Therefore, the lowest detectable heparin concentrations through UV-vis absorption and by the naked eye were estimated to be 0.3 and 60nM, respectively. Moreover, the proposed system enabled the determination of the therapeutic heparin concentration in a single drop of blood. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Determination of nitrite in tap waters based on fluorosurfactant-capped gold nanoparticles-enhanced chemiluminescence from carbonate and peroxynitrous acid.

    Science.gov (United States)

    Li, Jinge; Li, Qianqian; Lu, Chao; Zhao, Lixia

    2011-06-07

    Fluorosurfactant (FSN)-capped gold nanoparticles (GNPs), which exhibit higher stability at a wider pH range and high ionic strength, were utilized for investigating the chemiluminescence (CL) effect on the reaction between high concentration carbonate (~0.3 M) and peroxynitrous acid. When the pH of the colloidal solution was 10.2 by dropwise addition of 0.05 M NaOH, FSN-capped GNPs offer an enhanced CL intensity. Based on the CL spectra, XPS spectra and the quenching effect of reactive oxygen species, a possible CL mechanism is proposed. The tolerance of FSN-capped GNPs towards salt concentrations (salt proofing effect) within a large pH range is an interesting feature, compared to the other previously reported work on nanoparticles CL systems. The CL intensity is proportional to the concentration of nitrite in the range from 0.1 to 100 μM. The detection limit (S/N = 3) is 0.036 μM and the relative standard deviation (RSD) for seven repeated measurements of 0.5 μM nitrite was 2.4%. This method has been successfully applied to determine nitrite in tap waters with recoveries of 97-106%.

  19. Polysaccharide-capped silver Nanoparticles inhibit biofilm formation and eliminate multi-drug-resistant bacteria by disrupting bacterial cytoskeleton with reduced cytotoxicity towards mammalian cells

    Science.gov (United States)

    Sanyasi, Sridhar; Majhi, Rakesh Kumar; Kumar, Satish; Mishra, Mitali; Ghosh, Arnab; Suar, Mrutyunjay; Satyam, Parlapalli Venkata; Mohapatra, Harapriya; Goswami, Chandan; Goswami, Luna

    2016-04-01

    Development of effective anti-microbial therapeutics has been hindered by the emergence of bacterial strains with multi-drug resistance and biofilm formation capabilities. In this article, we report an efficient green synthesis of silver nanoparticle (AgNP) by in situ reduction and capping with a semi-synthetic polysaccharide-based biopolymer (carboxymethyl tamarind polysaccharide). The CMT-capped AgNPs were characterized by UV, DLS, FE-SEM, EDX and HR-TEM. These AgNPs have average particle size of ~20-40 nm, and show long time stability, indicated by their unchanged SPR and Zeta-potential values. These AgNPs inhibit growth and biofilm formation of both Gram positive (B. subtilis) and Gram negative (E. coli and Salmonella typhimurium) bacterial strains even at concentrations much lower than the minimum inhibitory concentration (MIC) breakpoints of antibiotics, but show reduced or no cytotoxicity against mammalian cells. These AgNPs alter expression and positioning of bacterial cytoskeletal proteins FtsZ and FtsA. CMT-capped AgNPs can effectively block growth of several clinical isolates and MDR strains representing different genera and resistant towards multiple antibiotics belonging to different classes. We propose that the CMT-capped AgNPs can have potential bio-medical application against multi-drug-resistant microbes with minimal cytotoxicity towards mammalian cells.

  20. Synthesis of carboxyl-capped and bright YVO{sub 4}:Eu,Bi nanoparticles and their applications in immunochromatographic test strip assay

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Min; Sun, Tian-Ying; Wang, Jia-Hong; Yang, Peng; Gan, Liang; Liang, Li-Lei [Key Laboratory of Acoustic and Photonic Materials and Devices of Ministry of Education, Department of Physics, Wuhan University, Wuhan 430072 (China); Yu, Xue-Feng, E-mail: yxf@whu.edu.cn [Key Laboratory of Acoustic and Photonic Materials and Devices of Ministry of Education, Department of Physics, Wuhan University, Wuhan 430072 (China); Gong, Xing-Hou, E-mail: xinghoug@yahoo.com.cn [Department of Chemical and Environmental Engineering, Hubei University of Technology, Wuhan 430068 (China)

    2013-11-15

    Graphical abstract: - Highlights: • The morphology and properties of YVO{sub 4}:Eu,Bi nanoparticles were investigated. • YVO{sub 4}:Eu,Bi were coupled with IgG for bioprobes due to their good properties. • YVO{sub 4}:Eu,Bi were applied to immunochromatographic test strip assay. - Abstract: Carboxyl-capped YVO{sub 4}:Eu,Bi nanoparticles with average diameter of ∼10 nm were synthesized via a copolymer of phosphono and carboxylic acid mediated hydrothermal method. Under a 350 nm ultraviolet light excitation, the YVO{sub 4}:Eu,Bi NPs exhibit sharp and bright red emission peaked at 615 nm and with highest quantum yield of ∼43%. Furthermore, the nanoparticles show good water/buffer stability and feasible bioconjugation benefiting from the carboxylic groups on their surface. Based on these kind optical and surface properties of the YVO{sub 4}:Eu,Bi nanoparticles, an immunochromatographic test strip assay for quantitative determination of human IgG was achieved. This protocol can be extended to other rare-earth nanoparticles with the purpose of developing bioprobes for desired applications.

  1. Multifunctional PLGA particles containing poly(l-glutamic acid)-capped silver nanoparticles and ascorbic acid with simultaneous antioxidative and prolonged antimicrobial activity

    OpenAIRE

    Stevanović, Magdalena; Bračko, Ines; Milenković, Marina; Filipović, Nenad; Nunić, Jana; Filipič, Metka; Uskoković, Dragan

    2014-01-01

    A water-soluble antioxidant (ascorbic acid, vitamin C) was encapsulated together with poly(l-glutamic acid)-capped silver nanoparticles (AgNpPGA) within a poly(lactide-co-glycolide) (PLGA) polymeric matrix and their synergistic effects were studied. The PLGA/AgNpPGA/ascorbic acid particles synthesized by a physicochemical method with solvent/non-solvent systems are spherical, have a mean diameter of 775 nm and a narrow size distribution with a polydispersity index of 0.158. The encapsulation ...

  2. Mercaptoundecanoic acid capped palladium nanoparticles in a SAPO 34 membrane: a solution for enhancement of H₂/CO₂ separation efficiency.

    Science.gov (United States)

    Das, Jugal Kishore; Das, Nandini

    2014-12-10

    In this work, the high quality Pd/SAPO 34 membranes were grown on the support using a secondary (seeded) growth hydrothermal technique followed by insertion of 11-mercaptoundecanoic acid capped palladium (MUA-Pd) nanoparticles (NPs) to the membrane surface. For this, first, the indigenous low cost clay-alumina support was treated with poly diallyldimethylammonium chloride (PolyDADMAC) polymer, and subsequently, a seed layer of SAPO 34 crystals was deposited homogeneously in a regular orientation. Since PolyDADMAC is a high charge density cationic polymer, it assisted in reversing the charge of the support surface and produced an attractive electrostatic interaction between the support and zeolite crystals. This may facilitate the zeolite grain orientation in the synthesized membrane layer. Here, the Pd NPs were deposited in the membrane matrix by a simple dip-coating method. After thermal treatment of the Pd/SAPO 34 membrane, the defects were formed because of the removal of the structure-directing agent (SDA) from the zeolite pores but the presence of Pd NPs, which were entrapped inside the nonzeolitic pores and clogged the defects of the membrane. Field emission scanning electron microscopy (FESEM) and elemental mapping of the membrane cross-section confirmed that most of the Pd NPs were deposited at the interface of the membrane and the support layer which may increase the membrane efficiency, i.e., separation factor, as well as permeability of H2 through the membrane. As the membrane structure was associated with the oriented crystal, the pores were more aligned and permeation adequacy of H2 through the membrane enhanced. These membranes have a relative hydrogen permeance of 14.8 × 10(-7) mol·m(-2)·s(-1)·Pa(-1). The selectivity of H2/CO2 based on single gas permeation was 10.6, but for the mixture gas (H2/CO2 55:45), the H2/CO2 mixture separation factor increased up to 20.8 at room temperature. It is anticipated that this technique may be useful for making

  3. Size-Dependent Structure and Dynamics of CdS Nanoclusters

    OpenAIRE

    Rockenberger, J.; Tröger, L.; Kornowski, A.; Eychmüller, A.; Feldhaus, J.; Weller, H.

    1997-01-01

    CdS nanoparticles with diameters from 14 - 120 Å and very narrow size distributions are studied by x-ray absorption fine structure spectroscopy between 5 and 296 K. Clear trends in the Cd-S distance as a function of size and surface stabilization of the nanoparticles could be observed. Particles with thiols as ligands show an expansion of the Cd-S distance with decreasing particle size whereas polyphosphate stabilized samples are slightly contracted with respect to CdS bulk. The static disord...

  4. Green synthesis and antibacterial effects of aqueous colloidal solutions of silver nanoparticles using camomile terpenoids as a combined reducing and capping agent.

    Science.gov (United States)

    Parlinska-Wojtan, Magdalena; Kus-Liskiewicz, Małgorzata; Depciuch, Joanna; Sadik, Omowunmi

    2016-08-01

    Green synthesis method using camomile extract was applied to synthesize silver nanoparticles to tune their antibacterial properties merging the synergistic effect of camomile and Ag. Scanning transmission electron microscopy revealed that camomile extract (CE) consisted of porous globular nanometer sized structures, which were a perfect support for Ag nanoparticles. The Ag nanoparticles synthesized with the camomile extract (AgNPs/CE) of 7 nm average sizes, were uniformly distributed on the CE support, contrary to the pure Ag nanoparticles synthesized with glucose (AgNPs/G), which were over 50 nm in diameter and strongly agglomerated. The energy dispersive X-ray spectroscopy chemical analysis showed that camomile terpenoids act as a capping and reducing agent being adsorbed on the surface of AgNPs/CE enabling their reduction from Ag(+) and preventing them from agglomeration. Fourier transform infrared and ultraviolet-visible spectroscopy measurements confirmed these findings, as the spectra of AgNPs/CE, compared to pure CE, did not contain the 1109 cm(-1) band, corresponding to -C-O groups of terpenoids and the peaks at 280 and 320 nm, respectively. Antibacterial tests using four bacteria strains showed that the AgNPs/CE performed five times better compared to CE AgNPs/G samples, reducing totally all the bacteria in 2 h.

  5. Comparative studies of upconversion luminescence characteristics and cell bioimaging based on one-step synthesized upconversion nanoparticles capped with different functional groups

    Energy Technology Data Exchange (ETDEWEB)

    Tsang, Ming-Kiu [Department of Applied Physics, The Hong Kong Polytechnic University, Hong Kong (China); Chan, Chi-Fai; Wong, Ka-Leung [Department of Chemistry, Hong Kong Baptist University (Hong Kong); Hao, Jianhua, E-mail: jh.hao@polyu.edu.hk [Department of Applied Physics, The Hong Kong Polytechnic University, Hong Kong (China)

    2015-01-15

    Herein, three types of upconverting NaGdF{sub 4}:Yb/Er nanoparticles (UCNPs) have been synthesized via one-step hydrothermal synthesis with polyethylene glycol (PEG), polyethylenimine (PEI) and 6-aminocapronic acid (6AA) functionalization. To evident the presence of these groups, FTIR spectra and ζ-potentials were measured to support the successful capping of PEG, PEI and 6AA on the UCNPs. The regular morphology and cubic phase of these functionalized UCNPs were attributed to the capping effect of the surfactants. Tunable upconversion luminescence (UCL) from red to green were observed under 980 nm laser excitation and the UCL tuning was attributed to the presence of various surface ligands. Moreover, surface group dependent UCL bioimaging was performed in HeLa cells. The enhanced UCL bioimaging demonstrated by PEI functionalized UCNPs evident high cell uptake. The significant cell uptake is explained by the electrostatic attraction between the amino groups (–NH{sub 2}) and the cell membrane. Moreover, the functionalized UCNPs demonstrated low cytotoxicity in MTT assay. Additional, paramagnetic property was presented by these UCNPs under magnetic field. - Highlights: • Tunable upconversion emission by capped functional groups under fixed composition. • Surface dependent upconversion luminescence bioimaging in HeLa cells. • Low cytotoxicity. • Additional paramagnetic property due to Gd{sup 3+} ions.

  6. Carboxymethyl chitosan/phospholipid bilayer-capped mesoporous carbon nanoparticles with pH-responsive and prolonged release properties for oral delivery of the antitumor drug, Docetaxel.

    Science.gov (United States)

    Zhang, Yanzhuo; Zhu, Wufu; Zhang, Heran; Han, Jin; Zhang, Lihua; Lin, Qisi; Ai, Fengwei

    2017-10-30

    In this article, a new type of carboxymethyl chitosan/phospholipid bilayer-capped mesoporous carbon nanomatrix (CCS/PL/MC) was fabricated as a potential nano-drug delivery system. In this drug delivery system, a mesoporous carbon nanomatrix (MC) acts as the support for loading drug molecules, a positively charged phospholipid (PL) layer works as the inner shell for prolonged drug release and a negatively charged carboxymethyl chitosan (CCS) layer serves as the outer shell for pH-responsive drug release. Docetaxel (DTX) was selected as a model drug. The drug-loaded CCS/PL/MC was synthesized via a combination approach of double emulsion/solvent evaporation followed by lyophilization. The drug-loaded nanoparticles were characterized for their particle size, structure, morphology, zeta (ζ)-potential, specific surface area, porosity, drug loading and solid state. In vitro drug release tests showed that the drug-loaded CCS/PL/MC nanoparticles possess a good pH-sensitivity and prolonged releasing ability with negligible release in gastric media and controlled release in intestinal media. Compared with MC and PL-capped MC, CCS/PL/MC had a greater mucoadhesiveness. Moreover, cellular uptake study indicated that CCS/PL/MC might improve intracellular drug delivery. These results suggest that this hybrid nanocarrier, combining the beneficial features of CCS, PL and MC, is a promising drug delivery system able to improve the oral absorption of antitumor drugs. Copyright © 2017. Published by Elsevier B.V.

  7. Facile synthesis of mPEG-luteolin-capped silver nanoparticles with antimicrobial activity and cytotoxicity to neuroblastoma SK-N-SH cells.

    Science.gov (United States)

    Qing, Weixia; Wang, Yong; Li, Xiao; Lu, Minghua; Liu, Xiuhua

    2017-09-22

    We firstly report a facile route for the green synthesis of mPEG-luteolin-capped silver nanoparticles (mPEG-luteolin-AgNPs) using mPEG-luteolin as both the reducer and stabilizer. The reaction was carried out in a stirred aqueous solution at 50°C without additional poisonous reagents. The prepared mPEG-luteolin-AgNPs was characterized by scanning electron microscope (SEM), transmission electron microscopy (TEM), fourier transform infrared spectroscopy (FTIR), X-ray powder diffraction (XRD), zeta potential and UV-vis (UV-vis) spectrum, respectively. The proportions of mPEG-luteolin capped silver nanoparticles is about 89.9%, and the content of silver is 6.65%. The mPEG-luteolin-AgNPs was evaluated the antimicrobial effects on Staphlococcus aureus, Extended spectrum β-Lactamases Staphlococcus aureus, Escherichia Coli and Extended spectrum β-Lactamases Escherichia Coli using drilling hole method. The results showed that both gram-positive and gram-negative bacteria were killed by the mPEG-luteolin-AgNPs at low concentration. Meanwhile, the cell viability assay demonstrated that mPEG-luteolin-AgNPs had toxic effects on human neuroblastoma SK-N-SH cells. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Novel epithelial cell adhesion molecule antibody conjugated polyethyleneimine-capped gold nanoparticles for enhanced and targeted small interfering RNA delivery to retinoblastoma cells.

    Science.gov (United States)

    Mitra, Moutushy; Kandalam, Mallikarjuna; Rangasamy, Judith; Shankar, Balaji; Maheswari, Uma K; Swaminathan, Sethuraman; Krishnakumar, Subramanian

    2013-01-01

    Several nanoconjugates have been designed to deliver nucleic acids such as small interfering RNA (siRNA) and DNA to cells to study silencing and expression efficacies. In the present study, we prepared novel epithelial cell adhesion molecule (EpCAM) monoclonal antibody conjugated polyethyleneimine (PEI) capped gold nanoparticles (AuNPs) loaded with EpCAM-specific siRNA molecules to knock-down the EpCAM gene in retinoblastoma (RB) cells. We chose EpCAM as a target moiety to deliver siRNA because this molecule is highly expressed in various epithelial cancers and is an ideal target as it is highly expressed in the apical surface of tumor cells while showing basolateral expression in normal cells. The EpCAM antibody was conjugated to AuNP-PEI loaded with siRNA molecules to specifically deliver siRNA to EpCAM-expressing RB cells. Conjugation efficiencies were confirmed with ultraviolet-visible spectrophotometry, Fourier transform infrared spectroscopy, and agarose and SDS-polyacrylamide gel electrophoresis. The size and zeta potential were measured using a Zeta sizer analyzer. Nanoparticle internalization and uptake were studied using fluorescent microscopy and flow cytometry. Gene silencing efficacy was monitored with western blot analysis and real-time quantitative PCR. Optimal size and neutral zeta potential properties of the AuNP-PEI- EpCAM antibody (EpAb) antibody were achieved for the transfection studies. The AuNP-PEI nanoparticles did not show any cytotoxicity to the cells, which means these nanomaterials are suitable for intracellular delivery of siRNA for therapeutic interventions. With EpCAM antibody conjugation, PEI-capped AuNPs loaded with EpCAM siRNA were significantly internalized in the Y79 cells as observed with fluorescence microscopy and flow cytometry and induced a highly significant reduction in the cell viability of the Y79 cells. Through increased binding of EpCAM antibody-conjugated AuNP-PEI nanoparticles, significant downregulation of Ep

  9. Laser-ablation-induced synthesis of SiO2-capped noble metal nanoparticles in a single step.

    Science.gov (United States)

    Jiménez, Ernesto; Abderrafi, Kamal; Abargues, Rafael; Valdés, José L; Martínez-Pastor, Juan P

    2010-05-18

    Here we describe a simple, powerful technique based on the laser ablation of a target immersed in a water solution of a metal salt. With this method, nanoparticles of different metals and alloys can be processed very quickly. Both the target and the salt solution can be chosen to produce metal nanoparticles of different sizes, surface-oxidized nanoparticles (silica-silver, for example), or even more complex structures to be defined by the researcher on one or more steps because the technique combines the advantages of both physical and chemical methods. We have applied this technique to the fabrication of inert silica-metal (silver, gold, and silver-gold) nanoparticles with a strong surface plasmon resonance all together in a single step. The advantage of the simultaneous production of silica during laser ablation is the stabilization of the metal nanoparticle colloid but also the possibility to reduce the toxicity of these nanoparticles.

  10. Mixed-solvothermal synthesis of CdS micro/nanostructures with optical and ferromagnetic properties

    Science.gov (United States)

    Zhang, Zhufeng; Ren, Yinshuan; Han, Lu; Xie, Guoya; Zhong, Bo

    2017-08-01

    Several special CdS micro/nanostructures, including microspheres, microrods, nanorods, nanosheets and nanoparticles were successfully synthesized by a simple solvothermal method using ethylenediamine (EN), ethanolamine (EA) and ethylene glycol (EG) as pure and mixed solvents with different S and Cd sources. X-ray diffraction (XRD) measurements showed that micro/nanostructures CdS had a hexagonal wurtzite structure. Scanning electron microscopy (SEM) images showed that the morphologies of CdS consisted of microrods, microsphere and nanosheets at different preparation conditions. Transmission electron microscopy (TEM) images revealed the CdS consisted of nanoparticles and nanorods at different preparation conditions. The optical properties of the CdS were measured by optical absorption spectroscopy. A vibrating sample magnetometer (VSM) measured that the CdS nanoparticles exhibited room temperature ferromagnetism. The saturation magnetization of the CdS nanoparticles was 9.109 (10-3 emu/g). The origin of the CdS nanoparticles with ferromagnetic properties is attributed to structural defects.

  11. Cradle cap

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/007582.htm Cradle cap To use the sharing features on this page, please enable JavaScript. Cradle cap is seborrheic dermatitis that affects the scalp of ...

  12. Poly(ethylene) glycol-capped silver and magnetic nanoparticles: synthesis, characterization, and comparison of bactericidal and cytotoxic effects.

    Science.gov (United States)

    Mandal, A; Sekar, S; Chandrasekaran, N; Mukherjee, A; Sastry, T P

    2013-11-01

    Silver and magnetic (Fe3O4) nanoparticles have attracted wide attention as novel antimicrobial agents due to their unique chemical and physical properties. In order to study the comparative effects on antibacterial and animal cytotoxicity, Staphylococcus aureus and NIH 3T3 fibroblasts were used, respectively. Both nanoparticles were synthesized via a novel matrix-mediated method using poly(ethylene) glycol. Formation of silver nanoparticles was confirmed by fluorescence and ultraviolet-visible spectroscopic techniques. The poly(ethylene) glycol-coated silver and Fe3O4 nanoparticles were characterized by scanning electron microscope, transmission electron microscope, zeta potential, particle size analysis, Fourier-transform infrared, X-ray diffraction, and X-ray photoelectron spectroscopy. The antimicrobial results indicate that both poly(ethylene) glycol-coated silver and Fe3O4 nanoparticles inhibited S. aureus growth at the concentrations of 5 and 10 µg/mL at all time points without showing any significant cytotoxicity on NIH 3T3 fibroblasts. The particle size of both the poly(ethylene) glycol-coated silver and Fe3O4 nanoparticles dominated in the range 10-15 nm, obtained by particle size analyzer. The poly(ethylene) glycol coating on the particles showed less aggregation of nanoparticles, as observed by scanning electron microscope and transmission electron microscope. The overall obtained results indicated that these two nanoparticles were stable and could be used to develop a magnetized antimicrobial scaffolds for biomedical applications.

  13. Clinical Decision Support (CDS) Inventory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Clinical Decision Support (CDS) Inventory contains descriptions of past and present CDS projects across the Federal Government. It includes Federal projects,...

  14. Evaluation of Curcumin Capped Copper Nanoparticles as Possible Inhibitors of Human Breast Cancer Cells and Angiogenesis: a Comparative Study with Native Curcumin.

    Science.gov (United States)

    Kamble, Sonali; Utage, Bhimashankar; Mogle, Pratima; Kamble, Rahul; Hese, Shrikant; Dawane, Bhaskar; Gacche, Rajesh

    2016-10-01

    Synthesis of metal nanoparticles for improving therapeutic index and drug delivery is coming up as an attractive strategy in the mainstream of cancer therapeutic research. In the present study, curcumin-capped copper nanoparticles (CU-NPs) were evaluated as possible inhibitors of in vivo angiogenesis, pro-angiogenic cytokines involved in promoting tumor angiogenesis along with inhibition of cell proliferation and migration of breast cancer cell line MDA-MB-231. The antiangiogenic potential was assessed using in vivo chorioallantoic membrane (CAM) model. 3-(4, 5-Dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT)-based cytotoxicity assay was used to assess the effect of CU-NPs against proliferation of breast cancer cell line. The wound healing migration assay was used to evaluate the effects of CU-NPs on the migration ability of breast cancer cell line. Native curcumin (CU) was used as a reference compound for comparison purpose. The result of the present investigation indicates that CU-NPs could not demonstrate impressive antiangiogenic or anticancer activities significantly as compared to native CU. The possible mechanisms of experimental outcomes are discussed in the light of the methods of nanoparticle synthesis in concert with the current state of the art literature.

  15. Spectroscopic Study of the Thermal Degradation of PVP-capped Rh and Pt Nanoparticles in H2 and O2 Environments

    Energy Technology Data Exchange (ETDEWEB)

    Borodko, Yuri; Lee, Hyun Sook; Joo, Sang Hoon; Zhang, Yawen; Somorjai, Gabor A.

    2009-09-15

    Poly(N-vinylpyrrolidone) (PVP) capped platinum and rhodium nanoparticles (7-12 nm) have been studied with UV-VIS, FTIR and Raman spectroscopy. The absorption bands in the region 190-900 nm are shown to be sensitive to the electronic structure of surface Rh and Pt atoms as well as to the aggregation of the nanoparticles. In-situ FTIR-DRIFT spectroscopy of the thermal decay of PVP stabilized Rh and Pt nanoparticles in H{sub 2} and O{sub 2} atmospheres in temperatures ranging from 30 C-350 C reveal that decomposition of PVP above 200 C, PVP transforms into a 'polyamidpolyene' - like material that is in turn converted into a thin layer of amorphous carbon above 300 C. Adsorbed carbon monoxide was used as a probing molecule to monitor changes of electronic structure of surface Rh and Pt atoms and accessible surface area. The behavior of surface Rh and Pt atoms with ligated CO and amide groups of pyrrolidones resemble that of surface coordination compounds.

  16. Glycerol capped PbS/CdS core/shell nanoparticles at different molar ratio and its application in biosensors: An optical properties study

    Energy Technology Data Exchange (ETDEWEB)

    Das, D., E-mail: ddasphy014@gmail.com; Hussain, A. M. P. [Department of Physics, Cotton College, Guwahati, Assam, India- 781001 (India)

    2016-05-06

    Glycerol capped PbS/CdS core/shell type nanoparticles fabricated with two different molar ratios are characterized for study of structural and optical properties. The X-ray diffraction (XRD) pattern exhibits cubic phased polycrystalline nanocrystals. The calculated grain sizes from Williamson-Hall plot were found to be around 6 nm with increased strain. HRTEM investigation confirms the formation of core/shell nanostructures and the sizes of the particles were found to be around 7 nm which is in good agreement with the results of the W-H plot. An increase of band gap with the decrease in precursor concentration is confirmed from the blue shift in the absorption spectra and also from Tauc plot. A clear blue shifted intense emission is observed in the photoluminescence spectra with decrease in particle size. Intense luminescence from the core/shell nanostructure may be applied in bio labelling and biosensors.

  17. Modulatory effects of Zn2+ ions on the toxicity of citrate- and PVP-capped gold nanoparticles towards freshwater algae, Scenedesmus obliquus.

    Science.gov (United States)

    Iswarya, V; Johnson, J B; Parashar, Abhinav; Pulimi, Mrudula; Chandrasekaran, N; Mukherjee, Amitava

    2017-02-01

    Gold nanoparticles (GNPs) are widely used for medical purposes, both in diagnostics as well as drug delivery, and hence are prone to release and distribution in the environment. Thus, we have explored the effects of GNPs with two distinct surface capping (citrate and PVP), and three different sizes (16, 27, and 37 nm) at 0.01-, 0.1-, and 1-mg L-1 concentrations on a predominant freshwater alga Scenedesmus obliquus in the sterile freshwater matrix. We have also investigated how an abundant metal ion from freshwater, i.e., Zn2+ ions may modulate the effects of the selected GNPs (40 nm, citrate, and PVP capped). Preliminary toxicity results revealed that gold nanoparticles were highly toxic in comparison to zinc ions alone. A significant modulation in the toxicity of Zn ions was not noticed in the presence of GNPs. In contrast, zinc ions minimized the toxicity produced by GNPs (both CIT-37 and PVP-37), despite its individual toxicity. Approximately, about 42, 33, and 25% toxicity reduction was noted at 0.05-, 0.5-, and 5-mg L-1 Zn ions, respectively, for CIT-37 GNPs, while 31% (0.05 mg L-1), 24% (0.5 mg L-1), and 9% (5 mg L-1) of toxicity reduction were noted for PVP-37 GNPs. Maximum toxicity reduction was seen at 0.05 mg L-1 of Zn ions. Abbott modeling substantiated antagonistic effects offered by Zn2+ ions on GNPs. Stability and sedimentation data revealed that the addition of zinc ions gradually induced the aggregation of NPs and in turn significantly reduced the toxicity of GNPs. Thus, the naturally existing ions like Zn2+ have an ability to modulate the toxicity of GNPs in a real-world environment scenario.

  18. Polyvinylpyrrolidone-Capped Silver Nanoparticle Inhibits Infection of Carbapenem-Resistant Strain of Acinetobacter baumannii in the Human Pulmonary Epithelial Cell

    Directory of Open Access Journals (Sweden)

    Vishvanath Tiwari

    2017-08-01

    Full Text Available Acinetobacter baumannii, an opportunistic ESKAPE pathogen, causes respiratory and urinary tract infections. Its prevalence increases gradually in the clinical setup. Pathogenicity of Acinetobacter is significantly influenced by its ability to infect and survive in human pulmonary cells. Therefore, it is important to study the infection of A. baumannii in human pulmonary host cell (A-549, monitoring surface interacting and internalized bacteria. It was found that during infection of A. baumannii, about 40% bacteria adhered to A-549, whereas 20% got internalized inside pulmonary cell and induces threefold increase in the reactive oxygen species production. We have synthesized polyvinylpyrrolidone (PVP-capped AgNPs using chemical methods and tested its efficacy against carbapenem-resistant strain of A. baumannii. PVP-capped silver nanoparticles (PVP-AgNPs (30 µM have shown antibacterial activity against carbapenem-resistant strain of A. baumannii and this concentration does not have any cytotoxic effect on the human pulmonary cell line (IC50 is 130 µM. Similarly, PVP-AgNPs treatment decreases 80% viability of intracellular bacteria, decreases adherence of A. baumannii to A-549 (40 to 2.2%, and decreases intracellular concentration (20 to 1.3% of A. baumannii. This concludes that PVP-AgNPs can be developed as a substitute for carbapenem to control the infection caused by carbapenem-resistant A. baumannii.

  19. Electrochemical Detection of Hydrogen Peroxide by Inhibiting the p-Benzenediboronic Acid-Triggered Assembly of Citrate-Capped Au/Ag Nanoparticles on Electrode Surface

    Directory of Open Access Journals (Sweden)

    Lin Liu

    2017-01-01

    Full Text Available Metal nanoparticles (NPs possess unique physicochemical attributes for creating effective recognition and transduction processes in chem/bio-sensing. In this work, we suggested that citrate-capped Au/Ag NPs could be used as the reporters for the design of hydrogen peroxide (H2O2 sensors with a simple manipulation principle and an easy detection procedure. Specifically, p-benzenediboronic acid (BDBA induced the aggregation of citrate-capped Au NPs through the cross-linking reaction between citrate and boronic acid of BDBA in solution. By modifying the electrode with a boronic acid derivative, the BDBA-induced assembly of Au NPs was achieved on the electrode surface. This led to a significant decrease in the electron transfer resistance due to the unique conductive ability of Au NPs. However, when the boronate group on the electrode surface was oxidized into its phenol format, the assembly of Au NPs on the electrode surface was not achieved. As a result, a higher electron transfer resistance was observed. The process could be monitored by electrochemical impedance technique. Furthermore, when Ag NPs were used instead of Au NPs in this design, the H2O2 concentration could be determined by measuring the linear-sweep voltammetry (LSV current through the solid-state Ag/AgCl reaction of Ag NPs. The results indicated that NP-based colorimetric assays could be developed into more sensitive electrochemical analysis.

  20. Biomolecularly capped uniformly sized nanocrystalline materials: glutathione-capped ZnS nanocrystals

    Science.gov (United States)

    Torres-Martínez, Claudia L.; Nguyen, Liem; Kho, Richard; Bae, Weon; Bozhilov, Krassimir; Klimov, Victor; Mehra, Rajesh K.

    1999-09-01

    Micro-organisms such as bacteria and yeasts form CdS to detoxify toxic cadmium ions. Frequently, CdS particles formed in yeasts and bacteria were found to be associated with specific biomolecules. It was later determined that these biomolecules were present at the surface of CdS. This coating caused a restriction in the growth of CdS particles and resulted in the formation of nanometre-sized semiconductors (NCs) that exhibited typical quantum confinement properties. Glutathione and related phytochelatin peptides were shown to be the biomolecules that capped CdS nanocrystallites synthesized by yeasts Candida glabrata and Schizosaccharomyces pombe. Although early studies showed the existence of specific biochemical pathways for the synthesis of biomolecularly capped CdS NCs, these NCs could be formed in vitro under appropriate conditions. We have recently shown that cysteine and cysteine-containing peptides such as glutathione and phytochelatins can be used in vitro to dictate the formation of discrete sizes of CdS and ZnS nanocrystals. We have evolved protocols for the synthesis of ZnS or CdS nanocrystals within a narrow size distribution range. These procedures involve three steps: (1) formation of metallo-complexes of cysteine or cysteine-containing peptides, (2) introduction of stoichiometric amounts of inorganic sulfide into the metallo-complexes to initiate the formation of nanocrystallites and finally (3) size-selective precipitation of NCs with ethanol in the presence of Na+. The resulting NCs were characterized by optical spectroscopy, high-resolution transmission electron microscopy (HRTEM), x-ray diffraction and electron diffraction. HRTEM showed that the diameter of the ZnS-glutathione nanocrystals was 3.45+/-0.5 nm. X-ray diffraction and electron diffraction analyses indicated ZnS-glutathione to be hexagonal. Photocatalytic studies suggest that glutathione-capped ZnS nanocrystals prepared by our procedure are highly efficient in degrading a test model

  1. Synthesis, characterization and toxicological evaluation of maltodextrin capped cadmium sulfide nanoparticles in human cell lines and chicken embryos

    Directory of Open Access Journals (Sweden)

    Rodríguez-Fragoso Patricia

    2012-12-01

    Full Text Available Abstract Background Semiconductor Quantum dots (QDs have become quite popular thanks to their properties and wide use in biological and biomedical studies. However, these same properties entail new challenges in understanding, predicting, and managing potential adverse health effects following exposure. Cadmium and selenium, which are the major components of the majority of quantum dots, are known to be acutely and chronically toxic to cells and organisms. Protecting the core of nanoparticles can, to some degree, control the toxicity related to cadmium and selenium leakage. Results This study successfully synthesized and characterized maltodextrin coated cadmium sulfide semiconductor nanoparticles. The results show that CdS-MD nanoparticles are cytotoxic and embryotoxic. CdS-MD nanoparticles in low concentrations (4.92 and 6.56 nM lightly increased the number of HepG2 cell. A reduction in MDA-MB-231 cells was observed with concentrations higher than 4.92 nM in a dose response manner, while Caco-2 cells showed an important increase starting at 1.64 nM. CdS-MD nanoparticles induced cell death by apoptosis and necrosis in MDA-MD-231 cells starting at 8.20 nM concentrations in a dose response manner. The exposure of these cells to 11.48-14.76 nM of CdS-MD nanoparticles induced ROS production. The analysis of cell proliferation in MDA-MB-231 showed different effects. Low concentrations (1.64 nM increased cell proliferation (6% at 7 days (p 4.92 nM increased cell proliferation in a dose response manner (15-30% at 7 days. Exposures of chicken embryos to CdS-MD nanoparticles resulted in a dose-dependent increase in anomalies that, starting at 9.84 nM, centered on the heart, central nervous system, placodes, neural tube and somites. No toxic alterations were observed with concentrations of  Conclusions Our results indicate that CdS-MD nanoparticles induce cell death and alter cell proliferation in human cell lines at concentrations higher than 4.92 n

  2. Synthesis, characterization and magnetic properties of MFe{sub 2}O{sub 4} (M=Co, Mg, Mn, Ni) nanoparticles using ricin oil as capping agent

    Energy Technology Data Exchange (ETDEWEB)

    Gherca, Daniel [Faculty of Chemistry, Alexandru Ioan Cuza University, Blvd. Carol I nr 11, Iasi 700506 (Romania); Pui, Aurel, E-mail: aurel@uaic.ro [Faculty of Chemistry, Alexandru Ioan Cuza University, Blvd. Carol I nr 11, Iasi 700506 (Romania); Cornei, Nicoleta [Faculty of Chemistry, Alexandru Ioan Cuza University, Blvd. Carol I nr 11, Iasi 700506 (Romania); Cojocariu, Alina; Nica, Valentin; Caltun, Ovidiu [Faculty of Physics and Carpath Center, Alexandru Ioan Cuza University, Blvd. Carol I nr 11, Iasi 700506 (Romania)

    2012-11-15

    We focused on obtaining MFe{sub 2}O{sub 4} nanoparticles using ricin oil solution as surfactant and on their structural characterization and magnetic properties. The annealed samples at 500 Degree-Sign C in air for 6 h were analyzed for the crystal phase identification by powder X-ray diffraction using CuK{alpha} radiation. The particle size, the chemical composition and the morphology of the calcinated powders were characterized by scanning electron microscopy. All sintered samples contain only one phase, which has a cubic structure with crystallite sizes of 12-21 nm. From the infrared spectra of all samples were observed two strong bands around 600 and 400 cm{sup -1}, which correspond to the intrinsic lattice vibrations of octahedral and tetrahedral sites of the spinel structure, respectively, and characteristic vibration for capping agent. The magnetic properties of fine powders were investigated at room temperature by using a vibrating sample magnetometer. The room temperature M-H hysteresis loops show ferromagnetic behavior of the calcined samples, with specific saturation magnetization (M{sub s}) values ranging between 11 and 53 emu/g. - Highlights: Black-Right-Pointing-Pointer MFe{sub 2}O{sub 4} nanoparticles obtained using ricin oil as surfactant. Black-Right-Pointing-Pointer The structures were confirmed by SEM micrographs, FTIR spectra and XRD spectroscopy. Black-Right-Pointing-Pointer The samples contain only one phase with crystallite sizes of 12-21 nm.

  3. Hybrid mesoporous silica nanoparticles with pH-operated and complementary H-bonding caps as an autonomous drug-delivery system.

    Science.gov (United States)

    Théron, Christophe; Gallud, Audrey; Carcel, Carole; Gary-Bobo, Magali; Maynadier, Marie; Garcia, Marcel; Lu, Jie; Tamanoi, Fuyuhiko; Zink, Jeffrey I; Wong Chi Man, Michel

    2014-07-21

    Mesoporous silica nanoparticles (MSNPs) are functionalized with molecular-recognition sites by anchoring a triazine or uracil fragment on the surface. After loading these MSNPs with dyes (propidium iodide or rhodamine B) or with a drug (camptothecin, CPT) they are capped by the complementary fragments, uracil and adenine, respectively, linked to the bulky cyclodextrin ring. These MSNPs are pH-sensitive and indeed, the dye release was observed at acidic pH by continuously monitored fluorescence spectroscopy studies. On the other hand, no dye leakage occurred at neutral pH, hence meeting the non-premature requirement to minimize side effects. In vitro studies were performed and confocal microscopy images demonstrate the internalization of the MSNPs and also dye release in the cells. To investigate the drug-delivery performance, the cytotoxicity of CPT-loaded nanoparticles was tested and cell death was observed. A remarkably lower amount of loaded CPT in the MSNPs (more than 40 times less) proved to be as efficient as free CPT. These results not only demonstrate the drug release after pore opening under lysosomal pH, but they also show the potential use of these MSNPs to significantly decrease the amount of the administered drug. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Dialkylamide as Both Capping Agent and Surfactant in a Direct Solvothermal Synthesis of Magnetite and Titania Nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Cara, C.; Musinu, A.; Mameli, V.; Ardu, A.; Nižňanský, D.; Buršík, Josef; Scorciapino, M. A.; Manzo, G.; Cannas, C.

    2015-01-01

    Roč. 15, č. 5 (2015), s. 2364-2372 ISSN 1528-7483 R&D Projects: GA ČR(CZ) GA14-18392S Institutional support: RVO:61388980 Keywords : Nanomagnetics * Nanoparticles * Nuclear magnetic resonance * Fourier transform infrared spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 4.425, year: 2015

  5. In situ growth of capping-free magnetic iron oxide nanoparticles on liquid-phase exfoliated graphene

    NARCIS (Netherlands)

    Tsoufis, T.; Syrgiannis, Z.; Akhtar, N.; Prato, M.; Katsaros, F.; Sideratou, Z.; Kouloumpis, A.; Gournis, D.; Rudolf, P.

    2015-01-01

    We report a facile approach for the in situ synthesis of very small iron oxide nanoparticles on the surface of high-quality graphene sheets. Our synthetic strategy involved the direct, liquid-phase exfoliation of highly crystalline graphite (avoiding any oxidation treatment) and the subsequent

  6. An IMPLICATION logic gate based on citrate-capped gold nanoparticles with thiocyanate and iodide as inputs.

    Science.gov (United States)

    Deng, Hao-Hua; Li, Guang-Wen; Lin, Xin-Hua; Liu, Ai-Lin; Chen, Wei; Xia, Xing-Hua

    2013-11-07

    Herein we developed an IMPLICATION logic gate based on citrate-capped AuNPs by employing thiocyanate (SCN(-)) and iodide (I(-)) as inputs, and devised a colorimetric sensor for the determination of I(-) with good selectivity and sensitivity. To the best of our knowledge, this is the first example in which two species of anions serve as inputs to obtain visually observed Boolean outputs. Under the optimum conditions, 0.8 μM I(-) could induce a significant color change and be recognized by the naked eye. The detection limit is 50 nM by using UV-vis spectroscopy.

  7. Development, optimization, and in vitro characterization of dasatinib-loaded PEG functionalized chitosan capped gold nanoparticles using Box-Behnken experimental design.

    Science.gov (United States)

    Adena, Sandeep Kumar Reddy; Upadhyay, Mansi; Vardhan, Harsh; Mishra, Brahmeshwar

    2018-03-01

    The purpose of this research study was to develop, optimize, and characterize dasatinib loaded polyethylene glycol (PEG) stabilized chitosan capped gold nanoparticles (DSB-PEG-Ch-GNPs). Gold (III) chloride hydrate was reduced with chitosan and the resulting nanoparticles were coated with thiol-terminated PEG and loaded with dasatinib (DSB). Plackett-Burman design (PBD) followed by Box-Behnken experimental design (BBD) were employed to optimize the process parameters. Polynomial equations, contour, and 3D response surface plots were generated to relate the factors and responses. The optimized DSB-PEG-Ch-GNPs were characterized by FTIR, XRD, HR-SEM, EDX, TEM, SAED, AFM, DLS, and ZP. The results of the optimized DSB-PEG-Ch-GNPs showed particle size (PS) of 24.39 ± 1.82 nm, apparent drug content (ADC) of 72.06 ± 0.86%, and zeta potential (ZP) of -13.91 ± 1.21 mV. The responses observed and the predicted values of the optimized process were found to be close. The shape and surface morphology studies showed that the resulting DSB-PEG-Ch-GNPs were spherical and smooth. The stability and in vitro drug release studies confirmed that the optimized formulation was stable at different conditions of storage and exhibited a sustained drug release of the drug of up to 76% in 48 h and followed Korsmeyer-Peppas release kinetic model. A process for preparing gold nanoparticles using chitosan, anchoring PEG to the particle surface, and entrapping dasatinib in the chitosan-PEG surface corona was optimized.

  8. Glutathione-Capped Gold Nanoparticles-Based Photoacoustic Sensor for Label-Free Detection of Lead Ions

    Science.gov (United States)

    Shi, R.; Liu, X.-J.; Ying, Y.

    2017-07-01

    The photoacoustic signal generated by laser-induced nanobubbles (PA-LINB) proved to be a sensitive tool to monitor the aggregation of gold nanoparticles. Here, a simple and label-free photoacoustic method for the rapid detection of Pb2+ in the aqueous phase was developed. Due to the high affinity of Pb2+ ions to glutathione, the presence of Pb2+ led to the aggregation of glutathione-conjugated gold nanoparticles (GSH-GNPs). Hence, by measuring the variation of the PA-LINB signal after the aggregation of GSH-GNPs, Pb2+ can be quantified. A low detection limit for Pb2+ (42 nM) and a wide linear working range ( 42-1000 nM) were achieved. Furthermore, the proposed method showed good selectivity against other metal ions.

  9. Artificial photosynthesis of C1-C3 hydrocarbons from water and CO2 on titanate nanotubes decorated with nanoparticle elemental copper and CdS quantum dots.

    Science.gov (United States)

    Park, Hyunwoong; Ou, Hsin-Hung; Colussi, Agustín J; Hoffmann, Michael R

    2015-05-14

    The conversion of CO2 and water into value-added fuels with visible light is difficult to achieve in inorganic photocatalytic systems. However, we synthesized a ternary catalyst, CdS/(Cu-TNTs), which is assembled on a core of sodium trititanate nanotubes (TNTs; NaxH2-xTi3O7) decorated with elemental copper deposits followed by an overcoat of CdS quantum dot deposits. This ternary photocatalyst is capable of catalyzing the conversion of CO2 and water into C1-C3 hydrocarbons (e.g., CH4, C2H6, C3H8, C2H4, C3H6) upon irradiation with visible light above 420 nm. With this composite photocatalyst, sacrificial electron donors are not required for the photoreduction of CO2. We have shown that water is the principal photoexcited-state electron donor, while CO2 bound to the composite surface serves as the corresponding electron acceptor. If the photochemical reaction is carried out under an atmosphere of 99.9% (13)CO2, then the product hydrocarbons are built upon a (13)C backbone. However, free molecular H2 is not observed over 5 h of visible light irradiation even though proton reduction in aqueous solution is thermodynamically favored over CO2 reduction. In terms of photocatalytic efficiency, the stoichiometric fraction of Na(+) in TNTs appears to be an important factor that influences the formation of the observed hydrocarbons. The coordination of CO2 to surface exchange sites on the ternary catalyst leads to the formation of surface-bound CO2 and related carbonate species. It appears that the bidentate binding of O═C═O to certain reactive surface sites reduces the energy barrier for conduction band electron transfer to CO2. The methyl radical (CH3(•)), an observed intermediate in the reaction, was positively identified using an ESR spin trapping probe molecule. The copper deposits on the surface of TNTs appear to play a major role in the transient trapping of methyl radical, which in turn self-reacts to produce ethane.

  10. Order/disorder dynamics in a dodecanethiol-capped gold nanoparticles supracrystal by small-angle ultrafast electron diffraction

    OpenAIRE

    Mancini, Giulia Fulvia; Latychevskaia, Tatiana; Pennacchio, Francesco; Reguera, Javier; Stellacci, Francesco; Carbone, Fabrizio

    2015-01-01

    In metal nanoparticles (NPs) supracrystals, the metallic core provides some key properties, e.g. magnetization, plasmonic response or conductivity, with the ligand molecules giving rise to others like solubility, assembly or interaction with biomolecules. The formation of these supracrystals depends on a complex interplay between many forces, some stemming from the core, some from the ligands. At present, there is no known approach to characterize the local order of ligand molecules or their ...

  11. Safe-haven CDS Premia

    DEFF Research Database (Denmark)

    Klingler, Sven; Lando, David

    We argue that Credit Default Swap (CDS) premia for safe-haven sovereigns, like Germany and the United States, are driven to a large extent by regulatory requirements under which derivatives dealing banks have an incentive to buy CDS to hedge counterparty credit risk of their counterparties. We...... explain the mechanics of the regulatory requirements and develop a model in which derivatives dealers, who have a derivatives exposure with sovereigns, need CDS for capital relief. End users without exposure to the sovereigns sell the CDS and require a positive premium equivalent to the capital...

  12. CDS User survey

    CERN Multimedia

    CERN Document Service

    2011-01-01

      The CERN Document Server is launching a user survey in order to collect information relative to its search engine, submission interfaces, collaborative features and content organisation. With the view of re-shaping its collections and interfaces and to better integrate with the new INSPIRE platform that serves all HEP literature, CERN Document Server team invites you to take part in the survey. Your input is essential to provide us with useful information before setting up the new service and improve your interactions with CDS. Thanks for participating !  

  13. One-pot solvothermal route to self-assembly of cauliflower-shaped CdS microspheres

    Science.gov (United States)

    Ge, Ming; Cui, Yao; Liu, Lu; Zhou, Zhen

    2011-05-01

    Nearly monodispersed cauliflower-shaped CdS microspheres were prepared through a simple one-step solvothermal route on a large scale by employing sodium dodecyl sulfate (SDS) as the surfactant. Images by field emission scanning electron microscope (FESEM) and transmission electron microscope (TEM) indicate that cauliflower-shaped CdS microspheres with diameters in the range from 1.3 to 4.5 μm are assembled by nanoparticles with an average diameter of approximately 30 nm. The possible formation mechanism of the cauliflower-shaped CdS microspheres was also proposed. The photovoltaic activity of cauliflower-shaped CdS architectures has been investigated, indicating that the as-obtained CdS microspheres exhibited higher photovoltaic performance in comparison with CdS nanoparticles.

  14. Cervical Cap

    Science.gov (United States)

    ... p020041. Accessed Nov. 11, 2014. Cervical cap About Advertisement Mayo Clinic does not endorse companies or products. ... a Job Site Map About This Site Twitter Facebook Google YouTube Pinterest Mayo Clinic is a not- ...

  15. Cervical Cap

    Science.gov (United States)

    ... pregnant during a year of typical use. This difference is due to the fact that the vagina and cervix are stretched by giving birth vaginally, which means the cervical cap may not fit as well. Inconsistent or incorrect ...

  16. Small-angle neutron scattering studies of mineralization on BSA coated citrate capped gold nanoparticles used as a model surface for membrane scaling in RO wastewater desalination.

    Science.gov (United States)

    Dahdal, Y N; Pipich, V; Rapaport, H; Oren, Y; Kasher, R; Schwahn, D

    2014-12-23

    Bovine serum albumin (BSA) coated on citrate capped gold nanoparticles (BSA-GNPs) was exposed to a simulated wastewater effluent (SSE) in order to study the mineralization and thereby mimic scaling at biofouled membranes of reverse osmosis (RO) wastewater desalination plants. RO is a leading technology of achieving freshwater quality as it has the capability of removing both dissolved inorganic salts and organic contaminants from tertiary wastewater effluents. The aim was to better understand one of the major problems facing this technology which is fouling of the membranes, mainly biofouling and scaling by calcium phosphate. The experiments were performed using the small-angle neutron scattering (SANS) technique. The nanoparticles, GNPs, stabilized by the citrate groups showed 30 Å large particles having a homogeneous distribution of gold and citrate with a gold volume fraction of the order of 1%. On the average two BSA monomers are grafted at 2.4 GNPs. The exposed BSA-GNPs to SSE solution led to immediate mineralization of stable composite particles of the order of 0.2 μm diameter and a mineral volume fraction between 50% and 80%. The volume fraction of the mineral was of the order of 10(-5), which is roughly 3 times larger but an order of magnitude smaller than the maximum possible contents of respectively calcium phosphate and calcium carbonate in the SSE solution. Considering the extreme low solubility product of calcium phosphate, we suggest total calcium phosphate and partially (5-10%) calcium carbonate formation in the presence of BSA-GNPs.

  17. Mimetic Ag nanoparticle/Zn-based MOF nanocomposite (AgNPs@ZnMOF) capped with molecularly imprinted polymer for the selective detection of patulin.

    Science.gov (United States)

    Bagheri, Nafiseh; Khataee, Alireza; Habibi, Biuck; Hassanzadeh, Javad

    2018-03-01

    Here, Ag nanoparticle/flake-like Zn-based MOF nanocomposite (AgNPs@ZnMOF) with great peroxidase-like activity was applied as an efficient support for molecularly imprinted polymer (MIP) and successfully used for selective determination of patulin. AgNPs@ZnMOF was simply synthesized by creating Ag nanoparticles (Ag NPs) inside the nano-pores of flake-like (Zn)MOF. The high surface area of MOF remarkably improved the catalytic activity of Ag NPs which was assessed by fluorometric, colorimetric and electrochemical techniques. Furthermore, it was observed that patulin could strangely reduce the catalytic activity of AgNPs@ZnMOF, probably due to its electron capturing features. This outcome was the motivation to design an assay for patulin detection. In order to make a selective interaction with patulin molecules, MIP layer was created on the surface of AgNPs@ZnMOF by co-polymerization reaction of 3-aminopropyl triethoxysilane (APTES) and tetraethyl orthosilicate (TEOS) monomers wherein patulin was applied as template agent. Combination between the selective identifying feature of MIP and outstanding peroxidase-like activity of novel AgNPs@ZnMOF nanocomposite as well as the sensitive fluorescence detection system was led to the design of a reliable probe for patulin. The prepared MIP-capped AgNPs@ZnMOF catalyzed the H 2 O 2 -terephthalic acid reaction which produced a high florescent product. In the presence of patulin, the fluorescence intensity was decreased proportional to its concentration in the range of 0.1-10µmolL -1 with a detection limit of 0.06µmolL -1 . The proposed method was able to selectively measure patulin in a complex media without significant interfering effects from analogue compounds. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. A 3D vascularized bone remodeling model combining osteoblasts and osteoclasts in a CaP nanoparticle-enriched matrix.

    Science.gov (United States)

    Bongio, Matilde; Lopa, Silvia; Gilardi, Mara; Bersini, Simone; Moretti, Matteo

    2016-05-01

    We aimed to establish a 3D vascularized in vitro bone remodeling model. Human umbilical endothelial cells (HUVECs), bone marrow mesenchymal stem cells (BMSCs), and osteoblast (OBs) and osteoclast (OCs) precursors were embedded in collagen/fibrin hydrogels enriched with calcium phosphate nanoparticles (CaPn). We assessed vasculogenesis in HUVEC-BMSC coculture, osteogenesis with OBs, osteoclastogenesis with OCs, and, ultimately, cell interplay in tetraculture. HUVECs developed a robust microvascular network and BMSCs differentiated into mural cells. Noteworthy, OB and OC differentiation was increased by their reciprocal coculture and by CaPn, and even more by the combination of the tetraculture and CaPn. We successfully developed a vascularized 3D bone remodeling model, whereby cells interacted and exerted their specific function.

  19. Eco-friendly biosynthesis, anticancer drug loading and cytotoxic effect of capped Ag-nanoparticles against breast cancer

    Science.gov (United States)

    Naz, M.; Nasiri, N.; Ikram, M.; Nafees, M.; Qureshi, M. Z.; Ali, S.; Tricoli, A.

    2017-10-01

    The work aimed to prepare silver nanoparticles (Ag-NPs) from silver nitrate and various concentrations of the seed extract (Setaria verticillata) by a green synthetic route. The chemical and physical properties of the resulting Ag-NPs were investigated by X-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FTIR) spectrometry and ultraviolet-visible (UV-Vis) spectrophotometry. Anticancer activity of Ag-NPs (5-20 nm) had dose-dependent cytotoxic effect against breast cancer (MCF7-FLV) cells. The in vitro toxicity was studied on adult earthworms (Lumbricina) resulting in statistically significant (P < 0.05) inhibition. The prepared NPs were loaded with hydrophilic anticancer drugs (ACD), doxorubicin (DOX) and daunorubicin (DNR), for developing a novel drug delivery carrier having significant adsorption capacity and efficiency to remove the side effects of the medicines effective for leukemia chemotherapy.

  20. Eco-friendly biosynthesis, anticancer drug loading and cytotoxic effect of capped Ag-nanoparticles against breast cancer

    Science.gov (United States)

    Naz, M.; Nasiri, N.; Ikram, M.; Nafees, M.; Qureshi, M. Z.; Ali, S.; Tricoli, A.

    2017-11-01

    The work aimed to prepare silver nanoparticles (Ag-NPs) from silver nitrate and various concentrations of the seed extract ( Setaria verticillata) by a green synthetic route. The chemical and physical properties of the resulting Ag-NPs were investigated by X-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FTIR) spectrometry and ultraviolet-visible (UV-Vis) spectrophotometry. Anticancer activity of Ag-NPs (5-20 nm) had dose-dependent cytotoxic effect against breast cancer (MCF7-FLV) cells. The in vitro toxicity was studied on adult earthworms (Lumbricina) resulting in statistically significant ( P < 0.05) inhibition. The prepared NPs were loaded with hydrophilic anticancer drugs (ACD), doxorubicin (DOX) and daunorubicin (DNR), for developing a novel drug delivery carrier having significant adsorption capacity and efficiency to remove the side effects of the medicines effective for leukemia chemotherapy.

  1. Direct electron transfer of glucose oxidase and biosensing for glucose based on PDDA-capped gold nanoparticle modified graphene/multi-walled carbon nanotubes electrode.

    Science.gov (United States)

    Yu, Yanyan; Chen, Zuanguang; He, Sijing; Zhang, Beibei; Li, Xinchun; Yao, Meicun

    2014-02-15

    In this work, poly (diallyldimethylammonium chloride) (PDDA)-capped gold nanoparticles (AuNPs) functionalized graphene (G)/multi-walled carbon nanotubes (MWCNTs) nanocomposites were fabricated. Based on the electrostatic attraction, the G/MWCNTs hybrid material can be decorated with AuNPs uniformly and densely. The new hierarchical nanostructure can provide a larger surface area and a more favorable microenvironment for electron transfer. The AuNPs/G/MWCNTs nanocomposite was used as a novel immobilization platform for glucose oxidase (GOD). Direct electron transfer (DET) was achieved between GOD and the electrode. Field emission scanning electron microscopy (FESEM), UV-vis spectroscopy and cyclic voltammetry (CV) were used to characterize the electrochemical biosensor. The glucose biosensor fabricated based on GOD electrode modified with AuNPs/G/MWCNTs demonstrated satisfactory analytical performance with high sensitivity (29.72mAM(-1)cm(-2)) and low limit of detection (4.8 µM). The heterogeneous electron transfer rate constant (ΚS) and the apparent Michaelis-Menten constant (Km) of GOD were calculated to be 11.18s(-1) and 2.09 mM, respectively. With satisfactory selectivity, reproducibility, and stability, the nanostructure we proposed offered an alternative for electrode fabricating and glucose biosensing. © 2013 Elsevier B.V. All rights reserved.

  2. A new approach for bisphenol A detection employing fluorosurfactant-capped gold nanoparticle-amplified chemiluminescence from cobalt(II) and peroxymonocarbonate.

    Science.gov (United States)

    Pan, Feng; Liu, Lin; Dong, Shichao; Lu, Chao

    2014-07-15

    In this work, we utilized the nonionic fluorosurfactant-capped gold nanoparticles (GNPs) as a novel chemiluminescence (CL) probe for the determination of trace bisphenol A. Bisphenol A can induce a sharp decrease in CL intensity from the GNP-Co(2+)-peroxymonocarbonate (HCO4(-)) system. Under the selected experimental conditions, a linear relationship was obtained between the CL intensity and the logarithm of concentration of bisphenol A in the range of 0.05-50 μM (R(2) = 0.9936), and the detection limit at a signal-to-noise ratio of 3 for bisphenol A was 10 nM. The applicability of the proposed method has been validated by determining bisphenol A in real polycarbonate samples with satisfactory results. The recoveries for bisphenol A in spiked samples were found to be between 94.4% and 105.0%. The relative standard deviation (RSD) for 12 repeated measurements of 0.5 μM bisphenol A was 2.2%. The proposed method described herein was simple, selective and obviated the need of extensive sample pretreatment. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Protein-gold clusters-capped mesoporous silica nanoparticles for high drug loading, autonomous gemcitabine/doxorubicin co-delivery, and in-vivo tumor imaging

    KAUST Repository

    Croissant, Jonas G.

    2016-03-23

    Functional nanocarriers capable of transporting high drug contents without premature leakage and to controllably deliver several drugs are needed for better cancer treatments. To address this clinical need, gold cluster bovine serum albumin (AuNC@BSA) nanogates were engineered on mesoporous silica nanoparticles (MSN) for high drug loadings and co-delivery of two different anticancer drugs. The first drug, gemcitabine (GEM, 40 wt%), was loaded in positively-charged ammonium-functionalized MSN (MSN-NH3+). The second drug, doxorubicin (DOX, 32 wt%), was bound with negatively-charged AuNC@BSA electrostatically-attached onto MSN-NH3+, affording highly loaded pH-responsive MSN-AuNC@BSA nanocarriers. The co-delivery of DOX and GEM was achieved for the first time via an inorganic nanocarrier, possessing a zero-premature leakage behavior as well as drug loading capacities seven times higher than polymersome NPs. Besides, unlike the majority of strategies used to cap the pores of MSN, AuNC@BSA nanogates are biotools and were applied for targeted red nuclear staining and in-vivo tumor imaging. The straightforward non-covalent combination of MSN and gold-protein cluster bioconjugates thus leads to a simple, yet multifunctional nanotheranostic for the next generation of cancer treatments.

  4. Aptamer/Graphene Quantum Dots Nanocomposite Capped Fluorescent Mesoporous Silica Nanoparticles for Intracellular Drug Delivery and Real-Time Monitoring of Drug Release.

    Science.gov (United States)

    Zheng, Fen-Fen; Zhang, Peng-Hui; Xi, Yu; Chen, Jing-Jia; Li, Ling-Ling; Zhu, Jun-Jie

    2015-12-01

    Great challenges in investigating the release of drug in complex cellular microenvironments necessitate the development of stimuli-responsive drug delivery systems with real-time monitoring capability. In this work, a smart drug nanocarrier based on fluorescence resonance energy transfer (FRET) is fabricated by capping graphene quantum dots (GQDs, the acceptor) onto fluorescent mesoporous silica nanoparticles (FMSNs, the donor) via ATP aptamer for real-time monitoring of ATP-triggered drug release. Under extracellular conditions, the fluorescence of FMSNs remains in the "off" state in the low ATP level which is unable to trigger the release of drug. Once specifically recognized and internalized into the target tumor cells by AS1411 aptamer, in the ATP-rich cytoplasm, the conformation switch of the ATP aptamer causes the shedding of the GQDs from the nanocarriers, leading to the release of the loaded drugs and consequently severe cytotoxicity. Simultaneously, the fluorescence of FMSNs turns "on" along with the dissociation of GQDs, which allows real-time monitoring of the release of drug from the pores. Such a drug delivery system features high specificity of dual-target recognition with AS1411 and ATP aptamer as well as high sensitivity of the FRET-based monitoring strategy. Thus, the proposed multifunctional ATP triggered FRET-nanocarriers will find potential applications for versatile drug-release monitoring, efficient drug transport, and targeted cancer therapeutics.

  5. Effect of PVP as a capping agent in single reaction synthesis of nanocomposite soft/hard ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, H.A. [Department of Physics, Faculty of Science, Universiti Putra Malaysia, UPM, 43400 Serdang, Selangor (Malaysia); Saiden, N.M., E-mail: nlaily@upm.edu.my [Department of Physics, Faculty of Science, Universiti Putra Malaysia, UPM, 43400 Serdang, Selangor (Malaysia); Saion, E.; Azis, R.S.; Mamat, M.S. [Department of Physics, Faculty of Science, Universiti Putra Malaysia, UPM, 43400 Serdang, Selangor (Malaysia); Hashim, M. [Advanced Material and Nanotechnology Laboratory, Institute of Advanced Technology, Universiti Putra Malaysia, UPM, 43400 Serdang, Selangor (Malaysia)

    2017-04-15

    Nanocomposite magnets consist of soft and hard ferrite phases are known as an exchange spring magnet when they are sufficiently spin exchange coupled. Hard and soft ferrites offer high value of coercivity, H{sub c} and saturation magnetization, M{sub s} respectively. In order to obtain a better permanent magnet, both soft and hard ferrite phases need to be “exchange coupled”. The nanoparticles were prepared by a simple one-pot technique of 80% soft phase and 20% hard phase. This technique involves a single reaction mixture of metal nitrates and aqueous solution of varied amounts of polyvinylpyrrolidone (PVP). The heat treatment applied was at 800 °C for 3 h. The synthesized composites were characterized by Transmission Electron Microscope (TEM), Fourier Transform Infra-red (FT-IR), Energy Dispersive X-Ray (EDX), X-ray diffraction (XRD) and Vibrating sample magnetometer (VSM). The coexistence of two phases, Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and SrFe{sub 12}O{sub 19} were observed by XRD patterns. It also verified by the EDX that no impurities detected. The magnetic properties of nanocomposite ferrites for 0.06 g/ml PVP gives a better properties of H{sub c} 932 G and M{sub s} 39.0 emu/g with average particle size obtained from FESEM was 49.2 nm. The concentration of PVP used gives effect on the magnetic properties of the samples. - Highlights: • Amount of PVP play important roles in controlling the particle size distribution and magnetic properties. • This is a novel technique to produce nanocomposite ferrites effectively. • This study contributes better understanding on magnetic properties in nanoparticle composite magnets.

  6. Cradle Cap (For Parents)

    Science.gov (United States)

    ... Giving Teens a Voice in Health Care Decisions Cradle Cap (Infantile Seborrheic Dermatitis) KidsHealth > For Parents > Cradle Cap ( ... condition many babies develop called cradle cap. About Cradle Cap Cradle cap is the common term for seborrheic ...

  7. {sup 99m}Tc-labelled gold nanoparticles capped with HYNIC-peptide/mannose for sentinel lymph node detection

    Energy Technology Data Exchange (ETDEWEB)

    Ocampo-Garcia, Blanca E. [Instituto Nacional de Investigaciones Nucleares, Estado de Mexico (Mexico); Universidad Autonoma del Estado de Mexico, Estado de Mexico (Mexico); Ramirez, Flor de M. [Instituto Nacional de Investigaciones Nucleares, Estado de Mexico (Mexico); Ferro-Flores, Guillermina, E-mail: ferro_flores@yahoo.com.m [Instituto Nacional de Investigaciones Nucleares, Estado de Mexico (Mexico); De Leon-Rodriguez, Luis M. [Universidad de Guanajuato, Guanajuato (Mexico); Santos-Cuevas, Clara L.; Morales-Avila, Enrique [Instituto Nacional de Investigaciones Nucleares, Estado de Mexico (Mexico); Universidad Autonoma del Estado de Mexico, Estado de Mexico (Mexico); Arteaga de Murphy, Consuelo; Pedraza-Lopez, Martha [Instituto Nacional de Ciencias Medicas y Nutricion Salvador Zubiran, Mexico City (Mexico); Medina, Luis A. [Universidad Nacional Autonoma de Mexico, Mexico City (Mexico); Instituto Nacional de Cancerologia, Mexico City (Mexico); Camacho-Lopez, Marco A. [Universidad Autonoma del Estado de Mexico, Estado de Mexico (Mexico)

    2011-01-15

    The aim of this research was to prepare a multifunctional system of technetium-99m-labelled gold nanoparticles conjugated to HYNIC-GGC/mannose and to evaluate its biological behaviour as a potential radiopharmaceutical for sentinel lymph node detection (SLND). Methods: Hydrazinonicotinamide-Gly-Gly-Cys-NH{sub 2} (HYNIC-GGC) peptide and a thiol-triazole-mannose derivative were synthesized, characterized and conjugated to gold nanoparticles (AuNP, 20 nm) to prepare a multifunctional system of HYNIC-GGC-AuNP-mannose by means of spontaneous reaction of the thiol (Cys) present in HYNIC-GGC sequence and in the thiol-mannose derivative. The nanoconjugate was characterized by transmission electron microscopy (TEM), IR, UV-Vis, Raman, fluorescence and X-ray photoelectron spectroscopy (XPS). Technetium-99m labelling was carried out using EDDA/tricine as coligands and SnCl{sub 2} as reducing agent with further size-exclusion chromatography purification. Radiochemical purity was determined by size-exclusion HPLC and ITLC-SG analyses. In vitro binding studies were carried out in rat liver homogenized tissue (mannose-receptor positive tissue). Biodistribution studies were accomplished in Wistar rats and images obtained using a micro-SPECT/CT system. Results: TEM and spectroscopy techniques demonstrated that AuNPs were functionalized with HYNIC-GGC-NH{sub 2} and thiol-mannose through interactions with thiol groups and the N-terminal amine of cysteine. Radio-chromatograms showed radiochemical purity higher than 95%. {sup 99m}Tc-EDDA/HYNIC-GGC-AuNP-mannose ({sup 99m}Tc-AuNP-mannose) showed specific recognition for mannose receptors in rat liver tissue. After subcutaneous administration of {sup 99m}Tc-AuNP-mannose in rats (footpad), radioactivity levels in the popliteal and inguinal lymph nodes revealed that 99% of the activity was extracted by the first lymph node (popliteal extraction). Biodistribution studies and in vivo micro-SPECT/CT images in Wistar rats showed an evident

  8. Effect of PVP as a capping agent in single reaction synthesis of nanocomposite soft/hard ferrite nanoparticles

    Science.gov (United States)

    Ahmad, H. A.; Saiden, N. M.; Saion, E.; Azis, R. S.; Mamat, M. S.; Hashim, M.

    2017-04-01

    Nanocomposite magnets consist of soft and hard ferrite phases are known as an exchange spring magnet when they are sufficiently spin exchange coupled. Hard and soft ferrites offer high value of coercivity, Hc and saturation magnetization, Ms respectively. In order to obtain a better permanent magnet, both soft and hard ferrite phases need to be ;exchange coupled;. The nanoparticles were prepared by a simple one-pot technique of 80% soft phase and 20% hard phase. This technique involves a single reaction mixture of metal nitrates and aqueous solution of varied amounts of polyvinylpyrrolidone (PVP). The heat treatment applied was at 800 °C for 3 h. The synthesized composites were characterized by Transmission Electron Microscope (TEM), Fourier Transform Infra-red (FT-IR), Energy Dispersive X-Ray (EDX), X-ray diffraction (XRD) and Vibrating sample magnetometer (VSM). The coexistence of two phases, Ni0.5Zn0.5Fe2O4 and SrFe12O19 were observed by XRD patterns. It also verified by the EDX that no impurities detected. The magnetic properties of nanocomposite ferrites for 0.06 g/ml PVP gives a better properties of Hc 932 G and Ms 39.0 emu/g with average particle size obtained from FESEM was 49.2 nm. The concentration of PVP used gives effect on the magnetic properties of the samples.

  9. A redox-responsive mesoporous silica nanoparticle capped with amphiphilic peptides by self-assembly for cancer targeting drug delivery

    Science.gov (United States)

    Xiao, Dong; Jia, Hui-Zhen; Ma, Ning; Zhuo, Ren-Xi; Zhang, Xian-Zheng

    2015-05-01

    A redox-responsive mesoporous silica nanoparticle (RRMSN) was developed as a drug nanocarrier by noncovalent functionalization of MSNs with amphiphilic peptides containing the RGD ligand. The alkyl chain stearic acid (C18) with a thiol terminal group was anchored on the surface of MSNs via a disulfide bond, and the amphiphilic peptide (AP) C18-DSDSDSDSRGDS was coated by self-assembly through hydrophobic interactions between the octadecyl groups of MSNs and alkyl chains of AP, which played the role of a gatekeeper collectively. In vitro drug release profiles demonstrated that the anticancer drug (DOX) could be entrapped with nearly no leakage in the absence of dithiothreitol (DTT) or glutathione (GSH). With the addition of DTT or GSH, the entrapped drug released quickly due to the cleavage of the disulfide bond. It was found that after the internalization of MSNs by cancer cells via the receptor-mediated endocytosis, the surface amphiphilic peptides and alkyl chain of RRMSN/DOX were removed to induce rapid drug release intracellularly after the cleavage of the disulfide bond, triggered by GSH secreted in cancer cells. This novel intelligent RRMSN/DOX drug delivery system using self-assembly of amphiphilic peptides around the MSNs provides a facile, but effective strategy for the design and development of smart drug delivery for cancer therapy.A redox-responsive mesoporous silica nanoparticle (RRMSN) was developed as a drug nanocarrier by noncovalent functionalization of MSNs with amphiphilic peptides containing the RGD ligand. The alkyl chain stearic acid (C18) with a thiol terminal group was anchored on the surface of MSNs via a disulfide bond, and the amphiphilic peptide (AP) C18-DSDSDSDSRGDS was coated by self-assembly through hydrophobic interactions between the octadecyl groups of MSNs and alkyl chains of AP, which played the role of a gatekeeper collectively. In vitro drug release profiles demonstrated that the anticancer drug (DOX) could be entrapped with

  10. Cradle Cap

    Science.gov (United States)

    ... t contagious, and it's not caused by poor hygiene. Prevention Shampooing your baby's hair every few days can help prevent cradle cap. Stick with a mild baby shampoo unless your baby's doctor recommends something stronger. By Mayo Clinic Staff . Mayo Clinic Footer Legal Conditions and Terms Any ...

  11. Death cap

    DEFF Research Database (Denmark)

    Rudbæk, Torsten R; Kofoed, Pernille Bouteloup; Bove, Jeppe

    2014-01-01

    Death cap (Amanita phalloides) is commonly found and is one of the five most toxic fungi in Denmark. Toxicity is due to amatoxin, and poisoning is a serious medical condition, causing organ failure with potential fatal outcome. Acknowledgement and clarification of exposure, symptomatic and focused...

  12. One-step, room-temperature synthesis of glutathione-capped iron-oxide nanoparticles and their application in in vivo T1-weighted magnetic resonance imaging.

    Science.gov (United States)

    Liu, Chien-Liang; Peng, Yung-Kang; Chou, Shang-Wei; Tseng, Wei-Hsuan; Tseng, Yu-Jui; Chen, Hsieh-Chih; Hsiao, Jong-Kai; Chou, Pi-Tai

    2014-10-15

    The room-temperature, aqueous-phase synthesis of iron-oxide nanoparticles (IO NPs) with glutathione (GSH) is reported. The simple, one-step reduction involves GSH as a capping agent and tetrakis(hydroxymethyl)phosphonium chloride (THPC) as the reducing agent; GSH is an anti-oxidant that is abundant in the human body while THPC is commonly used in the synthesis of noble-metal clusters. Due to their low magnetization and good water-dispersibility, the resulting GSH-IO NPs, which are 3.72 ± 0.12 nm in diameter, exhibit a low r2 relaxivity (8.28 mm(-1) s(-1)) and r2/r1 ratio (2.28)--both of which are critical for T1 contrast agents. This, together with the excellent biocompatibility, makes these NPs an ideal candidate to be a T1 contrast agent. Its capability in cellular imaging is illustrated by the high signal intensity in the T1-weighted magnetic resonance imaging (MRI) of treated HeLa cells. Surprisingly, the GSH-IO NPs escape ingestion by the hepatic reticuloendothelial system, enabling strong vascular enhancement at the internal carotid artery and superior sagittal sinus, where detection of the thrombus is critical for diagnosing a stroke. Moreover, serial T1- and T2-weighted time-dependent MR images are resolved for a rat's kidneys, unveiling detailed cortical-medullary anatomy and renal physiological functions. The newly developed GSH-IO NPs thus open a new dimension in efforts towards high-performance, long-circulating MRI contrast agents that have biotargeting potential. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Microwave Synthesized Monodisperse CdS Spheres of Different Size and Color for Solar Cell Applications

    Directory of Open Access Journals (Sweden)

    Carlos A. Rodríguez-Castañeda

    2015-01-01

    Full Text Available Monodisperse CdS spheres of size of 40 to 140 nm were obtained by microwave heating from basic solutions. It is observed that larger CdS spheres were formed at lower solution pH (8.4–8.8 and smaller ones at higher solution pH (10.8–11.3. The color of CdS products changed with solution pH and reaction temperature; those synthesized at lower pH and temperature were of green-yellow color, whereas those formed at higher pH and temperature were of orange-yellow color. A good photovoltage was observed in CdS:poly(3-hexylthiophene solar cells with spherical CdS particles. This is due to the good dispersion of CdS nanoparticles in P3HT solution that led to a large interface area between the organic and inorganic semiconductors. Higher photocurrent density was obtained in green-yellow CdS particles of lower defect density. The efficient microwave chemistry accelerated the hydrolysis of thiourea in pH lower than 9 and produced monodisperse spherical CdS nanoparticles suitable for solar cell applications.

  14. Effects of bacteria on CdS thin films used in technological devices

    Science.gov (United States)

    Alpdoğan, S.; Adıgüzel, A. O.; Sahan, B.; Tunçer, M.; Metin Gubur, H.

    2017-04-01

    Cadmium sulfide (CdS) thin films were fabricated on glass substrates by the chemical bath deposition method at 70 {}^\\circ \\text{C} considering deposition times ranging from 2 h to 5 h. The optical band gaps of CdS thin films were found to be in the 2.42-2.37 eV range. CdS thin films had uniform spherical nano-size grains which had polycrystalline, hexagonal and cubic phases. The films had a characteristic electrical resistivity of the order of {{10}5} Ω \\text{cm} and n-type conductivity at room condition. CdS thin films were incubated in cultures of B.domonas aeruginosa and Staphylococcus aureus, which exist abundantly in the environment, and form biofilms. SEM images showed that S. aureus and K. pneumonia were detected significantly on the film surfaces with a few of P. aeruginosa and B. subtilis cells attached. CdS thin film surface exhibits relatively good resistance to the colonization of P. aeruginosa and B. subtilis. Optical results showed that the band gap of CdS thin films which interacted with the bacteria is 2.42 \\text{eV} . The crystal structure and electrical properties of CdS thin films were not affected by bacterial adhesion. The antimicrobial effect of CdS nanoparticles was different for different bacterial strains.

  15. Apical cap

    Energy Technology Data Exchange (ETDEWEB)

    McLoud, T.C.; Isler, R.J.; Novelline, R.A.; Putman, C.E.; Simeone, J.; Stark, P.

    1981-08-01

    Apical caps, either unilateral or bilateral, are a common feature of advancing age and are usually the result of subpleural scarring unassociated with other diseases. Pancoast (superior sulcus) tumors are a well recognized cause of unilateral asymmetric apical density. Other lesions arising in the lung, pleura, or extrapleural space may produce unilateral or bilateral apical caps. These include: (1) inflammatory: tuberculosis and extrapleural abscesses extending from the neck; (2) post radiation fibrosis after mantle therapy for Hodgkin disease or supraclavicular radiation in the treatment of breast carcinoma; (3) neoplasm: lymphoma extending from the neck or mediastinum, superior sulcus bronchogenic carcinoma, and metastases; (4) traumatic: extrapleural dissection of blood from a ruptured aorta, fractures of the ribs or spine, or hemorrhage due to subclavian line placement; (5) vascular: coarctation of the aorta with dilated collaterals over the apex, fistula between the subclavian artery and vein; and (6) miscellaneous: mediastinal lipomatosis with subcostal fat extending over the apices.

  16. Synthesis and characterization of water-dispersed CdSe/CdS core-shell quantum dots prepared via Layer-by-layer Method capped with carboxylic-functionalized poly(vinyl alcohol)

    Energy Technology Data Exchange (ETDEWEB)

    Ramanery, Fabio Pereira; Mansur, Alexandra Ancelmo Piscitelli; Mansur, Herman Sander, E-mail: hmansur@demet.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Metalurgia e Engenharia dos Materiais. Centro de Nanociencia, Nanotecnologia e Inovacao

    2014-08-15

    The main goal of this work was to synthesize CdSe/CdS (core-shell) nanoparticles stabilized by polymer ligand using entirely aqueous colloidal chemistry at room temperature. First, the CdSe core was prepared using precursors and acid-functionalized poly(vinyl alcohol) as the capping ligand. Next, a CdS shell was grown onto the CdSe core via the layer-by-layer technique. The CdS shell was formed by two consecutive monolayers, as estimated by empirical mathematical functions. The nucleation and growth of CdSe quantum dots followed by CdS shell deposition were characterized by UV-vis spectroscopy, photoluminescence (PL) spectroscopy and transmission electron microscopy (TEM). The results indicated a systematic red-shift of the absorption and emission spectra after the deposition of CdS, indicating the shell growth onto the CdSe core. TEM coupled with electron diffraction analysis revealed the presence of CdSe/CdS with an epitaxial shell growth. Therefore, it may be concluded that CdSe/CdS quantum dots with core-shell nanostructure were effectively synthesized.(author)

  17. Shape-controlled synthesis of protein-conjugated CdS nanocrystals (NCs) and study on the binding of Cd2+/CdS to trypsin

    Science.gov (United States)

    Qin, Dezhi; Wang, Li; Wang, Yabo; Du, Xian; Zhang, Li; Zhang, Qiuxia; He, Bingyu

    2017-07-01

    Protein-conjugated CdS nanocrystals (NCs) with different morphology have been synthesized under biomimetic condition using trypsin as capping agent in aqueous medium. The reaction parameters including concentration of trypsin, pH value, reaction time, and temperature have a major influence on the morphology and optical property of CdS NCs. XRD, selected area electron diffraction (SAED), TEM, HRTEM, and EDS characterizations were used to investigate the structure, composition, morphology, and size of as-prepared products. The binding reaction between Cd2+/CdS and trypsin was investigated systematically through various spectroscopic methods. UV-vis, FT-IR, photoluminescence (PL) spectra, and conductivity analysis of Cd2+-trypsin suggest that Cd2+ ions could coordinate with the functional groups of trypsin and induce the formation of unfolding and loosening structure in protein molecules, and the change of protein conformation was also verified by circular dichroism (CD) spectra. This interaction increased local supersaturation of Cd2+ ions around the groups of trypsin and reduced the nucleation activation energy of CdS nuclei, which favored heterogeneous nucleation in trypsin matrix and resulted in the formation of inorganic-organic hybrid materials. The functional integrity of the enzyme conjugated to CdS NCs was studied by monitoring the enzymatic activity of CdS-trypsin conjugates. The fluorescence of CdS NCs is dependent strongly on trypsin which passivates the surface of NCs.

  18. A comparative analysis of green synthesis approach starch capped metal oxides (ZnO & CdO) nanoparticles and its bacterial activity

    Science.gov (United States)

    Vidhya, K.; Devarajan, V. P.; Viswanathan, C.; Nataraj, D.; Bhoopathi, G.

    2013-06-01

    In this study, we have investigated the bacterial activity of starch capped ZnO & CdO NPs. The NPs were prepared through green technique under room temperature and then obtained samples were characterized by using XRD and PL techniques. XRD pattern confirms the crystal nature it shows hexagonal structure for ZnO NPs and monoclinic structure for CdO NPs and their average particle size is ±20 nm. Further, the optical properties of NPs were investigated using PL technique in which the starch capped ZnO NPs shows maximum emission at 440 nm whereas starch capped CdO NPs shows maximum emission at 545 nm. Finally, toxic test was performed with E.coli bacteria and their results were investigated. Hence, starch capped ZnO NPs induced less killing effect when compared with starch capped CdO NPs. Therefore, we conclude that the starch capped ZnO NPs may be less toxic to microorganisms when compared with starch capped CdO NPs. In addition, starch capped ZnO NPs is also suitable for anti-microbial activity.

  19. Multifunctional PLGA particles containing poly(l-glutamic acid)-capped silver nanoparticles and ascorbic acid with simultaneous antioxidative and prolonged antimicrobial activity.

    Science.gov (United States)

    Stevanović, Magdalena; Bračko, Ines; Milenković, Marina; Filipović, Nenad; Nunić, Jana; Filipič, Metka; Uskoković, Dragan P

    2014-01-01

    A water-soluble antioxidant (ascorbic acid, vitamin C) was encapsulated together with poly(l-glutamic acid)-capped silver nanoparticles (AgNpPGA) within a poly(lactide-co-glycolide) (PLGA) polymeric matrix and their synergistic effects were studied. The PLGA/AgNpPGA/ascorbic acid particles synthesized by a physicochemical method with solvent/non-solvent systems are spherical, have a mean diameter of 775 nm and a narrow size distribution with a polydispersity index of 0.158. The encapsulation efficiency of AgNpPGA/ascorbic acid within PLGA was determined to be >90%. The entire amount of encapsulated ascorbic acid was released in 68 days, and the entire amount of AgNpPGAs was released in 87 days of degradation. The influence of PLGA/AgNpPGA/ascorbic acid on cell viability, generation of reactive oxygen species (ROS) in HepG2 cells, as well as antimicrobial activity against seven different pathogens was investigated. The 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay indicated good biocompatibility of these PLGA/AgNpPGA/ascorbic acid particles. We measured the kinetics of ROS formation in HepG2 cells by a DCFH-DA assay, and found that PLGA/AgNpPGA/ascorbic acid caused a significant decrease in DCF fluorescence intensity, which was 2-fold lower than that in control cells after a 5h exposure. This indicates that the PLGA/AgNpPGA/ascorbic acid microspheres either act as scavengers of intracellular ROS and/or reduce their formation. Also, the results of antimicrobial activity of PLGA/AgNpPGA/ascorbic acid obtained by the broth microdilution method showed superior and extended activity of these particles. The samples were characterized using Fourier transform infrared spectroscopy, field-emission scanning electron microscopy, transmission electron microscopy, zeta potential and particle size analysis. This paper presents a new approach to the treatment of infection that at the same time offers a very pronounced antioxidant effect. Copyright © 2013 Acta

  20. Sensitivity enhancement in the colorimetric detection of lead(II) ion using gallic acid-capped gold nanoparticles: improving size distribution and minimizing interparticle repulsion.

    Science.gov (United States)

    Huang, Kuan-Wei; Yu, Cheng-Ju; Tseng, Wei-Lung

    2010-01-15

    We have developed a colorimetric assay for the highly sensitive and selective detection of Pb(2+) by narrowing the size distribution of gallic acid-capped gold nanoparticles (GA-AuNPs) and minimizing electrostatic repulsion between each GA-AuNP. We unveil that the particle size and size distribution of GA-AuNPs could be controlled by varying the pH of HAuCl(4) with fixed concentrations of HAuCl(4) and GA. When the pH of the precursor solution (i.e., HAuCl(4)) was adjusted from 2.2 to 11.1, the average diameter of GA-AuNPs was decreased from 75.1 nm to 9.3 nm and their size distribution was reduced from 56.6-93.6 nm to 9.0-9.6 nm. The colorimetric sensitivity of the Pb(2+)-induced aggregation of GA-AuNPs could be improved using narrow size distribution of GA-AuNPs. Moreover, further enhancement of the colorimetric sensitivity of GA-AuNPs toward Pb(2+) could be achieved by adding NaClO(4) to minimize electrostatic repulsion between GA-AuNPs, which provide a small energy barrier for Pb(2+) to overcome. Under the optimum conditions (1.0 mM NaClO(4) and 20 mM formic acid at pH 4.5), the selectivity of 9.3 nm GA-AuNPs for Pb(2+) over other metal ions in aqueous solutions is remarkably high, and its minimum detectable concentration for Pb(2+) is 10nM. We demonstrate the practicality of 9.3 nm GA-AuNPs for the determination of Pb(2+) in drinking water. This approach offers several advantages, including simplicity (without temperature control), low cost (no enzyme or DNA), high sensitivity, high selectivity, and a large linear range (10.0-1000.0 nM). Copyright 2009 Elsevier B.V. All rights reserved.

  1. Enriching The Metadata On CDS

    CERN Document Server

    Chhibber, Nalin

    2014-01-01

    The project report revolves around the open source software package called Invenio. It provides the tools for management of digital assets in a repository and drives CERN Document Server. Primary objective is to enhance the existing metadata in CDS with data from other libraries. An implicit part of this task is to manage disambiguation (within incoming data), removal of multiple entries and handle replications between new and existing records. All such elements and their corresponding changes are integrated within Invenio to make the upgraded metadata available on the CDS. Latter part of the report discuss some changes related to the Invenio code-base itself.

  2. X-ray Reflectivity Studies on the Mixed Langmuir-Blodgett Monolayers of Thiol-Capped Gold Nanoparticles, Dipalmitoylphosphatidylcholine, and Sodium Dodecyl Sulfate.

    Science.gov (United States)

    Chen, Yi-Tang; Su, Han-Shiou; Hung, Chin-Hua; Yang, Po-Wei; Hu, Yuan; Lin, Tsang-Lang; Lee, Ming-Tao; Jeng, U-Ser

    2017-10-17

    Langmuir-Blodgett monolayers of thiolated gold nanoparticles mixed with dipalmitoylphosphatidylcholine/sodium dodecyl sulfate (DPPC/SDS) were investigated by combining the X-ray reflectivity, grazing-incident scattering, and TEM analyses to reveal the in-depth and in-plane organization and the 2D morphology of such mixed monolayers. It was found that the addition of a charged single-tail surfactant to the thiolated Au nanoparticle monolayer helps to stabilize the Au nanoparticle monolayer and to strengthen the mechanical property of the mixed monolayer film. For mixing with lipids, it was found that the thiolated gold nanoparticles could be pushed on top of the lipid monolayer when the mixed monolayer is compressed. At a typical comparable total surface area ratio of gold nanoparticle to lipid, the thiolated gold nanoparticles could form a uniform domain on top of the DPPC monolayer. When there are more thiolated gold nanoparticles than that could be supported by the lipid monolayer, domain overlapping could occur to form bilayer gold nanoparticle domains at some regions. At low total surface area ratio of thiolated gold nanoparticle to lipid, the thiolated gold nanoparticles tend to form a connected threadlike aggregation structure. Evidently, the morphology of the thiolated gold nanoparticle monolayer is highly depending on the total surface area ratio of the thiolated gold nanoparticle to lipid. SDS is found to have a dispersion power capable of dispersing the originally uniform Au-8C nanoparticle domain of the mixed Au-8C/DPPC monolayer into a foamlike structure for the mixed Au-8C/SDS/DPPC monolayer. It is evident that not only the concentration ratio but also the size and shape of the template formed by the amphiphilic molecules and their interaction with the thiolated gold nanoparticles can all have great effects on the organizational structure as well as morphology of the thiolated gold nanoparticle monolayer.

  3. Biomaterials supported CdS nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Balu, Alina M. [Institute of Physical Chemistry ' Ilie Murgulescu' , Spl. Independentei 202, 060021 Bucharest (Romania); Departamento de Quimica Organica, Campus de Rabanales, Edificio Marie Curie, Ctra Nnal IV, Km 396, Universidad de Cordoba, E-14014 Cordoba (Spain); Campelo, Juan M. [Departamento de Quimica Organica, Campus de Rabanales, Edificio Marie Curie, Ctra Nnal IV, Km 396, Universidad de Cordoba, E-14014 Cordoba (Spain); Luque, Rafael, E-mail: q62alsor@uco.es [Departamento de Quimica Organica, Campus de Rabanales, Edificio Marie Curie, Ctra Nnal IV, Km 396, Universidad de Cordoba, E-14014 Cordoba (Spain); Rajabi, Fatemeh [Department of Science, Payame Noor University, PO Box 878, Qazvin (Iran, Islamic Republic of); Romero, Antonio A. [Departamento de Quimica Organica, Campus de Rabanales, Edificio Marie Curie, Ctra Nnal IV, Km 396, Universidad de Cordoba, E-14014 Cordoba (Spain)

    2010-11-01

    CdS quantum dot materials were prepared through a simple room temperature deposition of CdS nanocrystals on biomaterials including starch and chitosan. Materials obtained were found to contain differently distributed CdS nanocrystals on the surface of the biopolymers, making them potentially interesting for biomedical applications as contrast agents and/or in photocatalysis.

  4. Triangular CdS nanostructure: effect of Mn doping on photoluminescence, electron spin resonance, and magneto-optical properties

    Science.gov (United States)

    Jadhav, Punam A.; Panmand, Rajendra P.; Patil, Deepak R.; Fouad, H.; Gosavi, Suresh W.; Kale, Bharat B.

    2017-06-01

    In this paper, we report synthesis and study of magneto-optic Faraday effect for dilute magnetic semiconductor nanostructure. The colloidal CdS nanocrystals were prepared via hot injection method and successfully doped with Mn2+ cations. The synthesized nanoparticles were characterized by using UV-Vis spectroscopy, X-ray diffraction, photoluminescence spectroscopy, transmission electron microscopy, and electron spin resonance spectroscopy. Systematic studies on effect of Mn2+ doping on photoluminescence, electron spin resonance, and magneto-optical properties are carried out. UV-Vis spectral analysis confirms blue shift in bandgap of CdS nanoparticles due to quantum confinement effect. The X-ray diffraction study confirms hexagonal wurtzite phase formation of CdS nanoparticles without any impurity phases. TEM analysis confirms uniform particle size, having particle size distribution around 5 nm. As-synthesized undoped CdS shows triangular-shaped nanocrystals with hexagonal structure; however, triangular shape of CdS nanoparticles is not conserved after Mn2+ doping. The photoluminescence characteristic spectra of Mn2+-doped CdS nanocrystals showed emission band at 660 nm and its intensity was found to increase with increasing Mn2+ concentration. Electron spin resonance signal, with six-line hyperfine structure splitting, confirmed doping of Mn2+ ions in CdS lattice. Magneto-optic measurements showed linear variation of Faraday rotation with respect to applied magnetic field, indicating paramagnetic behavior of Mn-doped CdS. The highest Verdet constant 24.81 deg/T cm was observed for 2% Mn-doped CdS nanocrystals, which further decreases with increasing Mn2+ concentration.

  5. A Tunable Photoluminescent Composite of Cellulose Nanofibrils and CdS Quantum Dots

    Directory of Open Access Journals (Sweden)

    Qinwen Wang

    2016-09-01

    Full Text Available The preparation of fluorescent nanocomposite materials with tunable emission wavelengths by combining cellulose nanofibrils (CNFs with inorganic nanoparticles is important for promoting CNFs applications. A CNF/CdS nanocomposite was prepared via in situ compositing at room temperature on oxidized CNFs with CdS quantum dots. By controlling the –COOH/Cd2+ ratio on the CNF, the feeding time of Na2S and the ultrasonic maturing time, the size of the CdS quantum dots on the CNF surface could be adjusted so that to obtain the CNF/CdS nanocomposite material with different fluorescent colors. The results indicated that the CdS particles quantized were evenly distributed on the CNF. The maximum average size of the CdS nanoparticles glowed red under the excitation of UV light was 5.34 nm, which could be obtained with a –COOH/Cd2+ ratio of 1.0, a Na2S feeding time of 20 min, and an ultrasonic maturing time of 60 min. A series of CNF/CdS nanocomposite materials were obtained with CdS nanoparticle sizes varying from 3.44 nm to 5.34 nm, the emission wavelength of which varied from 546 nm to 655 nm, and their fluorescence color changed from green to yellow to red. This is the first time the fluorescence-tunable effect of the CNF/CdS nanocomposite has been realized.

  6. Unraveling the core-shell structure of ligand-capped Sn/SnOx nanoparticles by surface-enhanced nuclear magnetic resonance, Mössbauer, and X-ray absorption spectroscopies.

    Science.gov (United States)

    Protesescu, Loredana; Rossini, Aaron J; Kriegner, Dominik; Valla, Maxence; de Kergommeaux, Antoine; Walter, Marc; Kravchyk, Kostiantyn V; Nachtegaal, Maarten; Stangl, Julian; Malaman, Bernard; Reiss, Peter; Lesage, Anne; Emsley, Lyndon; Copéret, Christophe; Kovalenko, Maksym V

    2014-03-25

    A particularly difficult challenge in the chemistry of nanomaterials is the detailed structural and chemical analysis of multicomponent nano-objects. This is especially true for the determination of spatially resolved information. In this study, we demonstrate that dynamic nuclear polarization surface-enhanced solid-state NMR spectroscopy (DNP-SENS), which provides selective and enhanced NMR signal collection from the (near) surface regions of a sample, can be used to resolve the core-shell structure of a nanoparticle. Li-ion anode materials, monodisperse 10-20 nm large tin nanoparticles covered with a ∼3 nm thick layer of native oxides, were used in this case study. DNP-SENS selectively enhanced the weak 119Sn NMR signal of the amorphous surface SnO2 layer. Mössbauer and X-ray absorption spectroscopies identified a subsurface SnO phase and quantified the atomic fractions of both oxides. Finally, temperature-dependent X-ray diffraction measurements were used to probe the metallic β-Sn core and indicated that even after 8 months of storage at 255 K there are no signs of conversion of the metallic β-Sn core into a brittle semiconducting α-phase, a phase transition which normally occurs in bulk tin at 286 K (13 °C). Taken together, these results indicate that Sn/SnOx nanoparticles have core/shell1/shell2 structure of Sn/SnO/SnO2 phases. The study suggests that DNP-SENS experiments can be carried on many types of uniform colloidal nanomaterials containing NMR-active nuclei, in the presence of either hydrophilic (ion-capped surfaces) or hydrophobic (capping ligands with long hydrocarbon chains) surface functionalities.

  7. Synthesis of ultra-small cysteine-capped gold nanoparticles by pH switching of the Au(I)-cysteine polymer.

    Science.gov (United States)

    Cappellari, Paula S; Buceta, David; Morales, Gustavo M; Barbero, Cesar A; Sergio Moreno, M; Giovanetti, Lisandro J; Ramallo-López, José Martín; Requejo, Felix G; Craievich, Aldo F; Planes, Gabriel A

    2015-03-01

    We report a synthetic approach for the production of ultra-small (0.6 nm) gold nanoparticles soluble in water with a precise control of the nanoparticle size. Our synthetic approach utilizes a pH-depending Au-cysteine polymer as a quencher for the AuNPs grown. The method extends the synthetic capabilities of nanoparticles with sizes down to 1 nm. In addition to the strict pH control, the existence of free -SH groups present in the mixture of reaction has been observed as a key requirement for the synthesis of small nanoparticles in mild conditions. UV-Vis, SAXS, XANES, EXAFS and HR-TEM, has been used to determinate the particle size, characterization of the gold precursor and gold-cysteine interaction. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. Characterization and in vitro studies on anticancer, antioxidant activity against colon cancer cell line of gold nanoparticles capped with Cassia tora SM leaf extract

    Science.gov (United States)

    Abel, Ezra Elumalai; John Poonga, Preetam Raj; Panicker, Shirly George

    2016-01-01

    This study was aimed to determine the effectiveness of synthesized gold nanoparticles of an ethnobotanically and medicinally important plant species Cassia tora against colon cancer cells and to find its antibacterial and antioxidant activities. In order to improve the bioavailability of C. tora, we synthesized gold nanoparticles through green synthesis, by simple mixing and stirring of C. tora leaf powder and tetrachloroauric acid (HAuCl4) solution which gave a dispersion of gold nanoparticles conjugate with C. tora secondary metabolites (SMs) with characteristic surface plasmon resonance. It was characterized by Fourier transform infrared spectroscopy, zeta sizer, zeta potential and transmission electron microscopy. Antibacterial activity was carried out for gold nanoparticles conjugated with C. tora SMs, using well-diffusion method. The MTT assay for cell viability and markers such as catalase, nitric oxide and lipid peroxidation was predictable to confirm the cytotoxicity and antioxidant properties. The treatment of gold nanoparticles conjugated with C. tora SMs on Col320 cells showed reduction in the cell viability through MTT assay, and it also significantly suppressed the release of H2O2, LPO and NO production in a dose-dependent manner. C. tora SMs conjugate gold nanoparticles showed enhanced bioavailability, antioxidant and anticancer effect against colon cancer cell line (Col320).

  9. SYNTHESIS AND CHARACTERIZATION OF CdS IN DIOL VANILIN LIQUID CRYSTAL MONOMER

    Directory of Open Access Journals (Sweden)

    H. L. Lee

    2010-06-01

    Full Text Available Nanocomposites comprising diol-vanilin and cadmium sulfide (CdS has been synthesized via chemical precipitation method in ethanol at refluxed temperature (160 oC for 12 hours. CdCl2. 2.5H2O and thiourea as cadmium and sulfide precursors respectively were employed. Diol vanilin is a thermotropic liquid crystal monomer which exhibits enantiotropic nematic metaphase texture when observed under polarizing microscope and confirmed by DSC thermal stability study. A series of different mass composition  of diol vanilin and CdS nanocomposites ranging from  0.1:1.0 till 1.0:1.0(w/w were prepared and characterized using XRD, TEM, SEM-EDX, POM and DSC. The X-ray diffraction pattern (XRD showed broad peaks due to the formation of cubic CdS nanoparticles in diol vanilin matrix. The nanocomposites at low mass composition  of CdS still maintained their nematic phase. However, the liquid crystal property was affected when the mass  composition  of CdS in nanocomposite was increased and the liquid crystal characteristic vanished when the mass composition  was at 0.6:1.0. .    Keywords: CdS, diol vanilin, thermotropic liquid crystal, nanocomposite.

  10. Ionic liquid-assisted synthesis, structural characterization, and photocatalytic performance of CdS nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Yao Kaisheng [College of Chemistry and Chemical Engineering, Lanzhou University, Lanzhou, Gansu 730000 (China); School of Chemical Engineering and Pharmaceutics, Henan University of Science and Technology, Luoyang, Henan 471003 (China); Lu Weiwei [School of Chemical Engineering and Pharmaceutics, Henan University of Science and Technology, Luoyang, Henan 471003 (China); Wang Jianji, E-mail: jwang@henannu.edu.cn [School of Chemistry and Environmental Sciences, Key Laboratory of Green Chemical Media and Reactions, Ministry of Education, Henan Normal University, Xinxiang, Henan 453007 (China)

    2011-11-01

    Highlights: {yields} Short nanorods, quasi-nanospheres and faceted CdS NPs were prepared with the assistance of an IL. {yields} The CdS samples show hexagonal phase structures. {yields} Shape, size and crystallinity of the products could be controllably synthesized. {yields} The samples demonstrated a highly photocatalytic activity in the degradation of methyl orange. - Abstract: With the assistance of the ionic liquid trihexyl(tetradecyl)phosphonium bis(2,4,4-trimethylpentylphosphinate), we have successfully synthesized short nanorods, quasi-nanospheres and faceted CdS nanoparticles via thermal decomposition of cadmium diethyldithiocarbamate complexes. It was shown that the shape, size and crystallinity of the products could be controlled through delicate regulation of the reaction temperature, monomer concentration, reaction time, and ionic liquid ratio. We found that higher temperature was beneficial to the good crystallinity, while the lower temperature and higher monomer concentration were in favor of anisotropic structures. The used ionic liquid contributed to the formation of hexagonal phase CdS nanocrystals, and its ratio played an important role in determining the ultimate morphology of products. The possible mechanism for the formation CdS nanocrystals was proposed. Furthermore, the as-prepared CdS samples demonstrated a highly photocatalytic activity in the degradation of methyl orange under visible light irradiation.

  11. A configurable CDS for the production laboratory

    CERN Document Server

    Meek, Irish

    2003-01-01

    Various aspects of a configurable chromatography data system (CDS) for the production laboratory are discussed. The Atlas CDS can be configured extensively to fit the production laboratory work flow and meet the needs of analysts. The CDS can also be configured to automatically create a sample sequence with the required number of injections and download methods to the dedicated instrument. The Atlas Quick Start wizard offers uses quick way of generating a sequence from a predefined template and starting a run. (Edited abstract).

  12. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >gnl|CMER|CMP119C GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate synthase... (dhbp synthase) MFQCVPARVSWSVSGVHARRQLASNFLGRRNYFKIIGTMKNLSLMRGALAQSAGDGTAAERAPGATPAPAPAA

  13. Water-driven stabilization of cadmium sulphide nanoparticles

    Science.gov (United States)

    Goswami, Navendu; Sen, P.

    2017-12-01

    Water driven stabilization of cadmium sulphide (CdS) nanoparticles, synthesized through a novel and facile electro-explosion of wire (EEW) technique, is reported by us. The transformation of prepared material was visually evident; as greenish black colour of the colloidal as well as the powder particles, obtained just after the synthesis, changed to orange colour after one month. Cubic Hawleyite phase CdS nanoparticles with 2.3-13.4 nm average crystallite size were ascertained by XRD analysis. HRTEM and AFM analysis collectively confirmed the formation of stable CdS nanoparticles. The crucial S-H vibrational mode, a signature interaction of CdS nanoparticles with surrounding water molecules, was revealed by FTIR analysis. The composition of prepared nanoparticles was accessed through XPS analysis. Not only structural but optical properties of nanoparticles also altered due to aging of nanoparticles. Enhanced band gap of CdS nanoparticles and gradual prominence of absorption energy with aging were demonstrated through UV-vis analysis. Complementary to this, PL spectroscopic analysis revealed the photophysics of CdS nanoparticles by providing details of radiative recombination channels. Thus, intricacies of CdS nanoparticles stabilization in aqueous environment were unravelled on the basis of variations in crystallinity, local chemical environment, alterations in electronic structure and optical processes occurring therein.

  14. Antimicrobial activity of spherical silver nanoparticles prepared using a biocompatible macromolecular capping agent: evidence for induction of a greatly prolonged bacterial lag phase

    Science.gov (United States)

    We have evaluated the antimicrobial properties of Ag-based nanoparticles (Np) using two solid platform-based bioassays and found that 10-20 uL of 0.3-3 uM keratin-based Nps (depending on the starting bacteria concentration = CI) completely inhibited the growth of an equivalent volume of ca. 1,000 to...

  15. In-situ synthesis of high stable CdS quantum dots and their application for photocatalytic degradation of dyes

    Science.gov (United States)

    Samadi-Maybodi, Abdolraouf; Sadeghi-Maleki, Mohammad-Rasool

    2016-01-01

    Photocatalysis based on semiconductor quantum dots, which utilize the solar energy can be used for elimination of pollutants from aqueous media and applied for water purification. In this paper, high stable CdS quantum dots (QDs) with good optical properties were successfully synthesized in a facile in-situ method, using Na2S2O3 as precursor and thioglycolic acid (TGA) as a catalyst, as well as capping agent in aqueous media. The synthesis process was optimized with a 2IV7-3 fractional factorial design method. Then, we studied the degradation of some industrial dyes including: alizarin, acid violet, mordant red and thymol blue as a tool to check the photocatalytic activity of synthesized CdS QDs. Results specified that the synthesized CdS QDs are capable for degradation of organic dyes under visible light irradiation with good recycling stability during photocatalytic experiments. Structural and spectroscopic properties of the synthesized CdS QDs were studied by TEM, XRD and absorption and fluorescence spectroscopy techniques. The synthesized TGA-capped CdS QDs have sizes in the range of 2.65-2.93 nm with cubic crystalline structures.

  16. Biosynthesis of luminescent CdS quantum dots using plant hairy root culture

    Science.gov (United States)

    Borovaya, Mariya N.; Naumenko, Antonina P.; Matvieieva, Nadia A.; Blume, Yaroslav B.; Yemets, Alla I.

    2014-12-01

    CdS nanoparticles have a great potential for application in chemical research, bioscience and medicine. The aim of this study was to develop an efficient and environmentally-friendly method of plant-based biosynthesis of CdS quantum dots using hairy root culture of Linaria maroccana L. By incubating Linaria root extract with inorganic cadmium sulfate and sodium sulfide we synthesized stable luminescent CdS nanocrystals with absorption peaks for UV-visible spectrometry at 362 nm, 398 nm and 464 nm, and luminescent peaks at 425, 462, 500 nm. Transmission electron microscopy of produced quantum dots revealed their spherical shape with a size predominantly from 5 to 7 nm. Electron diffraction pattern confirmed the wurtzite crystalline structure of synthesized cadmium sulfide quantum dots. These results describe the first successful attempt of quantum dots synthesis using plant extract.

  17. Cradle Cap: Treatment

    Science.gov (United States)

    Cradle cap Treatment Cradle cap usually doesn't require medical treatment. It clears up on its own within a few months. In the meantime, ... care tips can help you control and manage cradle cap. Gently rub your baby's scalp with your fingers ...

  18. Cradle Cap: Treatment

    Science.gov (United States)

    Cradle cap Treatment Cradle cap usually doesn't require medical treatment. It clears up on its own within a few months. In the meantime, wash ... tips can help you control and manage cradle cap. Gently rub your baby's scalp with your fingers ...

  19. The cervical cap.

    Science.gov (United States)

    1988-10-07

    The US Food and Drug Administration has approved marketing of the Prentif cavity-rim cervical cap. This contraceptive device is being distributed in the US and Canada by Cervical Cap Ltd, Los Gatos, California. The Prentif cap is available in 4 sizes: 22, 25, 28, and 31 mm inside diameter, with a length of 1 1/4-1 1/2 inches. In a multicenter trial involving 522 diaphragm users and 581 cap users followed for 2 years, the cap was 82.6% effective and the diaphragm was 83.3% effective in preventing pregnancy. When pregnancies attributable to user failure were excluded, these rates were increased to 93.6% for the cap and 95.4% for the diaphragm. 4% of cap users compared with only 1.7% of diaphragm users in this study developed abnormal Pap smears after 3 months of use; in addition, a higher proportion of cap users became infected with Gardnerella vaginalis and Monilia. Theoretical hazards include toxic shock syndrome and endometriosis due to backflow of menstrual fluids. Cap users are advised to undergo a Pap test after 3 months of use and discontinue cap use if the results are abnormal. The cap should not be used during menstruation. Although the cap can be left in place for up to 48 hours, its position should be checked before and after each episode of intercourse. The cervical cap requires less spermicide than the diaphragm and is not as messy. In addition, it can be left in the vagina twice as long as the diaphragm, without additional spermicide. Since the cap is smaller than the diaphragm and does not cover the vaginal wall, some women find intercourse more pleasurable with this device.

  20. What do we know about speculation in the CDS market?

    NARCIS (Netherlands)

    L. Norden (Lars); K. Radoeva (Kristina)

    2012-01-01

    textabstractWe measure speculation in the CDS market and investigate its determinants. The CDS volume on a firm that exceeds its outstanding debt (= naked CDS) indicates speculation since hedging can be ruled out. Using weekly CDS trading volume data for actively traded U.S. firms during 2008-2012,

  1. Structural and Optical Properties of Core-Shell TiO2/CdS Prepared by Chemical Bath Deposition

    Science.gov (United States)

    Al-Jawad, Selma M. H.

    2017-10-01

    Titanium dioxide (TiO2) nanorod arrays (NRAs) sensitized with cadmium sulfide (CdS) nanoparticles (NPs) were deposited by chemical bath deposition (CBD). TiO2 NRAs were also obtained by using the same method on glass substrates coated with fluorine-doped tin oxide (FTO). The structure of the FTO/TiO2/CdS core-shell was characterized by x-ray diffraction (XRD), atomic force microscopy, scanning electron microscopy, ultraviolet-visible (UV-Vis) absorption spectroscopy, photoluminescence, and photoelectrocatalysis of FTO/TiO2 and FTO/TiO2/CdS. The FTO/TiO2 conformed to anatase and rutile phase structures for different pH values and also with annealing. XRD patterns of the FTO/TiO2/CdS sample exhibited two peaks corresponding to hexagonal (100) and (101) for CdS. Scanning electron micrographs showed nanorod structures for the TiO2 thin films deposited at a pH value equal 0.7. Optical results showed the CdS deposited on nanorod TiO2 exhibited increased absorption ability in the visible light, indicating an increased photocatalytic activity for TiO2/CdS core-shell nanorods in the visible light. When illuminated with a UV-Vis light source, the TiO2/CdS core-shell films displayed high responses. A composite exists between the TiO2 nanostructure and CdS NPs because the film absorbs the incident light located in both the visible and UV-Vis regions. A higher response to UV-Vis light was attained with the use of TiO2 NRAs/CdS NPs films prepared by CBD. This approach offers a technique for fabricating photoelectrodes.

  2. TLC-SERS Plates with a Built-In SERS Layer Consisting of Cap-Shaped Noble Metal Nanoparticles Intended for Environmental Monitoring and Food Safety Assurance

    Directory of Open Access Journals (Sweden)

    H. Takei

    2015-01-01

    Full Text Available We report on a thin layer chromatograph (TLC with a built-in surface enhanced Raman scattering (SERS layer for in-situ identification of chemical species separated by TLC. Our goal is to monitor mixture samples or diluted target molecules suspended in a host material, as happens often in environmental monitoring or detection of food additives. We demonstrate that the TLC-SERS can separate mixture samples and provide in-situ SERS spectra. One sample investigated was a mixture consisting of equal portions of Raman-active chemical species, rhodamine 6 G (R6G, crystal violet (CV, and 1,2-di(4-pyridylethylene (BPE. The three components could be separated and their SERS spectra were obtained from different locations. Another sample was skim milk with a trace amount of melamine. Without development, no characteristic peaks were observed, but after development, a peak was observed at 694 cm−1. Unlike previous TLC-SERS whereby noble metal nanoparticles are added after development of a sample, having a built-in SERS layer greatly facilitates analysis as well as maintaining high uniformity of noble metal nanoparticles.

  3. Improving the Formatting Tools of CDS Invenio

    CERN Document Server

    Caffaro, J; Pu Faltings, Pearl

    2006-01-01

    CDS Invenio is the web-based integrated digital library system developed at CERN. It is a strategical tool that supports the archival and open dissemination of documents produced by CERN researchers. This paper reports on my Master’s thesis work done on BibFormat, a module in CDS Invenio, which formats documents metadata. The goal of this project was to implement a completely new formatting module for CDS Invenio. In this report a strong emphasis is put on the user-centered design of the new BibFormat. The bibliographic formatting process and its requirements are discussed. The task analysis and its resulting interaction model are detailed. The document also shows the implemented user interface of BibFormat and gives the results of the user evaluation of this interface. Finally the results of a small usability study of the formats included in CDS Invenio are discussed.

  4. Managing an Institutional Repository with CDS Invenio

    CERN Document Server

    Robinson, N; Simko, T

    2007-01-01

    CERN has long been committed to the free dissemination of scientific research results and theories. Towards this end, CERN's own institutional repository, the CERN Document Server (CDS) offers access to CERN works and to all related scholarly literature in the HEP domain. Hosting over 500 document collections containing more than 900,000 records, CDS provides access to anything from preprints and articles, to multimedia information such as photographs, movies, posters and brochures. The software that powers this service, CDS Invenio, is distributed freely under the GNU GPL and is currently used in approximately 15 institutions worldwide. In this paper, we discuss the use of CDS Invenio to manage a repository of scientific literature. We outline some of the issues faced during the lifecycle of a document from acquisition, processing and indexing to dissemination. In particular, we focus on the features and technology developed to meet the complexities of managing scientific information in the LHC era of large ...

  5. Loose-fit polypseudorotaxanes constructed from γ-CDs and PHEMA-PPG-PEG-PPG-PHEMA

    Directory of Open Access Journals (Sweden)

    Tao Kong

    2014-10-01

    Full Text Available A pentablock copolymer was prepared via the atom transfer radical polymerization of 2-hydroxyethyl methacrylate (HEMA initiated by 2-bromoisobutyryl end-capped PPO-PEO-PPO as a macroinitiator in DMF. Attaching PHEMA blocks altered the self-assembly process of the pentablock copolymer with γ-CDs in aqueous solution. Before attaching the PHEMA, the macroinitiator was preferentially bent to pass through the inner cavity of γ-CDs to give rise to tight-fit double-chain stranded polypseudorotaxanes (PPRs. After attaching the PHEMA, the resulting pentablock copolymer was single-chain stranded into the interior of γ-CDs to form more stable, loose-fit PPRs. The results of 1H NMR, WXRD, DSC, TGA, 13C CP/MAS NMR and FTIR analyses indicated that γ-CDs can accommodate and slip over PHEMA blocks to randomly distribute along the entire pentablock copolymer chain. This results in unique, single-chain stranded PPRs showing no characteristic channel-type crystal structure.

  6. Dual-Enzyme Characteristics of Polyvinylpyrrolidone-Capped Iridium Nanoparticles and Their Cellular Protective Effect against H2O2-Induced Oxidative Damage.

    Science.gov (United States)

    Su, Hua; Liu, Dan-Dan; Zhao, Meng; Hu, Wei-Liang; Xue, Shan-Shan; Cao, Qian; Le, Xue-Yi; Ji, Liang-Nian; Mao, Zong-Wan

    2015-04-22

    Polyvinylpyrrolidone-stabilized iridium nanoparticles (PVP-IrNPs), synthesized by the facile alcoholic reduction method using abundantly available PVP as protecting agents, were first reported as enzyme mimics showing intrinsic catalase- and peroxidase-like activities. The preparation procedure was much easier and more importantly, kinetic studies found that the catalytic activity of PVP-IrNPs was comparable to previously reported platinum nanoparticles. Transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS) characterization indicated that PVP-IrNPs had the average size of approximately 1.5 nm and mainly consisted of Ir(0) chemical state. The mechanism of PVP-IrNPs' dual-enzyme activities was investigated using XPS, Electron spin resonance (ESR) and cytochrome C-based electron transfer methods. The catalase-like activity was related to the formation of oxidized species Ir(0)@IrO2 upon reaction with H2O2. The peroxidase-like activity originated from their ability acting as electron transfer mediators during the catalysis cycle, without the production of hydroxyl radicals. Interestingly, the protective effect of PVP-IrNPs against H2O2-induced cellular oxidative damage was investigated in an A549 lung cancer cell model and PVP-IrNPs displayed excellent biocompatibility and antioxidant activity. Upon pretreatment of cells with PVP-IrNPs, the intracellular reactive oxygen species (ROS) level in response to H2O2 was decreased and the cell viability increased. This work will facilitate studies on the mechanism and biomedical application of nanomaterials-based enzyme mimic.

  7. Method for removing strongly adsorbed surfactants and capping agents from metal to facilitate their catalytic applications

    Energy Technology Data Exchange (ETDEWEB)

    Adzic, Radoslav R.; Gong, Kuanping; Cai, Yun; Wong, Stanislaus; Koenigsmann, Christopher

    2016-11-08

    A method of synthesizing activated electrocatalyst, preferably having a morphology of a nanostructure, is disclosed. The method includes safely and efficiently removing surfactants and capping agents from the surface of the metal structures. With regard to metal nanoparticles, the method includes synthesis of nanoparticle(s) in polar or non-polar solution with surfactants or capping agents and subsequent activation by CO-adsorption-induced surfactant/capping agent desorption and electrochemical oxidation. The method produces activated macroparticle or nanoparticle electrocatalysts without damaging the surface of the electrocatalyst that includes breaking, increasing particle thickness or increasing the number of low coordination sites.

  8. Synthesis, Characterization, and Investigation of Visible Light Photocatalytic Activity of C Doped TiO2/CdS Core-Shell Nanocomposite

    Directory of Open Access Journals (Sweden)

    Atul B. Lavand

    2015-01-01

    Full Text Available Carbon (C doped TiO2/CdS core-shell nanocomposite (C/TiO2/CdS was synthesized using microemulsion method. Synthesized powder was characterized using X-ray diffraction (XRD, Fourier transform infrared spectroscopy (FTIR, energy dispersive X-ray spectroscopy (EDX, transmission electron microscopy (TEM, and UV-visible spectrophotometery. TEM images reveal that C/TiO2/CdS core-shell heterostructure is successfully prepared with CdS as a core and C doped TiO2 as a shell. UV-visible absorption spectra show that CdS nanoparticles act as a sensitizer and effectively enhance the photoabsorption capacity of C/TiO2/CdS nanocomposite in visible region. Visible light photocatalytic activity of synthesized nanocomposite was evaluated for the degradation of methylene blue. C/TiO2/CdS core-shell nanocomposite exhibits better photocatalytic activity as compared to bare TiO2, CdS, CdS/TiO2, and C doped TiO2.

  9. Photovoltaic performance of P3HT-porphyrin functionalized 1D CdS nanostructured organic inorganic bulk heterojunction hybrid solar cells

    Science.gov (United States)

    Jabeen, Uzma; Adhikari, Tham; Shah, Syed Mujtaba; Pathak, Dinesh; Wagner, Tomas; Nunzi, Jean-Michel

    2017-05-01

    Here we report first time the direct observation of the nucleation and growth process of cadmium sulfide (CdS) nanowires by stirring of CdS nanoparticles. The growth process of CdS nanowires consist of three steps, the growth of CdS particles, nucleation of CdS nanorods and finally the growth of CdS nanowires. This method brings forward a new idea to synthesize nanowires. The X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray (EDAX), ultraviolet-visible (UV-Vis) and photoluminescence (PL) spectra have been provided for the characterization of the as-obtained nanowires. Furthermore, carboxylic functionalize porphyrin was examined as sensitizer for CdS nanowires. The interaction of porphyrin with CdS nanowires was investigated by absorption, infrared, steady state fluorescence spectroscopy and SEM techniques. The hybrid devices were fabricated with organic polymer with different concentration of dyes and the device with optimum concentration 6 × 10-6 M shows the highest efficiency of 0.5% with short-circuit current density 3.10 mA cm-2, open-circuit voltage 0.44 V and fill factor 0.37. Contribution to the topical issue "Materials for Energy harvesting, conversion and storage II (ICOME 2016)", edited by Jean-Michel Nunzi, Rachid Bennacer and Mohammed El Ganaoui

  10. The synthesis of rhodium/carbon dots nanoparticles and its hydrogenation application

    Science.gov (United States)

    Zhang, Jie; Chen, Yao; Tan, Jing; Sang, Haitao; Zhang, Liqun; Yue, Dongmei

    2017-02-01

    Rhodium (Rh) nanoparticles have been widely used as potent hydrogenation catalysts. Herein, a new convenient method has been developed to synthesize rhodium nanoparticles, in which carbon dots (CDs) were used both as stabilizing and reducing agents. The fluorescent CDs were prepared by microwave-assisted heating method using chitosan as raw material and the presences of hydroxyl and carbonyl on the surface of CDs were supported by FTIR spectra. Subsequently, CDs could directly reduce Rh3+ to Rh0 without additional reducing and stabilizing agents by heating Rh3+ with CDs for 1 h at 120 °C. The resulting Rh nanoparticles have an average size of about 2.8 nm and the Rh/CDs nanoparticles also retain the fluorescent property of CDs. The hydrogenation activities of Rh/CDs nanoparticles were investigated. The results demonstrated that the nanoparticles had highly catalytic activity in the hydrogenation reaction of hydroxyl-terminated polybutadiene (HTPB) and hydroxy-terminated butadiene-acrylonitrile (HTBN). Also, the presence of CDs could improve the fluorescent properties of rubbers after hydrogenation.

  11. In situ generated CdS nanostructure induced enhanced photoluminescence from Dy{sup 3+} ions doped dielectric nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Dey, Chirantan; Karmakar, Basudeb [Glass Science and Technology Section, Glass Division, CSIR-Central Glass and Ceramic Research Institute, Kolkata (India)

    2017-08-15

    We report CdS nanostructure induced enhanced photoluminescence (PL) from Dy{sup +3}:CdS co-doped dielectric-nanocomposites synthesized by the conventional melt-quench technique. CdS nanocrystals (NCs) were synthesized as in situ within the dielectric medium and their growth was controlled by heat treatment duration. Nanoparticles were investigated with absorption spectroscopy, X-ray diffraction (XRD), transmission electron microscopy (TEM), field emission scanning electron microscopy (FESEM), and Raman spectroscopy. The experimentally obtained sizes of the NCs are found to increase from 5-11 nm to 50-80 nm. Bandgap enhancement for the carrier confinement was found to alter within the range of 0.20-0.38 eV. Phonon confinement effect has been confirmed by blue shifting of Raman peak for CdS NCs at 303 cm{sup -1}. Enhanced highly intense sharp PL peak at 576 nm was detected, and different parameters associated with the PL enhancement including energy transfer from CdS NCs to Dy{sup 3+} ions have been studied. This PL enhancement was steered by varying CdS NC sizes. Enhanced PL of these nanocomposites finds their potential applications as gain medium in the field of solid state lasers. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  12. Peroxide-Dependent Analyte Conversion by the Heme Prosthetic Group, the Heme Peptide “Microperoxidase-11” and Cytochrome c on Chitosan Capped Gold Nanoparticles Modified Electrodes

    Directory of Open Access Journals (Sweden)

    Frieder W. Scheller

    2012-05-01

    Full Text Available In view of the role ascribed to the peroxidatic activity of degradation products of cytochrome c (cyt c in the processes of apoptosis, we investigate the catalytic potential of heme and of the cyt c derived heme peptide MP-11 to catalyse the cathodic reduction of hydrogen peroxide and to oxidize aromatic compounds. In order to check whether cyt c has an enzymatic activity in the native state where the protein matrix should suppress the inherent peroxidatic activity of its heme prosthetic group, we applied a biocompatible immobilization matrix and very low concentrations of the co-substrate H2O2. The biocatalysts were entrapped on the surface of a glassy carbon electrode in a biocompatible chitosan layer which contained gold nanoparticles. The electrochemical signal for the peroxide reduction is generated by the redox conversion of the heme group, whilst a reaction product of the substrate oxidation is cathodically reduced in the substrate indication. The catalytic efficiency of microperoxidase-11 is sufficient for sensors indicating HRP substrates, e.g., p-aminophenol, paracetamol and catechol, but also the hydroxylation of aniline and dehalogenation of 4-fluoroaniline. The lower limit of detection for p-aminophenol is comparable to previously published papers with different enzyme systems. The peroxidatic activity of cyt c immobilized in the chitosan layer for catechol was found to be below 1 per mill and for p-aminophenol about 3% as compared with that of heme or MP-11.

  13. Shape induced (spherical, sheets and rods) optical and magnetic properties of CdS nanostructures with enhanced photocatalytic activity for photodegradation of methylene blue dye under ultra-violet irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Bilal; Kumar, Sachin; Kumar, Sumeet; Ojha, Animesh K., E-mail: animesh@mnnit.ac.in

    2016-09-15

    CdS nanostructures of different shapes such as, nanoparticles (NPs), nanosheets (NS) and nanorods (NRs) have been synthesized by one step chemical solvothermal method. The synthesized samples were characterized by X-ray diffractometer (XRD), transmission electron microscopy (TEM), photoluminescence (PL) spectroscopy, UV–visible (UV-VIS) spectroscopy, Raman spectroscopy (RS) and vibrating sample magnetometer (VSM) techniques. The effect of shape on optical and magnetic properties of CdS nanostructures was studied. The optical band gap and emission spectra are found to be shape dependent. CdS NRs were found to have high saturation (Ms) magnetization than that of CdS NPs and NS. The role of shape on photocatalytic performance of CdS NPs, NS and NRs was investigated by monitoring the photodegradation of methylene blue (MB) dye under the UV irradiation of wavelength 365 nm. The lower recombination rate of electron-hole pairs and larger surface area as reactive facets for adsorption of MB dye molecules in CdS NS are mainly lead to the better photocatalytic performance of CdS NS compared to NPs and NRs. - Highlights: • Synthesis of CdS nanostructures with different shapes (spherical, rod and sheet) by easy and low cost solvothermal method. • Shape induced optical and magnetic properties of CdS nanostructures have been investigated. • The shapes of nanostructures play an important role for photocatalytic performance of CdS nanostructures.

  14. Synthesis of CdS flower-like hierarchical microspheres as electrode material for electrochemical performance

    Energy Technology Data Exchange (ETDEWEB)

    Kaviyarasu, K., E-mail: Kaviyarasuloyolacollege@gmail.com [UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology Laboratories, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, P O Box 392, Pretoria (South Africa); Nanosciences African Network (NANOAFNET), Materials Research Department (MSD), iThemba LABS-National Research Foundation - NRF, 1 Old Faure Road, 7129, P O Box 722, Somerset West, Western Cape Province (South Africa); Manikandan, E., E-mail: maniphysics@gmail.com [Nanosciences African Network (NANOAFNET), Materials Research Department (MSD), iThemba LABS-National Research Foundation - NRF, 1 Old Faure Road, 7129, P O Box 722, Somerset West, Western Cape Province (South Africa); Central Research Laboratory, Sree Balaji Medical College & Hospital, Bharath University, Chrompet, Chennai, 600044, Tamil Nadu (India); Maaza, M., E-mail: maaza@gmail.com [UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology Laboratories, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, P O Box 392, Pretoria (South Africa); Nanosciences African Network (NANOAFNET), Materials Research Department (MSD), iThemba LABS-National Research Foundation - NRF, 1 Old Faure Road, 7129, P O Box 722, Somerset West, Western Cape Province (South Africa)

    2015-11-05

    We report in this paper, a facile hydrothermal route for the preparation of CdS nanocrystals at room temperature (RT). Composition, structure and morphology of the products were analyzed and characterized by X-ray diffraction (XRD) confirms that the hydrothermal treatment at 180 °C for periods ranging from 0 to 1440 min caused no significant modification of the long range order structure subjected to hydrothermal treatment. From the XRD analysis the diffraction peaks pertaining to 26.75°, 43.89° and 52.34° are attributed to the (111), (220) and (311) planes of cubic zinc blende structure. The Photoluminescence (PL) spectra are dominated by a strong narrow band edge emission tunable in the blue region of the visible spectra indicating the narrow size distribution of CdS nanocrystals. TEM observation shows that the CdS nanocrystals synthesized by hydrothermal synthesis are well dispersed and the average crystallite size was found to be ∼10 nm. The confocal microscopic studies reveal that each flower like spheres is due to Ostwald's ripening with numerous nanoparticles aggregating a surface. - Highlights: • The adjacent particle coalesces together forming spherical particles. • The average crystalline size of CdS nanoparticles was found to be ∼3 nm. • In the case of spherical crystallite, is given by L = 3/4 D. • The CdS nanocrystal exhibits a direct band gap of 2.4 eV. • The microspheres are dispersed with good monodispersity.

  15. Algae mediated synthesis of cadmium sulphide nanoparticles and their application in bioremediation

    Science.gov (United States)

    Prasad Mandal, Ranju; Sekh, Sanoyaz; Sarkar, Neera Sen; Chattopadhyay, Dipankar; De, Swati

    2016-05-01

    The present work is a study on the biological synthesis of cadmium sulphide (CdS) nanoparticles using blue-green algae that is popularly used as a food supplement. This synthesis is unique in the sense that no external sulphur precursor is required, the CdS nanoparticles are synthesized in situ in the algal medium. The CdS nanoparticles thus synthesized are photoluminescent and can act as highly efficient photocatalysts for degradation of the dye pollutant malachite green. Thus the CdS nanoparticles synthesized in situ in the algae conform to the desired criteria of waste water treatment i.e. biosorption of the pollutant and its subsequent degradation. The novelty of this work also lies in its potential for use in bioremediation by conversion of the toxic Cd(II) ion to less toxic CdS nanoparticles within the algal framework.

  16. Simultaneous determination of paracetamol and ascorbic acid using tetraoctylammonium bromide capped gold nanoparticles immobilized on 1,6-hexanedithiol modified Au electrode

    Energy Technology Data Exchange (ETDEWEB)

    Nair, Santhosh S. [Department of Chemistry, Gandhigram Rural University, Gandhigram 624302, Dindigul (India); John, S. Abraham [Department of Chemistry, Gandhigram Rural University, Gandhigram 624302, Dindigul (India)], E-mail: abrajohn@yahoo.co.in; Sagara, Takamasa [Department of Chemistry, Gandhigram Rural University, Gandhigram 624302, Dindigul (India)], E-mail: sagara@nagasaki-u.ac.jp

    2009-11-30

    Tetraoctylammonium bromide stabilized gold nanoparticles (TOAB-AuNPs) attached to 1,6-hexanedithiol (HDT) modified Au electrode was used for the simultaneous determination of paracetamol (PA) and ascorbic acid (AA) at physiological pH. The attachment of TOAB-AuNPs on HDT modified Au surface was confirmed by attenuated total reflectance (ATR)-FT-IR spectroscopy and atomic force microscope (AFM). The ATR-FT-IR spectrum of TOAB-AuNPs attached to the HDT monolayer showed a characteristic stretching modes corresponding to -CH{sub 2} and -CH{sub 3} of TOAB, confirming the immobilization of AuNPs with surface-protecting TOAB ions on the surface of the AuNPs after being attached to HDT modified Au electrode. AFM image showed that the immobilized AuNPs were spherical in shape and densely packed to a film of ca. 7 nm thickness. Interestingly, TOAB-AuNPs modified electrode shifted the oxidation potential of PA towards less positive potential by 70 mV and enhanced its oxidation current twice when compared to bare Au electrode. In addition, the AuNPs modified electrode separated the oxidation potentials of AA and PA by 210 mV, whereas bare Au electrode failed to resolve them. The amperometry current of PA was increased linearly from 1.50 x 10{sup -7} to 1.34 x 10{sup -5} M with a correlation coefficient of 0.9981 and the lowest detection limit was found to be 2.6 nM (S/N = 3). The present method was successfully used to determine the concentration of PA in human blood plasma and commercial drugs.

  17. Role of 5-thio-(2-nitrobenzoic acid)-capped gold nanoparticles in the sensing of chromium(vi): remover and sensor.

    Science.gov (United States)

    Lai, Yi-Jhen; Tseng, Wei-Lung

    2011-07-07

    This study describes a simple, rapid method for sensing Cr(vi) using 5-thio-(2-nitrobenzoic acid) modified gold nanoparticles (TNBA-AuNPs) as a remover for Cr(iii) and as a sensor for Cr(vi). We discovered that TNBA-AuNPs were dispersed in the presence of Cr(vi), whereas Cr(iii) induced the aggregation of TNBA-AuNPs. Due to this phenomenon, TNBA-AuNPs can be used as a sorbent material for the removal of >90% Cr(iii), without removing Cr(vi). After centrifuging a solution containing Cr(iii), Cr(vi), and TNBA-AuNPs, Cr(iii) and Cr(vi) were separately present in the precipitate and supernatant. In other words, TNBA-AuNPs are capable of separating a mixture of Cr(iii) and Cr(vi). The addition of ascorbic acid to the supernatant resulted in a reduction of Cr(vi) to Cr(iii), driving the aggregation of TNBA-AuNPs. The selectivity of this approach is more than 1000-fold for Cr(vi) over other metal ions. The minimum detectable concentration of Cr(vi) was 1 μM using this approach. Inductively coupled plasma mass spectrometry provided an alternative for the quantification of Cr(iii) and Cr(vi) after a mixture of Cr(iii) and Cr(vi) had been separated by TNBA-AuNPs. The applicability of this approach was validated through the analysis of Cr(vi) in environmental water samples.

  18. Synthesis and Characterization of Mercaptoacetic Acid Capped Cadmium Sulphide Quantum Dots.

    Science.gov (United States)

    Wageh, S; Maize, Mai; Donia, A M; Al-Ghamdi, Ahmed A; Umar, Ahmad

    2015-12-01

    This paper reports the facile synthesis and detailed characterization of mercaptoacetic acid capped cadmium sulphide (CdS) quantum dots using various cadmium precursors. The mercaptoacetic acid capped CdS quantum dots were prepared by facile and simple wet chemical method and characterized by several techniques such as energy dispersive spectroscopy (EDS), X-ray diffraction, Fourier transform infrared (FTIR) spectroscopy, UV-vis. spectroscopy, photoluminescence spectroscopy, high-resolution transmission microscopy (HRTEM) and thremogravimetric analysis. The EDS studies revealed that the prepared quantum dots possess higher atomic percentage of sulfur compared to cadmium due to the coordination of thiolate to the quantum dots surfaces. The X-ray and absorption analyses exhibited that the size of quantum dots prepared by cadmium acetate is larger than the quantum dots prepared by cadmium chloride and cadmium nitrate. The increase in size can be attributed to the low stability constant of cadmium acetate in comparison with cadmium chloride and cadmium nitrate. The FTIR and thermogravimetric analysis showed that the nature of capping molecule on the surface of quantum dots are different depending on the cadmium precursors which affect the emission from CdS quantum dots. Photoemission spectroscopy revealed that the emission of quantum dots prepared by cadmium acetate has high intensity band edge emission along with low intensity trapping state emission. However the CdS quantum dots prepared by cadmium chloride and cadmium nitrate produced only trapping state emissions.

  19. Photoluminescent nanocomposite materials based on SBMA copolymer and CdS

    Science.gov (United States)

    Iovu, M.; Enachescu, M.; Culeac, I.; Verlan, V.; Robu, S.; Bojin, D.; Nistor, Iu.; Cojocaru, I.

    2015-02-01

    We present experimental results on copolymer-based nanocomposite made of styrene with butyl methacrylate (SBMA) (1:1) and inorganic semiconductor CdS. Thin film composite samples have been characterized by UV-Vis absorption and photoluminescent spectroscopy, as well as by transmission electron microscopy. Transmission electron microscope (TEM) examination confirms a relatively narrow distribution of CdS nanoclusters in the SBMA matrix, which covers the range 2-10 nm. On the other side, the average CdS particles size estimated from the position of first excitonic peak in the UV-Vis absorption spectrum was found to be 2.8 nm and 4.4 nm for two samples with different duration of thermal treatment, which is in good agreement with photoluminescence (PL) experimental data. The PL spectrum for CdS nanocrystals is dominated by near-band-edge emission. The relatively narrow line width (40-45 nm) of the main PL band suggests the nanoparticles having narrow size distribution. On the other side, relatively low PL emission from surface trap states at longer wavelengths were observed in the region 500-750 nm indicating on recombination on defects. Key words: nanocomposite, polymer matrix, photoluminescence,

  20. Photoacoustic Study of CdS QDs for Application in Quantum-Dot-Sensitized Solar Cells

    Directory of Open Access Journals (Sweden)

    S. Abdallah

    2012-01-01

    Full Text Available The optical properties and photovoltaic characterization of CdS quantum dots sensitized solar cells (QDSSCs were studied. CdS QDs were prepared by the chemical solution deposition (CD technique. Photoacoustic spectroscopy (PA was employed to study the optical properties of the prepared samples. The sizes of the CdS QDs were estimated from transmission electron microscope (TEM micrographs gives radii ranged from 1.57 to 1.92 nm. The current density-voltage (J-V characteristic curves of the assembled QDSSCs were measured. Fluorine doped Tin Oxide (FTO substrates were coated with 20 nm-diameter TiO2 nanoparticles (NPs. Presynthesized colloidal CdS quantum dots of different particles size were deposited on the TiO2-coated substrates using direct adsorption (DA method. The FTO counter electrodes were coated with platinum, while the electroelectrolyte containing I-/I-3 redox species was sandwiched between the two electrodes. The short current density (Jsc and efficiency (η increases as the particle size increases. The values of Jsc increases linearly with increasing the intensities of the sun light which indicates the greater sensitivity of the assembled cells.

  1. Light-emitting structures of CdS nanocrystals in oxidized macroporous silicon

    Energy Technology Data Exchange (ETDEWEB)

    Karachevtseva, L., E-mail: lakar@isp.kiev.ua [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China); V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauki pr., Kyiv 03028 (Ukraine); Kuchmii, S., E-mail: stephan@ukr.net [L. Pisarzhevsky Institute of Physical Chemistry NAS of Ukraine, 31 Nauki pr., Kyiv 03028 (Ukraine); Stroyuk, O., E-mail: alstroyuk@ukr.net [L. Pisarzhevsky Institute of Physical Chemistry NAS of Ukraine, 31 Nauki pr., Kyiv 03028 (Ukraine); Lytvynenko, O., E-mail: lytvole@gmail.com [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauki pr., Kyiv 03028 (Ukraine); Sapelnikova, O., E-mail: e_kolesnik84@mail.ru [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauki pr., Kyiv 03028 (Ukraine); Stronska, O., E-mail: yaschichek@ukr.net [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauki pr., Kyiv 03028 (Ukraine); Bo, Wang, E-mail: bo305@hotmail.com [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China); Kartel, M., E-mail: nikar@kartel.kiev.ua [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China)

    2016-12-01

    Highlights: • Oxidized macroporous silicon substrates enhance the nc-CdS photoluminescence. • The maximal photoluminescence corresponds to a maximum surface electric field. • Substrates decrease the non-radiate recombination on CdS nanocrystals. • The quantum yield increases with time due to evaporation of water molecules. - Abstract: Structured silicon substrates (macroporous silicon) with SiO{sub 2} nanolayers and CdS nanocrystals were proposed to reduce the flow of electrons and recombination outside the nanoparticle layer. It was found that the resonance electron scattering in samples with low concentration of Si−O−Si states transforms into ordinary scattering on ionized impurities for samples with high concentration of Si−O−Si states. The maximal intensity of photoluminescence was measured for a structure with maximum strength of the local electric field at the Si−SiO{sub 2} interface, indicating a significant decrease of non-radiative recombination in CdS nanocoating due to the flow of electrons from the silicon matrix towards the CdS nanocrystal layer. The quantum yield of photoluminescence increases with time due to evaporation of water molecules.

  2. Antimicrobial activity of spherical silver nanoparticles prepared using a biocompatible macromolecular capping agent: evidence for induction of a greatly prolonged bacterial lag phase

    Directory of Open Access Journals (Sweden)

    Gehring Andrew

    2010-12-01

    Full Text Available Abstract Background We have evaluated the antimicrobial properties of Ag-based nanoparticles (Nps using two solid phase bioassays and found that 10-20 μL of 0.3-3 μM keratin-stabilized Nps (depending on the starting bacterial concentration = CI completely inhibited the growth of an equivalent volume of ca. 103 to 104 colony forming units per mL (CFU mL-1 Staphylococcus aureus, Salmonella Typhimurium, or Escherichia coli O157:H7 on solid surfaces. Even after one week at 37°C on solid media, no growth was observed. At lower Np concentrations (= [Np]s, visible colonies were observed but they eventually ceased growing. Results To further study the physiology of this growth inhibition, we repeated these experiments in liquid phase by observing microbial growth via optical density at 590 nm (OD at 37°C in the presence of a [Np] = 0 to 10-6 M. To extract various growth parameters we fit all OD[t] data to a common sigmoidal function which provides measures of the beginning and final OD values, a first-order rate constant (k, as well as the time to calculated 1/2-maximal OD (tm which is a function of CI, k, as well as the microbiological lag time (T. Performing such experiments using a 96-well microtitre plate reader, we found that growth always occurred in solution but tm varied between 7 (controls; CI = 8 × 103 CFU mL-1 and > 20 hrs using either the citrate-([Np] ~ 3 × 10-7 M or keratin-based ([Np] ~ 10-6 M Nps and observed that {∂tm/∂ [Np]}citrate ~ 5 × 107 and {∂tm/∂ [Np]}keratin ~ 107 hr·L mol-1. We also found that there was little effect of Nps on S. aureus growth rates which varied only between k = 1.0 and 1.2 hr-1 (1.1 ± 0.075 hr-1. To test the idea that the Nps were changing the initial concentration (CI of bacteria (i.e., cell death, we performed probabilistic calculations assuming that the perturbations in tm were due to CI alone. We found that such large perturbations in tm could only come about at a CI where the probability

  3. CENTRIFUGE END CAP

    Science.gov (United States)

    Beams, J.W.; Snoddy, L.B.

    1960-08-01

    An end cap for ultra-gas centrifuges is designed to impart or remove angular momentum to or from the gas and to bring the entering gas to the temperature of the gas inside the centrifuge. The end cap is provided with slots or fins for adjusting the temperature and the angular momentum of the entering gas to the temperature and momentum of the gas in the centrifuge and is constructed to introduce both the inner and the peripheral stream into the centrifuge.

  4. High-Sensitive Sensor of Dopamine Based on Photoluminescence Quenching of Hierarchical CdS Spherical Aggregates

    Directory of Open Access Journals (Sweden)

    Binjie Sun

    2012-01-01

    Full Text Available Hierarchical CdS spherical aggregates have been fabricated by an assembling strategy starting from nanoparticles, which opens a general way to obtain hierarchical spherical aggregates of different types of materials. The hierarchical CdS spherical aggregates are of high porosity and high surface area, which give rise to unique photoluminescence properties. The desirable properties we report here will spur further developments of novel dopamine photoluminescence sensors based on the high surface area hierarchical CdS spherical aggregates fabricated with our unique assembling strategy. The novel dopamine photoluminescence sensor has a low detection limit of 1.0×10−8 M, which is much lower than those reported previously.

  5. In situ self-transformation synthesis of g-C3N4-modified CdS heterostructure with enhanced photocatalytic activity

    Science.gov (United States)

    Yu, Huogen; Chen, Fengyun; Chen, Feng; Wang, Xuefei

    2015-12-01

    The fabrication of heterojunction photocatalysts with uniform dispersion and strongly coupling interface is one of the main strategies to improve the photocatalytic activity of semiconductor materials. In this study, the heterostructured g-C3N4/CdS photocatalyst with above features was synthesized via a facile in situ high-temperature self-transformation method by using melamine-CdS composites as the precursor. The results showed that g-C3N4 nanoparticles (5-30 nm) are homogeneously grafted on the CdS surface with closely contacted interfaces, resulting in a greatly improved photocatalytic hydrogen-production performance. When the amount of g-C3N4 was 1 wt%, the resultant g-C3N4/CdS showed the highest hydrogen evolution rate (5303 μmol h-1 g-1), which is significantly higher than the pure CdS by a factor of 2.5 times. Considering the obviously enhanced performance of CdS by loading a very limited g-C3N4 (0.1-5 wt%), a possible photocatalytic mechanism was proposed, namely, the g-C3N4 works as an effective hole-transfer cocatalyst to promote the rapid transfer of photogenerated holes from the CdS surface, causing the effective separation of photogenerated charges in CdS. Our present work can provide some interesting idea for the reasonable design and preparation of other highly efficient heterojunction photocatalysts.

  6. Arabidopsis CDS blastp result: AK068433 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068433 J013156D16 At1g20620.2 catalase 3 (SEN2) almost identical to catalase 3 SP...:Q42547, GI:3123188 from [Arabidopsis thaliana]; identical to catalase 3 (SEN2) mRNA, partial cds GI:3158369 1e-63 ...

  7. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion... ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var. neoforman...-related protein, putative [Cryptococcus ... neoformans var. neoformans JEC21] ref|XP_572234.1| ...

  8. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement protein..., putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative ...

  9. Electrophoretic deposition of CdS coatings and their photocatalytic activities in the degradation of tetracycline antibiotic

    Energy Technology Data Exchange (ETDEWEB)

    Vázquez, A., E-mail: alejandro.lqi@gmail.com [Universidad Autónoma de Nuevo León, Facultad de Ciencias Químicas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico); Hernández-Uresti, D.B., E-mail: ing.dianahdz@gmail.com [Universidad Autónoma de Nuevo León, CICFIM–Facultad de Ciencias Físico Matemáticas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico); Obregón, S. [Universidad Autónoma de Nuevo León, CICFIM–Facultad de Ciencias Físico Matemáticas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico)

    2016-11-15

    Highlights: • CdS photocatalyst was prepared by electrophoretic deposition. • The CdS coating was used in the photodegradation of antibiotics. • O{sub 2}{sup −} and ·OH radicals were responsible for the degradation of tetracycline. - Abstract: The photocatalytic activities of CdS coatings formed by electrophoretic deposition (EPD) were evaluated through the photodegradation of an antibiotic, tetracycline. First, CdS nanoparticles were synthesized under microwave irradiation of aqueous solutions containing the cadmium and sulfur precursors at stoichiometric amounts and by using trisodium citrate as stabilizer. Microwave irradiation was carried out in a conventional microwave oven at 2.45 GHz and 1650 W of nominal power, for 60 s. The CdS nanoparticles were characterized by UV–vis spectrophotometry, photoluminescence and X-ray diffraction. Electrophoretic deposition parameters were 300 mV, 600 mV and 900 mV of applied voltage between aluminum plates separated by 1 cm. The fractal dimensions of the surfaces were evaluated by atomic force microscopy and correlated to the morphological and topographic characteristics of the coatings. The photocatalytic activity of the CdS coatings was investigated by means the photodegradation of the tetracycline antibiotic under simulated sunlight irradiation. According to the results, the photoactivity of the coatings directly depends on the concentration of the precursors and the applied voltage during the deposition. The material obtained at 600 mV showed the best photocatalytic behavior, probably due to its physical properties, such as optimum load and suitable aggregate size.

  10. A Phrygian Cap

    Directory of Open Access Journals (Sweden)

    Marie-Janne S. van Kamp

    2013-08-01

    Full Text Available A Phrygian cap is a congenital anomaly of the gallbladder with an incidence of 4%. It can simulate a mass in the liver during hepatobiliary imaging and is sometimes mistaken for pathology. A Phrygian cap, however, has no pathological significance and normally causes no symptoms. A case will be presented where a Phrygian cap was found by coincidence during surgery. The patient was operated for colon cancer with liver metastasis in segment V. He underwent a simultaneous right hemicolectomy and wedge resection of the liver lesion. During perioperative inspection, a gallbladder with a folded fundus was seen. This deformity was, in retrospective, detected on the preoperative MRI scan. The patient underwent cholecystectomy to make the wedge resection easier to perform. Otherwise, cholecystectomy for a Phrygian cap is only indicated in case of symptoms. Radiographic imaging can be helpful in narrowing the differential diagnosis. To our knowledge, there is no recent literature about the Phrygian cap and its imaging aspects. Nowadays, multiphase MRI, or multiphase CT in case of MRI contraindication, are the first choices of hepatobiliary imaging.

  11. Kalopanacis Cortex extract-capped gold nanoparticles activate NRF2 signaling and ameliorate damage in human neuronal SH-SY5Y cells exposed to oxygen-glucose deprivation and reoxygenation.

    Science.gov (United States)

    Park, Sun Young; Chae, Seon Yeong; Park, Jin Oh; Lee, Kyu Jin; Park, Geuntae

    2017-01-01

    Recently, environment-friendly synthesis of gold nanoparticles (GNPs) has been extensively explored by biologists and chemists. However, significant research is still required to determine whether "eco-friendly" GNPs are beneficial to human health and to elucidate the molecular mechanisms of their effects on human cells. We used human neuronal SH-SY5Y cells to show that treatment with Kalopanacis Cortex extract-capped GNPs (KC-GNs), prepared via an eco-friendly, fast, one-pot synthetic route, protected neuronal cells against oxygen-glucose deprivation/reoxygenation (OGD/R)-induced damage. To prepare GNPs, Kalopanacis Cortex was used without any chemical reducing and stabilizing agents. Ultraviolet-visible spectroscopy showed maximum absorbance at 526 nm owing to KC-GN surface plasmon resonance. Hydrodynamic size (54.02±2.19 nm) and zeta potential (-20.3±0.04 mV) were determined by dynamic light scattering. The average diameter (41.07±3.05 nm) was determined by high-resolution transmission electron microscopy. Energy-dispersive X-ray diffraction spectroscopy and X-ray diffraction confirmed the presence of assembled GNPs. Fourier transform infrared analysis suggested that functional groups such as O-H, C-C, and C-N participated in KC-GN formation. Cell viability assays indicated that KC-GNs restored the viability of OGD/R-treated SH-SY5Y cells. Flow cytometry demonstrated that KC-GNs inhibited the OGD/R-induced reactive oxygen species production and mitochondrial membrane potential disruption. KC-GNs also inhibited the apoptosis of OGD/R-exposed cells. Western blot analysis indicated that the OGD/R-induced cellular apoptosis and simultaneous increases in the expression of cleaved caspase-3, p53, p21, and B-cell lymphoma 2-associated X protein were reversed by KC-GNs. The KC-GN-mediated protection against OGD/R-induced neurotoxicity was diminished by NRF2 and heme oxygenase-1 gene knockdowns. Collectively, these results suggested that KC-GNs exerted strong

  12. Electrophoretic deposition of CdS coatings and their photocatalytic activities in the degradation of tetracycline antibiotic

    Science.gov (United States)

    Vázquez, A.; Hernández-Uresti, D. B.; Obregón, S.

    2016-11-01

    The photocatalytic activities of CdS coatings formed by electrophoretic deposition (EPD) were evaluated through the photodegradation of an antibiotic, tetracycline. First, CdS nanoparticles were synthesized under microwave irradiation of aqueous solutions containing the cadmium and sulfur precursors at stoichiometric amounts and by using trisodium citrate as stabilizer. Microwave irradiation was carried out in a conventional microwave oven at 2.45 GHz and 1650 W of nominal power, for 60 s. The CdS nanoparticles were characterized by UV-vis spectrophotometry, photoluminescence and X-ray diffraction. Electrophoretic deposition parameters were 300 mV, 600 mV and 900 mV of applied voltage between aluminum plates separated by 1 cm. The fractal dimensions of the surfaces were evaluated by atomic force microscopy and correlated to the morphological and topographic characteristics of the coatings. The photocatalytic activity of the CdS coatings was investigated by means the photodegradation of the tetracycline antibiotic under simulated sunlight irradiation. According to the results, the photoactivity of the coatings directly depends on the concentration of the precursors and the applied voltage during the deposition. The material obtained at 600 mV showed the best photocatalytic behavior, probably due to its physical properties, such as optimum load and suitable aggregate size.

  13. Fluorescence Quenching of Dendrimer-Encapsulated CdS Quantum Dots for the Detection of H{sub 2}O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Hyojung; Kim, Hai Dong; Kim, Joohoon [Kyung Hee Un iversity, Seoul (Korea, Republic of)

    2016-02-15

    Hydrogen peroxide (H{sub 2}O{sub 2}) exists in natural environments as a byproduct of various enzymatic and photochemical reactions. Various approaches have been reported for the synthesis of cadmium sulfide (CdS) QDs using dendrimers, which can be categorized mainly into two general approaches. The first approach utilizes dendrimers as capping agents, resulting in the formation of agglomerates of spatially segregated QDs stabilized by multiple dendrimers. We have described the synthesis and characterization of the CdS QDs using G6-NH{sub 2} dendrimers. By controlling the molar ratios (n = Cd2+/G6-NH{sub 2}) between the Cd{sup 2+} ions and G6-NH{sub 2} dendrimers, we synthesized a set of CdS QDs with different structural and optical properties. Importantly, the synthesized CdS QDs exhibited H{sub 2}O{sub 2}-sensitive fluorescence, which can be utilized for the detection of H{sub 2}O{sub 2}. Especially, the CdS QDs with n = 64 displayed a Stern–Volmer relationship between the fluorescence of the CdS QDs and the concentration of H{sub 2}O{sub 2}, as well as the strongest fluorescence among the set of the synthesized CdS QDs. Since core-shell structures of QDs often result in enhanced stability and quantum efficiency of the QDs, we are currently working on core-shell structured QDs prepared using dendrimers to improve their stability and quantum yield compared to the CdS QDs reported in the present study.

  14. Arrays of magnetic nanoparticles capped with alkylamines

    Indian Academy of Sciences (India)

    tive to the length of the surfactant chain (l) in determining the structure of such superlattices has been .... of Pd561Ni3000 and Pd561Ni3000Pd1500 respectively, in agreement with the expected values of 0.842 and 0.695. .... [4] P P Edwards, R L Johnston and C N R Rao in Metal clusters in chemistry edited by P Braunstein,.

  15. Microtubule's conformational cap

    DEFF Research Database (Denmark)

    Chretien, D.; Janosi, I.; Taveau, J.C.

    1999-01-01

    The molecular mechanisms that allow elongation of the unstable microtubule lattice remain unclear. It is usually thought that the GDP-liganded tubulin lattice is capped by a small layer of GTP- or GDP-P(i)-liganded molecules, the so called "GTP-cap". Here, we point-out that the elastic properties...... of the microtubule lattice cause a difference in stability between the elongating tubulin sheet and the completed microtubule wall. The implications of our observations for microtubule structure and dynamics are discussed....

  16. Room temperature synthesis of colloidal platinum nanoparticles

    Indian Academy of Sciences (India)

    Efficient preparation of stable dispersions of platinum nanoparticles from platinous chloride (K2PtCl4) was achieved by simultaneous addition of capping polymer material. The size of platinum nanoparticles was controlled by changing the ratio of concentration of capping polymer material to the concentration of platinum ...

  17. [Capping strategies in RNA viruses].

    Science.gov (United States)

    Bouvet, Mickaël; Ferron, François; Imbert, Isabelle; Gluais, Laure; Selisko, Barbara; Coutard, Bruno; Canard, Bruno; Decroly, Etienne

    2012-04-01

    Most viruses use the mRNA-cap dependent cellular translation machinery to translate their mRNAs into proteins. The addition of a cap structure at the 5' end of mRNA is therefore an essential step for the replication of many virus families. Additionally, the cap protects the viral RNA from degradation by cellular nucleases and prevents viral RNA recognition by innate immunity mechanisms. Viral RNAs acquire their cap structure either by using cellular capping enzymes, by stealing the cap of cellular mRNA in a process named "cap snatching", or using virus-encoded capping enzymes. Many viral enzymes involved in this process have recently been structurally and functionally characterized. These studies have revealed original cap synthesis mechanisms and pave the way towards the development of specific inhibitors bearing antiviral drug potential. © 2012 médecine/sciences – Inserm / SRMS.

  18. Application of CdS quantum dots modified carbon paste electrode for monitoring the process of acetaminophen preparation.

    Science.gov (United States)

    Pasandideh-Nadamani, M; Omrani, A; Sadeghi-Maleki, M R; Samadi-Maybodi, A

    2016-06-01

    In this research article, a novel, selective, and sensitive modified carbon paste electrode (CPE) using CdS quantum dots (QDs) is presented. The highly stable CdS QDs were successfully synthesized in an in situ process using Na2S2O3 as a precursor and thioglycolic acid as a catalyst and capping agent. The synthesis of CdS QDs was studied using X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. The synthesized CdS QDs were used for preparation of a modified carbon paste electrode (CdS/CPE). The electrochemical behavior of the electrode toward p-aminophenol (PAP) and acetaminophen (Ac) was studied, and the results demonstrated that the CdS/CPE exhibited good electrocatalytic performance toward PAP and Ac oxidation. The oxidation peak potential of each analyte in the mixture was well separated. As a result, a selective and reliable method was developed for the determination of PAP and Ac simultaneously without any chemical separations. Application of the fabricated electrode for monitoring the process of Ac preparation from PAP was investigated. The obtained results show that CdS/CPE has satisfactory analytical performance; it could be a kind of attractive and promising nanomaterial-based sensor for process monitoring via the electrochemical approach. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Organic–Inorganic Nanostructure Architecture via Directly Capping Fullerenes onto Quantum Dots

    Directory of Open Access Journals (Sweden)

    Kim Jonggi

    2011-01-01

    Full Text Available Abstract A new form of fullerene-capped CdSe nanoparticles (PCBA-capped CdSe NPs, using carboxylate ligands with [60]fullerene capping groups that provides an effective synthetic methodology to attach fullerenes noncovalently to CdSe, is presented for usage in nanotechnology and photoelectric fields. Interestingly, either the internal charge transfer or the energy transfer in the hybrid material contributes to photoluminescence (PL quenching of the CdSe moieties.

  20. Organic-Inorganic Nanostructure Architecture via Directly Capping Fullerenes onto Quantum Dots.

    Science.gov (United States)

    Lee, Jae Kwan; Kim, Jonggi; Yang, Changduk

    2011-12-01

    A new form of fullerene-capped CdSe nanoparticles (PCBA-capped CdSe NPs), using carboxylate ligands with [60]fullerene capping groups that provides an effective synthetic methodology to attach fullerenes noncovalently to CdSe, is presented for usage in nanotechnology and photoelectric fields. Interestingly, either the internal charge transfer or the energy transfer in the hybrid material contributes to photoluminescence (PL) quenching of the CdSe moieties.

  1. Mining the CDS Collection: A Learning Experience

    Science.gov (United States)

    Ortiz, Patricio F.; Ochsenbein, François

    The experiences gained as a result of the CDS/ESO Datamining project are described in this paper as well as a brief outline of the tools developed (described in Ortiz et al. 1998 and Ortiz, 2000). Important issues about datamining and the exchange of information in the context of the Virtual Observatory are described and discussed, emphasizing the need of consistent meta-information for the exchange of data amongst servers and institutions.

  2. Asymmetric Hybrid Nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Chumanov, George [Clemson Univ., SC (United States)

    2015-11-05

    Hybrid Nanoparticles (AHNs) are rationally-designed multifunctional nanostructures and novel building blocks for the next generation of advanced materials and devices. Nanoscale materials attract considerable interest because of their unusual properties and potential for practical applications. Most of the activity in this field is focused on the synthesis of homogeneous nanoparticles from metals, metal oxides, semiconductors, and polymers. It is well recognized that properties of nanoparticles can be further enhanced if they are made as hybrid structures. This program is concerned with the synthesis, characterization, and application of such hybrid structures termed AHNs. AHNs are composed of a homogeneous core and several caps of different materials deposited on its surface (Fig. 1). Combined properties of the core and the caps as well as new properties that arise from core-cap and cap-cap interactions render AHNs multifunctional. In addition, specific chemical reactivity of the caps enables directional self-assembly of AHNs into complex architectures that are not possible with only spherical nanoparticles.

  3. The Potential Application of Raw Cadmium Sulfide Nanoparticles as CT Photographic Developer.

    Science.gov (United States)

    Wu, Qiang; Huang, Lingxin; Li, Zhan; An, Wenzhen; Liu, Dan; Lin, Jin; Tian, Longlong; Wang, Xinling; Liu, Bo; Qi, Wei; Wu, Wangsuo

    2016-12-01

    With the development of science and technology, new applications about nanoparticles should be explored to achieve full-scale knowledge. Therefore, in this work, the toxicity and potential application of raw cadmium sulfide nanoparticles (CdS) in vivo were further studied through ICP-OES and CTs. Surprisingly, CdS exhibited an excellent photographic property, except for finding the accumulation of CdS in the lungs, liver, spleen, and kidney with a strong dependence on time; it is also found that there were a significant uptake in the pancreas for an obvious CT imaging. And the following investigations showed that the raw CdS could damage the tissues accumulating nanoparticles. Through this work, it can be seen that the raw CdS being modified might be an excellent photographic developer for detecting cancers or other diseases.

  4. Dielectric properties of CdS nanoparticles synthesized by soft ...

    Indian Academy of Sciences (India)

    The frequency-dependent electrical data are analysed in the framework of conductivity and modulus formalisms. The frequency-dependent conductivity spectra obey the power law. Keywords. Cadmium sulphide; chemical synthesis; impedance spectroscopy; dielectric properties. PACS Nos 61.46.Df; 61.46.Hk; 81.07.Wx. 1.

  5. Synthesis and Characterization of Eu3+-Doped CdS Quantum Dots by a Single-Step Aqueous Method.

    Science.gov (United States)

    Zhou, Chunyan; Song, Jiahui; Zhang, Xinguo; Sun, Lu; Zhou, Liya; Huang, Ni; Gan, Yufei; Chen, Mengyang; Zhang, Wei

    2016-04-01

    Eu3+-doped CdS quantum dots (QDs) are successfully synthesized through a straightforward single-pot process in aqueous solution using thioglycolic acid as the capping ligand. The structure, shape, and spectral properties of the QDs are investigated. The obtained CdS:Eu3+ QDs exhibit cubic structures with good crystallinity and approximately sphere-like shapes about 4 nm in diameter. The CdS QDs manifest a broadband emission peak at 600 nm and enhanced Photoluminescence (PL) emission intensity after doping with Eu3+ ions. Given the strong PL intensity and good chromaticity of the sulfide-based QDs, they have potential use in doping rare-earth ions.

  6. nanoparticles

    Science.gov (United States)

    Olive-Méndez, Sion F.; Santillán-Rodríguez, Carlos R.; González-Valenzuela, Ricardo A.; Espinosa-Magaña, Francisco; Matutes-Aquino, José A.

    2014-04-01

    In this work, we present the role of vanadium ions (V+5 and V+3), oxygen vacancies (VO), and interstitial zinc (Zni) to the contribution of specific magnetization for a mixture of ZnO-V2O5 nanoparticles (NPs). Samples were obtained by mechanical milling of dry powders and ethanol-assisted milling for 1 h with a fixed atomic ratio V/Zn?=?5% at. For comparison, pure ZnO samples were also prepared. All samples exhibit a room temperature magnetization ranging from 1.18?×?10-3 to 3.5?×?10-3 emu/gr. Pure ZnO powders (1.34?×?10-3 emu/gr) milled with ethanol exhibit slight increase in magnetization attributed to formation of Zni, while dry milled ZnO powders exhibit a decrease of magnetization due to a reduction of VO concentration. For the ZnO-V2O5 system, dry milled and thermally treated samples under reducing atmosphere exhibit a large paramagnetic component associated to the formation of V2O3 and secondary phases containing V+3 ions; at the same time, an increase of VO is observed with an abrupt fall of magnetization to σ?~?0.7?×?10-3 emu/gr due to segregation of V oxides and formation of secondary phases. As mechanical milling is an aggressive synthesis method, high disorder is induced at the surface of the ZnO NPs, including VO and Zni depending on the chemical environment. Thermal treatment restores partially structural order at the surface of the NPs, thus reducing the amount of Zni at the same time that V2O5 NPs segregate reducing the direct contact with the surface of ZnO NPs. Additional samples were milled for longer time up to 24 h to study the effect of milling on the magnetization; 1-h milled samples have the highest magnetizations. Structural characterization was carried out using X-ray diffraction and transmission electron microscopy. Identification of VO and Zni was carried out with Raman spectra, and energy-dispersive X-ray spectroscopy was used to verify that V did not diffuse into ZnO NPs as well to quantify O/Zn ratios.

  7. Synthesis, structural, optical and photocatalytic properties of CdS/ZnS core/shell nanoparticles

    Science.gov (United States)

    Reddy, Ch. Venkata; Shim, Jaesool; Cho, Migyung

    2017-04-01

    CdS, ZnS and CdS/ZnS core/shell nanoparticles were successfully synthesized via two-step synthesis method. The as-prepared CdS, ZnS and CdS/ZnS core/shell nanoparticles were used to study the structural, morphological, and optical properties by PXRD, TEM, HRTEM, UV-vis spectroscopy, N2 adsorption-desorption, FT-IR, PL and Raman spectroscopy measurements. The XRD pattern confirms the crystal structure of the prepared ZnS, CdS, and CdS/ZnS core/shell nanoparticles. The crystallinity of the as-prepared samples is confirmed by PXRD, TEM and HRTEM analysis. The BET analysis showed that the CdS/ZnS core/shell nanoparticles had larger surface area and pore diameter than CdS and ZnS. The Raman and FT-IR spectra confirm the fundamental vibrational modes of CdS and ZnS respectively. Compared to pure CdS and ZnS, CdS/ZnS core/shell nanoparticles exhibited higher photocatalytic activity for the degradation of methyl orange (MO). The enhancement of photocatalytic activity in the CdS/ZnS core/shell nanoparticles is due to the interface actions between CdS and ZnS, which greatly reduces the recombination of photogenerated electrons-holes pair. The proposed mechanism for degradation of MO dye is discussed in detail.

  8. Enhanced green and orange photoluminescence of nanostructured CdS in glass nanocomposites by energy transfer From Ho3+ and Eu3+ ions

    Science.gov (United States)

    Dey, Chirantan; Karmakar, Basudeb

    2017-01-01

    We report enhanced photoluminescence (PL) of both band edge and trap state emissions in Ho3+ or Eu3+ ion doped CdS (II-VI semiconductor) nanoparticles (NPs) containing glass nanocomposites. These glass nanocomposites were synthesized by the conventional melt-quench technique. The sizes of CdS NPs are found to increase from 5-15 nm to 40-80 nm with the increase in thermal treatment. Band edge emission (green emission, peak around 495 nm) of CdS NPs is controlled by their size and enhanced about three to nine-fold by Ho3+ ions on excitation at 446 nm by a diode laser. Under the same excitation, twelve to fifty-fold enhanced trap state emission (orange and red emissions about 550-900 nm) of CdS NPs is obtained by Eu3+-doping compared to undoped CdS NPs containing glass nanocomposites. The predominant mechanism of PL enhancement is the energy transfer from rare earth ions to CdS NPs. Enhanced PL of these nanocomposites enables their applications in efficient solar concentrators, green and red light emitting component for white light emission devices.

  9. CdS and ZnS quantum dots embedded in hyaluronic acid films

    Energy Technology Data Exchange (ETDEWEB)

    Khachatryan, G.; Khachatryan, K. [Department of Chemistry, Agricultural University, Balicka 122, 30-149 Krakow (Poland); Stobinski, L. [Institute of Physical Chemistry, Polish Academy of Sciences, Kasprzaka 48/52, 01-224 Warsaw (Poland); Faculty of Materials Science and Engineering, Warsaw University of Technology, Woloska 141, 02-507 Warszawa (Poland)], E-mail: lstob@ichf.edu.pl; Tomasik, P.; Fiedorowicz, M. [Department of Chemistry, Agricultural University, Balicka 122, 30-149 Krakow (Poland); Lin, H.M. [Department of Materials Engineering, Tatung University, Taipei 104, Taiwan, ROC (China)

    2009-07-29

    An in situ synthesis of ZnS and CdS quantum dots (QDs) in an aqueous solution of sodium hyaluronate (Hyal) produced foils emitting light on excitation with a UV light. The wavelength of emission was only slightly QDs size and more QDs concentration dependent and reached up to {approx}320 nm in the case of ZnS and {approx}400-450 nm in the case of CdS. Nanoparticles remained as non-agglomerated 10-20 nm nanoclusters. CdS/Hyal and ZnS/Hyal-QDs biocomposites were characterized using photoluminescence (PL), IR spectrometric techniques, and Transmission Electron Microscopy (TEM). The absolute molecular weights, radii of gyration, R{sub g}, and thermodynamic properties of the obtained foils are given. Electric resistivity studies performed for the hyaluronic foil in the 100-1000 V range have revealed that the hyaluronate foil has very weak conducting properties and QDs only insignificantly affect those properties as QDs practically did not interact with the foil. Size exclusion chromatography showed a decrease in the molecular weight of the hyaluronate after generation of QDs in its solution, particularly in the lower molecular fraction of the hyaluronate. The generation of CdS QDs was more destructive for the polysaccharide matrix.

  10. C. pneumoniae CdsL regulates CdsN ATPase activity, and disruption with a peptide mimetic prevents bacterial invasion

    Directory of Open Access Journals (Sweden)

    Chris Blair Stone

    2011-02-01

    Full Text Available Chlamydiae are obligate intracellular pathogens that likely require type III secretion (T3S to invade cells and replicate intracellulary within a cytoplasmic vacuole called an inclusion body. C. pneumoniae possess a YscL ortholog, CdsL, that has been shown to interact with the T3S ATPase (CdsN. In this report we demonstrate that CdsL down-regulates CdsN enzymatic activity in a dose-dependent manner. Using PepScan epitope mapping we identified two separate binding domains to which CdsL binds viz. CdsN 221-229 and CdsN265-270. We confirmed the binding domains using a pull-down assay and showed that GST-CdsN221-270, which encompasses these peptides, co-purified with His-CdsL. Next, we used orthology modeling based on the crystal structure of a T3S ATPase ortholog from E. coli, EscN, to map the binding domains on the predicted three dimensional structure of CdsN. The CdsL binding domains mapped to the catalytic domain of the ATPase, one in the central channel of the ATPase hexamer and one on the outer face. Since peptide mimetics have been used to disrupt essential protein interactions of the chlamydial T3S system and inhibit T3S-mediated invasion of HeLa cells, we hypothesized that if CdsL – CdsN binding is essential for regulating T3S then a CdsN peptide mimetic could be used to potentially block T3S and Chlamydial invasion. Treatment of EBs with a CdsN peptide mimetic inhibited C. pneumoniae invasion into HeLa cells in a dose-dependent fashion. This report represents the first use of Pepscan technology to identify binding domains for specific T3S proteins viz. CdsL on the ATPase, CdsN, and demonstrates that peptide mimetics can be used as anti-virulence factors to block bacterial invasion.

  11. Cradle Cap: Symptoms and Causes

    Science.gov (United States)

    Cradle cap Overview Cradle cap causes crusty or oily scaly patches on a baby's scalp. The condition isn't painful or itchy. But it ... yellow scales that aren't easy to remove. Cradle cap usually clears up on its own in a ...

  12. Designing Smart Charter School Caps

    Science.gov (United States)

    Dillon, Erin

    2010-01-01

    In 2007, Andrew J. Rotherham proposed a new approach to the contentious issue of charter school caps, the statutory limits on charter school growth in place in several states. Rotherham's proposal, termed "smart charter school caps," called for quality sensitive caps that allow the expansion of high-performing charter schools while also…

  13. Modeling Nanotube Caps: The Relationship Between Fullerenes and Caps.

    Science.gov (United States)

    Melle-Franco, Manuel; Brinkmann, Gunnar; Zerbetto, Francesco

    2015-12-24

    We present a novel method to calculate energies of nanotube caps with different levels of accuracy and a comprehensive study of its application to the IPR caps of the (10,0) carbon nanotube. The two most stable caps for (10,0) have 42 atoms, an energy of 8.7 eV, and correspond to sections of the third most abundant fullerene, C84. These caps are isoenergetic with a chemically unstable cap with 40 carbon atoms related to a C80 isomer that is also chemically unstable. Energies for the other caps are between 9.3 and 10 eV. A method to calculate cap energetics with fullerenes with an error less than 3% is also presented.

  14. Polar Cap Patch Dynamics

    Science.gov (United States)

    2013-04-25

    associated with the rotation of the extreme density may in itself lead to a stronger growth of ionospheric irregularities . These irregularities may...continue to grow all the way across the polar cap. The result is more efficient creation of ionospheric irregularities . Title 4: Motion of polar...the cusp ionosphere over Svalbard to investigate the production of decameter scale irregularities in the electron plasma associated with HF radar

  15. Saltstone Clean Cap Formulation

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C

    2005-04-22

    The current operation strategy for using Saltstone Vault 4 to receive 0.2 Ci/gallon salt solution waste involves pouring a clean grout layer over the radioactive grout prior to initiating pour into another cell. This will minimize the radiating surface area and reduce the dose rate at the vault and surrounding area. The Clean Cap will be used to shield about four feet of Saltstone poured into a Z-Area vault cell prior to moving to another cell. The minimum thickness of the Clean Cap layer will be determined by the cesium concentration and resulting dose levels and it is expected to be about one foot thick based on current calculations for 0.1 Ci Saltstone that is produced in the Saltstone process by stabilization of 0.2 Ci salt solution. This report documents experiments performed to identify a formulation for the Clean Cap. Thermal transient calculations, adiabatic temperature rise measurements, pour height, time between pour calculations and shielding calculations were beyond the scope and time limitations of this study. However, data required for shielding calculations (composition and specific gravity) are provided for shielding calculations. The approach used to design a Clean Cap formulation was to produce a slurry from the reference premix (10/45/45 weight percent cement/slag/fly ash) and domestic water that resembled as closely as possible the properties of the Saltstone slurry. In addition, options were investigated that may offer advantages such as less bleed water and less heat generation. The options with less bleed water required addition of dispersants. The options with lower heat contained more fly ash and less slag. A mix containing 10/45/45 weight percent cement/slag/fly ash with a water to premix ratio of 0.60 is recommended for the Clean Cap. Although this mix may generate more than 3 volume percent standing water (bleed water), it has rheological, mixing and flow properties that are similar to previously processed Saltstone. The recommended

  16. Hydrogen-induced electrical and optical switching in Pd capped Pr ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 31; Issue 3 ... Praseodymium nanoparticles; switchable mirror; electrical and optical properties. ... The reversible changes in hydrogen-induced electrical and optical properties of Pd capped Pr nanoparticle layers have been studied as a function of hydrogenation time ...

  17. Direct Z-scheme TiO2/CdS hierarchical photocatalyst for enhanced photocatalytic H2-production activity

    Science.gov (United States)

    Meng, Aiyun; Zhu, Bicheng; Zhong, Bo; Zhang, Liuyang; Cheng, Bei

    2017-11-01

    Photocatalytic H2 evolution, which utilizes solar energy via water splitting, is a promising route to deal with concerns about energy and environment. Herein, a direct Z-scheme TiO2/CdS binary hierarchical photocatalyst was fabricated via a successive ionic layer adsorption and reaction (SILAR) technique, and photocatalytic H2 production was measured afterwards. The as-prepared TiO2/CdS hybrid photocatalyst exhibited noticeably promoted photocatalytic H2-production activity of 51.4 μmol h-1. The enhancement of photocatalytic activity was ascribed to the hierarchical structure, as well as the efficient charge separation and migration from TiO2 nanosheets to CdS nanoparticles (NPs) at their tight contact interfaces. Moreover, the direct Z-scheme photocatalytic reaction mechanism was demonstrated to elucidate the improved photocatalytic performance of TiO2/CdS composite photocatalyst. The photoluminescence (PL) analysis of hydroxyl radicals were conducted to provide clues for the direct Z-scheme mechanism. This work provides a facile route for the construction of redox mediator-free Z-scheme photocatalytic system for photocatalytic water splitting.

  18. Effect of heat treatments in vacuum on CdS thin films prepared by the spray deposition technique

    Energy Technology Data Exchange (ETDEWEB)

    Escosura, L.; Garcia-Camarero, E.; Arjona, F.; Rueda, F.

    1984-04-01

    The effects of short heat treatments in vacuum (10 min at 200-400/sup 0/C) on the electrical, structural and optical properties of hexagonal polycrystalline CdS thin films prepared by the spray deposition technique were studied. It was found that the electrical and structural properties change remarkably under these treatments. However, the optical properties do not vary significantly. The resistivity, in particular, decreased from about 500 ..cap omega.. cm to less then 1 ..cap omega.. for a 300/sup 0/C annealing while the electron mobility increased by two orders of magnitude, a result similar to that reported by Martinuzzi and coworkers. A hexagonal phase was obtained regardless of deposition temperature. The preferential orientation changed when samples were subjected to vacuum annealing at 300/sup 0/C or more, indicating that a recrystallization had taken place in the films.

  19. Synthesis of CdS Nanocrystals by Employing the By-Products of the Anaerobic Respiratory Process of Desulfovibrio alaskensis 6SR Bacteria

    Directory of Open Access Journals (Sweden)

    L. G. Rangel-Chávez

    2015-01-01

    Full Text Available A novel methodology for the direct synthesis of CdS nanoparticles, using a biological agent that avoids the extracellular processing, and the results of the characterization of CdS nanocrystals are presented. The by-products of the anaerobic respiratory process of Desulfovibrio alaskensis 6SR along with aqueous solutions of Cd salts were successfully employed to produce CdS nanocrystals with mixed cubic and hexagonal phases. Nanocrystal size has a narrow size distribution with little dependence on the Cd concentration. Both the presence of the crystallographic cubic phase and the crystalline order decrease as Cd concentration increases. The band gap values obtained from optical transmission measurements are lower than those of the bulk crystal. Raman spectroscopy characterization agrees with electron transmission microscopy images and X-ray diffraction results indicating that the method promotes the formation of high structural quality nanocrystals when low concentrations of the Cd salt are used.

  20. DNA-guided nanoparticle assemblies

    Science.gov (United States)

    Gang, Oleg; Nykypanchuk, Dmytro; Maye, Mathew; van der Lelie, Daniel

    2013-07-16

    In some embodiments, DNA-capped nanoparticles are used to define a degree of crystalline order in assemblies thereof. In some embodiments, thermodynamically reversible and stable body-centered cubic (bcc) structures, with particles occupying nanoparticles linked by nucleic acid sequences and forming an open crystal structure with catalytically active agents attached to the crystal on its surface or in interstices.

  1. Synthesis, Characterization, and Magnetic Properties of Pure and EDTA-Capped NiO Nanosized Particles

    Directory of Open Access Journals (Sweden)

    H. T. Rahal

    2017-01-01

    Full Text Available The effect of ethylenediaminetetraacetic acid (EDTA as a capping agent on the structure, morphology, optical, and magnetic properties of nickel oxide (NiO nanosized particles, synthesized by coprecipitation method, was investigated. Nickel chloride hexahydrate and sodium hydroxide (NaOH were used as precursors. The resultant nanoparticles were characterized by X-ray diffraction (XRD, transmission electron microscopy (TEM, and scanning electron microscopy (SEM. XRD patterns showed that NiO have a face-centered cubic (FCC structure. The crystallite size, estimated by Scherrer formula, has been found in the range of 28–33 nm. It is noticed that EDTA-capped NiO nanoparticles have a smaller size than pure nanoparticles. Thus, the addition of 0.1 M capping agent EDTA can form a nucleation point for nanoparticles growth. The optical and magnetic properties were investigated by Fourier transform infrared spectroscopy (FTIR and UV-vis absorption spectroscopy (UV as well as electron paramagnetic resonance (EPR and magnetization measurements. FTIR spectra indicated the presence of absorption bands in the range of 402–425 cm−1, which is a common feature of NiO. EPR for NiO nanosized particles was measured at room temperature. An EPR line with g factor ≈1.9–2 is detected for NiO nanoparticles, corresponding to Ni2+ ions. The magnetic hysteresis of NiO nanoparticles showed that EDTA capping recovers the surface magnetization of the nanoparticles.

  2. Glutathione-mediated mesoporous carbon as a drug delivery nanocarrier with carbon dots as a cap and fluorescent tracer

    Science.gov (United States)

    Zhang, Yang; Han, Lu; Zhang, Yue; Chang, Yan-Qin; Chen, Xu-Wei; He, Rong-Huan; Shu, Yang; Wang, Jian-Hua

    2016-09-01

    This work describes a novel and general redox-responsive controlled drug delivery-release nanocarrier with mesoporous carbon nanoparticles (MCNs) gated by customized fluorescent carbon dots (CDs). The modification of MCNs with a disulfide unit enables the system to be sensitive to intracellular glutathione (GSH). The CDs anchoring onto the surface of the MCNs via an electrostatic interaction block the mesopores and thus prevent the leakage of doxorubicin (DOX) loaded inside the channel of the MCNs. Upon the addition of GSH at the physiological environment, the integrity of the system is disrupted due to the dissociation of the disulfide bond; meanwhile stripping the CDs opens the gate and thus triggers the rapid release of the encapsulated DOX. The fluorescence of the CDs is quenched/‘turned off’ when linking to the MCNs, while it is restored/‘turned on’ when detaching the CDs from the surface of the MCNs. Thus the fluorescent CDs serve as both a controllable drug release gatekeeper and a fluorescent probe for the visualization of the drug delivery process. By combining these inherent capabilities, the present drug delivery system may be a promising route for designing custom-made visual controlled-release nanodevices specifically governed by in situ stimulus in the cells.

  3. Technical training: CERN Document Server (CDS), Inspire and Library Services

    CERN Multimedia

    IT & GS Departments

    2012-01-01

    A new training course, “CERN Document Server (CDS), Inspire and Library Services”, is available since the beginning of the year. The training course is given by members of CERN’s CDS Team (IT-CIS group) and the Library Services (GIS SIS group) and is intended for all members of personnel of CERN. This course will present CDS and inspirehep.net and the content, scope and scientific information available in or with CDS, as much as the classification and organization of the documents. It is intended to give you the training needed to know how to use CDS most efficiently and in particular covers: the main characteristics and advanced features for the search of documents (scientific, multimedia, etc). the collaborative tools : baskets, alerts, comments, evaluation, etc. the submission of documents in CDS and examples of workflows. An important part of the training is composed of various exercises, designed to acquire practical ability to work with CDS in cases similar to re...

  4. ZnO-CdS core-shell quantum dots sensitized solar cell: influence of crystalline and amorphous CdS structures in photovoltaic performance.

    Science.gov (United States)

    Lim, Iseul; Ganesh, T; Lee, Misun; Lee, Duk-Yun; Cai, Gangri; Kim, Eun-Kyung; Lee, Wonjoo; Han, Sung Hwan

    2011-07-01

    ZnO nanoparticles (NPs) coated with amorphous and crystalline CdS quantum dots (QDs) were successfully synthesized through chemical bath deposition (CBD) process. Scanning electron microscopy (SEM) and X-ray diffraction (XRD) have been utilized to characterize the samples morphology and structural properties. The conduction band of CdS QDs is much higher than the ZnO conduction band facilitates electron transfer process through cascade system. The thickness and crystallinity of the CdS QDs coated on ZnO NPs critically controls the electron diffusion length and photovoltaic performance of the solar cell. The red shift from 506 to 524 nm, increased optical absorption in the UV-visible range and electron diffusion length limited by the thickness of the amorphous/crystalline CdS QDs coated on ZnO NPs film, influences the performance of the QDs sensitized solar cell (QDSSCs) under one sun illumination intensity (AM 1.5, 100 mW/cm2). The results discuss the CBD process controlled growth of CdS QDs on ZnO NPs and its influence on the photovoltaic performance of QDSSCs.

  5. Biosynthesis and Antimicrobial Activity of Semiconductor Nanoparticles against Oral Pathogens

    Science.gov (United States)

    Malarkodi, C.; Rajeshkumar, S.; Paulkumar, K.; Vanaja, M.; Gnanajobitha, G.; Annadurai, G.

    2014-01-01

    Dental care is an essential phenomenon in human health. Oral pathogens can cause severe break which may show the way to serious issues in human disease like blood circulation and coronary disease. In the current study, we demonstrated the synthesis and antimicrobial activity of cadmium sulphide and zinc sulphide nanoparticles against oral pathogens. The process for the synthesis of cadmium sulphide (CdS) and zinc sulphide (ZnS) nanoparticles is fast, novel, and ecofriendly. Formation of cadmium sulphide (CdS) and zinc sulphide (ZnS) nanoparticles was confirmed by surface plasmon spectra using UV-Vis spectrophotometer. The morphology of crystalline phase of nanoparticles was determined from transmission electron microscopy (TEM) and X-ray diffraction (XRD) spectra. The average size of cadmium sulphide (CdS) and zinc sulphide (ZnS) nanoparticles was in the range of 10 nm to 25 nm and 65 nm, respectively, and the observed morphology was spherical. The results indicated that the proteins, which contain amine groups, played a reducing and controlling responsibility during the formation of cadmium sulphide (CdS) and zinc sulphide (ZnS) nanoparticles in the colloidal solution. The antimicrobial activity was assessed against oral pathogens such as Streptococcus sp. Staphylococcus sp. Lactobacillus sp., and Candida albicans and these results confirmed that the sulphide nanoparticles are exhibiting good bactericidal activity. PMID:24860280

  6. Raman studies of surface phonons in CdSe and CdS quantum dots embedded in dielectric media

    Energy Technology Data Exchange (ETDEWEB)

    Azhniuk, Yuriy [Institute of Electron Physics, Uzhhorod (Ukraine); Dzhagan, Volodymyr; Valakh, Mykhailo [Institute of Semiconductor Physics, Kyiv (Ukraine); Kuchmii, Stepan; Raevskaya, Alexandra; Stroyuk, Alexandr [Institute of Physical Chemistry, Kyiv (Ukraine); Zahn, Dietrich [Chemnitz University of Technology, Chemnitz (Germany)

    2007-07-01

    Contribution of surface phonons strongly affects Raman spectra of quantum dots (QDs). In spite of a number of studies for CdSe and CdS, there is still no unique opinion on the behaviour of surface phonon parameters on the QD size. Moreover, since surface phonons are localized near the QD / host matrix interface, they can be sensitive to the type of host media as well as to the shell type for capped QDs. Here we present resonant micro-Raman studies of surface phonons of bare and capped colloidal CdSe and CdS QDs in different organic media (gelatine, polyvinyl alcohol, polyacrylamide) as well as those grown in silicate glass. Measurements were performed using a Dilor XY 800 spectrometer and different Ar laser lines for excitation. The dependences obtained for the surface phonon frequency, halfwidth as well as surface-to-LO phonon intensity ratio on the QD size, excitation wavelength, type of host media, passivating shell are analyzed. The results are compared with the calculations in the framework of a dielectric continuum model. The differences observed can be related to the QD surface reconstruction.

  7. Genetics Home Reference: cap myopathy

    Science.gov (United States)

    ... expand/collapse boxes. Description Cap myopathy is a disorder that primarily affects skeletal muscles , which are muscles that the body uses for ... Ochala J. Thin filament proteins mutations associated with skeletal myopathies: ... in cap disease associated with beta-tropomyosin (TPM2) mutations. Neurology. 2008 ...

  8. Characterization of Photochemical Processes for H2 Production by CdS Nanorod-[FeFe] Hydrogenase Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Brown, K. A.; Wilker, M. B.; Boehm, M.; Dukovic, G.; King, P. W.

    2012-03-28

    We have developed complexes of CdS nanorods capped with 3-mercaptopropionic acid (MPA) and Clostridium acetobutylicum [FeFe]-hydrogenase I (CaI) that photocatalyze reduction of H{sup +} to H{sub 2} at a CaI turnover frequency of 380-900 s{sup -1} and photon conversion efficiencies of up to 20% under illumination at 405 nm. In this paper, we focus on the compositional and mechanistic aspects of CdS:CaI complexes that control the photochemical conversion of solar energy into H{sub 2}. Self-assembly of CdS with CaI was driven by electrostatics, demonstrated as the inhibition of ferredoxin-mediated H{sub 2} evolution by CaI. Production of H{sub 2} by CdS:CaI was observed only under illumination and only in the presence of a sacrificial donor. We explored the effects of the CdS:CaI molar ratio, sacrificial donor concentration, and light intensity on photocatalytic H{sub 2} production, which were interpreted on the basis of contributions to electron transfer, hole transfer, or rate of photon absorption, respectively. Each parameter was found to have pronounced effects on the CdS:CaI photocatalytic activity. Specifically, we found that under 405 nm light at an intensity equivalent to total AM 1.5 solar flux, H{sub 2} production was limited by the rate of photon absorption ({approx}1 ms{sup -1}) and not by the turnover of CaI. Complexes were capable of H{sub 2} production for up to 4 h with a total turnover number of 106 before photocatalytic activity was lost. This loss correlated with inactivation of CaI, resulting from the photo-oxidation of the CdS capping ligand MPA.

  9. Characterization of photochemical processes for H2 production by CdS nanorod-[FeFe] hydrogenase complexes.

    Science.gov (United States)

    Brown, Katherine A; Wilker, Molly B; Boehm, Marko; Dukovic, Gordana; King, Paul W

    2012-03-28

    We have developed complexes of CdS nanorods capped with 3-mercaptopropionic acid (MPA) and Clostridium acetobutylicum [FeFe]-hydrogenase I (CaI) that photocatalyze reduction of H(+) to H(2) at a CaI turnover frequency of 380-900 s(-1) and photon conversion efficiencies of up to 20% under illumination at 405 nm. In this paper, we focus on the compositional and mechanistic aspects of CdS:CaI complexes that control the photochemical conversion of solar energy into H(2). Self-assembly of CdS with CaI was driven by electrostatics, demonstrated as the inhibition of ferredoxin-mediated H(2) evolution by CaI. Production of H(2) by CdS:CaI was observed only under illumination and only in the presence of a sacrificial donor. We explored the effects of the CdS:CaI molar ratio, sacrificial donor concentration, and light intensity on photocatalytic H(2) production, which were interpreted on the basis of contributions to electron transfer, hole transfer, or rate of photon absorption, respectively. Each parameter was found to have pronounced effects on the CdS:CaI photocatalytic activity. Specifically, we found that under 405 nm light at an intensity equivalent to total AM 1.5 solar flux, H(2) production was limited by the rate of photon absorption (~1 ms(-1)) and not by the turnover of CaI. Complexes were capable of H(2) production for up to 4 h with a total turnover number of 10(6) before photocatalytic activity was lost. This loss correlated with inactivation of CaI, resulting from the photo-oxidation of the CdS capping ligand MPA.

  10. Synthesis and Characterization of CDS Nanocrystals with Thermoresponsive Polymer

    Science.gov (United States)

    Alsaleh, Ahmad; Khan, Aslam; Ahamad, Tansir; Alam Khan, M.

    2010-04-01

    This paper reports the synthesis of thermoresponsive colloidal nanocomposites based on CdS and poly(N-isopropylacrylamide) (pNIPAAm). CdS nanocrystals are prepared at room temperature from cadmium chloride and sodium sulfide salts in presence of an organic ligand (3-mercaptopropionic acid) (MPA). As prepared, MPA bound CdS nanocrystals are stable over a month and show good optical properties. The effect of the different ratios of MPA/Cd2+ and H2O/DMF on the resulting particle size of CdS nanocrystals are investigated by UV-Vis absorption measurements. Transmission electron microscopy shows that the particle sizes are about 4 nm, which is in close agreement with the size obtained by UV-Vis spectroscopy.

  11. Ferromagnetism in sphalerite and wurtzite CdS nanostructures.

    Science.gov (United States)

    Yang, Zhaolong; Gao, Daqiang; Zhu, Zhonghua; Zhang, Jing; Shi, Zhenhua; Zhang, Zhipeng; Xue, Desheng

    2013-01-07

    Room-temperature ferromagnetism is observed in undoped sphalerite and wurtzite CdS nanostructures which are synthesized by hydrothermal methods. Scanning electron microscopy and transmission electron microscopy results indicate that the sphalerite CdS samples show a spherical-like shape and the wurtzite CdS ones show a flower-like shape, both of which are aggregated by lots of smaller particles. The impurity of the samples has been ruled out by the results of X-ray diffraction, selected-area electron diffraction, and X-ray photoelectron spectroscopy. Magnetization measurements indicate that all the samples exhibit room-temperature ferromagnetism and the saturation magnetization decreases with the increased crystal sizes, revealing that the observed ferromagnetism is defect-related, which is also confirmed by the post-annealing processes. This finding in CdS should be the focus of future electronic and spintronic devices.

  12. Manganous ion dictated morphology change and ferromagnetism in CdS nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Sambandam, Balaji; Michael, R. Jude Vimal [Indian Institute of Technology, Madras, Department of Chemistry (India); Rajendran, Nalliyan [Anna University, Department of Chemistry (India); Arumugam, Sonachalam [Bharathidasan University, School of Physics, Centre for High Pressure Research (India); Manoharan, Periakaruppan T., E-mail: ptm@iitm.ac.in [Indian Institute of Technology, Madras, Department of Chemistry (India)

    2012-09-15

    We report a simple chemical route for converting the dimorphic CdS nanocrystals into pure hexagonal structure by loading {approx}5 % Mn{sup 2+} into CdS in presence of a surfactant rather than under harsh conditions reported earlier. Differential scanning calorimetric measurement was used to quantify the percentages of cubic and hexagonal components at lower manganese ion loading, which correlated well with the Short and Steward procedure using X-ray diffraction analysis. Annealing of all lower (<5 %) manganese ion-loaded samples transforms the cubic component into its hexagonal form. Systematic variation of manganese ion concentration in the range of 0-5 % helps tune in a new combination of photoluminescence bands, composed of a band edge, surface and manganese d-d emissions. The manganese ions located inside the CdS matrix studied by electron paramagnetic resonance (EPR) reveal progressively changing presence of (i) distorted tetrahedral nature of isolated Mn{sup 2+} and (ii) cluster formation through dipolar and/or exchange coupling arising from Mn{sup 2+}-Mn{sup 2+} interaction. There is a neat correlation between PL and EPR properties on the one hand and between EPR and magnetism on the other. Most important part of this investigation lies in manganese coupled ferromagnetism (FM) as compared to our earlier reported anti-FM-coupled superparamagnetism, the difference originating from the use of different ligands. Pre-annealed (as synthesized) and post-annealed CdS/Mn{sup 2+} nanocrystals exhibit FM of manganese origin, the latter exhibiting increased FM due to annealing promoted migration of manganese ions to form more clusters, as confirmed by magnetization experiments. Electron microscopy reveals the formation of nanorods and nanoparticles.

  13. Photodeposition of Pt on Colloidal CdS and CdSe/CdS Semiconductor Nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Dukovic, Gordana; Merkle, Maxwell G.; Nelson, James H.; Hughes, Steven M.; Alivisatos, A. Paul

    2008-08-06

    colloidal CdS and CdSe/CdS core/shell nanocrystals. Among the II-VI semiconductors, CdS is of particular interest because it has the correct band alignment for water photolysis[2] and has been demonstrated to be photocatalytically active.[11-16] We have found that the photoexcitation of CdS and CdSe/CdS in the presence of an organometallic Pt precursor leads to deposition of Pt nanoparticles on the semiconductor surface. Stark differences are observed in the Pt nanoparticle location on the two substrates, and the photodeposition can be completely inhibited by the modification of the semiconductor surface. Our results suggest that tuning of the semiconductor band structure, spatial organization and surface chemistry should be crucial in the design of photocatalytic nanostructures.

  14. Summer Student Project: Collecting and disseminating CDS KPIs

    CERN Document Server

    Alvarez Perez, Carmen

    2010-01-01

    CDS (CERN Document Server) stores over 900,000 bibliographic records, including 360,000 fulltext documents, of interest to people working in particle physics and related areas. My project consisted on extracting KPIs (Key Performance Indicators) from it and feeding them to a central IT KPI system. To achieve this, I learned the CDS-Invenio open source digital library software, and worked with its statistic module.

  15. Green synthesis of nanoparticles and its potential application.

    Science.gov (United States)

    Hussain, Imtiyaz; Singh, N B; Singh, Ajey; Singh, Himani; Singh, S C

    2016-04-01

    Nanotechnology is a new and emerging technology with wealth of applications. It involves the synthesis and application of materials having one of the dimensions in the range of 1-100 nm. A wide variety of physico-chemical approaches are being used these days for the synthesis of nanoparticles (NPs). However, biogenic reduction of metal precursors to produce corresponding NPs is eco-friendly, less expensive, free of chemical contaminants for medical and biological applications where purity of NPs is of major concern. Biogenic reduction is a "Bottom Up" approach similar to chemical reduction where a reducing agent is replaced by extract of a natural products with inherent stabilizing, growth terminating and capping properties. Furthermore, the nature of biological entities in different concentrations in combination with reducing organic agents influence the size and shape of NPs. Present review focuses on microbes or plants based green synthesis of Ag, Au, Cu, Fe, Pd, Ru, PbS, CdS, CuO, CeO2, Fe3O4, TiO2, and ZnO NPs and their potential applications.

  16. Facile Synthesis of Monodisperse CdS Nanocrystals via Microreaction

    Directory of Open Access Journals (Sweden)

    Zhou Xinggui

    2009-01-01

    Full Text Available Abstract CdS-based nanocrystals (NCs have attracted extensive interest due to their potential application as key luminescent materials for blue and white LEDs. In this research, the continuous synthesis of monodisperse CdS NCs was demonstrated utilizing a capillary microreactor. The enhanced heat and mass transfer in the microreactor was useful to reduce the reaction temperature and residence time to synthesize monodisperse CdS NCs. The superior stability of the microreactor and its continuous operation allowed the investigation of synthesis parameters with high efficiency. Reaction temperature was found to be a key parameter for balancing the reactivity of CdS precursors, while residence time was shown to be an important factor that governs the size and size distribution of the CdS NCs. Furthermore, variation of OA concentration was demonstrated to be a facile tuning mechanism for controlling the size of the CdS NCs. The variation of the volume percentage of OA from 10.5 to 51.2% and the variation of the residence time from 17 to 136 s facilitated the synthesis of monodisperse CdS NCs in the size range of 3.0–5.4 nm, and the NCs produced photoluminescent emissions in the range of 391–463 nm.

  17. Development of Acid-Resistant Alginate/Trimethyl Chitosan Nanoparticles Containing Cationic β-Cyclodextrin Polymers for Insulin Oral Delivery

    OpenAIRE

    Mansourpour, Maryam; Mahjub, Reza; Amini, Mohsen; Ostad, Seyed Naser; Shamsa, Elnaz Sadat; Rafiee- Tehrani, Morteza; Dorkoosh, Farid Abedin

    2015-01-01

    In this study, the use of trimethylchitosan (TMC), by higher solubility in comparison with chitosan, in alginate/chitosan nanoparticles containing cationic β-cyclodextrin polymers (CPβCDs) has been studied, with the aim of increasing insulin uptake by nanoparticles. Firstly, TMCs were synthesized by iodomethane, and CPβCDs were synthesized within a one-step polycondensation reaction using choline chloride (CC) and epichlorohydrine (EP). Insulin–CβCDPs complex was prepared by mixing 1:1 portio...

  18. Mechanochemical Synthesis of Nanocrystalline CdS in a Laboratory and Industrial Mill

    Directory of Open Access Journals (Sweden)

    Eberhard Gock

    2004-12-01

    Full Text Available Nanocrystalline materials have been of interest of more than 20 years and this interest is still increasing. The preparation and characterization of different chalcogenides have attracted a considerable attention due to their important nonlinear properties, luminiscent properties and other important physical and chemical properties. The main cause is in their unusual properties based on the high concentration of atoms in interfacial structures and the relatively simple ways of their preparation. Nanoparticles of semiconductors have many potential applications in the area of advanced materials. These materials can be synthesized via solid state reactions where the recovery degree can be strongly enhanced by the intervention of mechanical activation. Mechanochemical synthesis belongs among the synthesis route which can effectively control and regulate the course of solid state reactions.This paper describes structural and surface properties of cadmium sulphide nanoparticles synthesized in a planetary mill and in an eccentric vibratory mill. The main aim of this paper was to illustrate the potential of this technique for the large-scale production of CdS nanopowder.CdS nanoparticles were successfully synthesized by the mechanochemical route from the cadmium acetate and natrium sulphide. Structure properties of the as-prepared products were characterized by X-ray powder diffraction. X-ray diffraction patterns reveal the crystalline nature of CdS nanoparticles. Hexagonal ƒ¿-CdS greenockite together with cubic hawleyite ƒÀ-CdS are present among the products of mechanochemical synthesis. The methods of SEM, particle size analysis and low temperature nitrogen sorption were used to analyze the surface composition. The SEM measurements show the aggregates of small nanocrystals in which particle sizes of 5-9 nm were estimated by ScherrerLs formula.The cadmium sulphide nanoparticles are obtained in the simple step, making the process attractive for

  19. Room temperature synthesis of colloidal platinum nanoparticles

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Efficient preparation of stable dispersions of platinum nanoparticles from platinous chloride. (K2PtCl4) was achieved by simultaneous addition of capping polymer material. The size of platinum nanoparti- cles was controlled by changing the ratio of concentration of capping polymer material to the concentration of.

  20. ATLAS - End-Cap calorimeter

    CERN Multimedia

    CERN Audiovisual Unit

    2006-01-01

    The End-cap calorimeter was moved with the help of the rails and this calorimeter will measure the energy of particles close to the beam axis when protons collide. Cooling is important for maximum detector efficiency.

  1. Cap-binding complex (CBC)

    National Research Council Canada - National Science Library

    Gonatopoulos-Pournatzis, Thomas; Cowling, Victoria H

    2014-01-01

    .... One of the most important mediators of 7mG functions is CBC (cap-binding complex). CBC has a key role in several gene expression mechanisms, including transcription, splicing, transcript export and translation...

  2. Additive interaction of carbon dots extracted from soluble coffee and biogenic silver nanoparticles against bacteria

    Science.gov (United States)

    Andrade, Patricia F.; Nakazato, Gerson; Durán, Nelson

    2017-06-01

    It is known the presence of carbon dots (CDs) in carbohydrate based foods. CDs extracted from coffee grounds and instant coffee was also published. CDs from soluble coffee revealed an average size of 4.4 nm. CDs were well-dispersed in water, fluorescent and we have characterized by XPS, XRD analysis, fluorescence and by FTIR spectra. The MIC value by serial micro-dilution assays for CDs on S. aureus ATCC 25923 was 250 μg/mL and E. coli ATCC 25922 >1000 ug/mL. For silver nanoparticles biogenically synthesized was 6.7 μg/mL. Following the checkerboard assay with combining ½ MIC values of the MICs of 125 μg/mL of carbon dots and 3.4 μg/mL of silver nanoparticles, following the fractionated inhibitory concentration (FIC) index methodology, on S. aureus gave a fractionated inhibitory concentration (FIC) value of 1.0, meaning additive interaction. In general, the unfunctionalized CDs showed to be inefficient as antibacterial compounds, however the CDs extracted from Coffee powder and together silver nanoparticles appeared interesting as antibacterial association.

  3. LL37 peptide@silver nanoparticles : combining the best of the two worlds for skin infection control

    OpenAIRE

    Vignoni, Mariana; de Alwis Weerasekera, Hasitha; Simpson, Madeline J.; Phopase, Jaywant; Mah, Thien-Fah; Griffith, May; Alarcon, Emilio I.; Scaiano, Juan

    2014-01-01

    Capping silver nanoparticles with LL37 peptide eradicates the anti-proliferative effect of silver on primary skin cells, but retains the bactericidal properties of silver nanoparticles with activities comparable to silver nitrate or silver sulfadiazine. In addition, LL37 capped silver nanoparticles have anti-biofilm formation activity.

  4. Mechanochemical approach for the capping of mixed core CdS/ZnS nanocrystals: Elimination of cadmium toxicity.

    Science.gov (United States)

    Bujňáková, Zdenka; Baláž, Matej; Dutková, Erika; Baláž, Peter; Kello, Martin; Mojžišová, Gabriela; Mojžiš, Ján; Vilková, Mária; Imrich, Ján; Psotka, Miroslav

    2017-01-15

    The wet mechanochemical procedure for the capping of the CdS and CdS/ZnS quantum dot nanocrystals is reported. l-cysteine and polyvinylpyrrolidone (PVP) were used as capping agents. When using l-cysteine, the dissolution of cadmium(II) was almost none for CdS/ZnS nanocrystals. Moreover, prepared CdS- and CdS/ZnS-cysteine nanosuspensions exhibited unimodal particle size distributions with very good stability, which was further supported by the zeta potential measurements. The Fourier-transform infrared (FTIR) and nuclear magnetic resonance (NMR) spectroscopy showed the successful embedment of cysteine into the structure of the nanocrystals. Additionally, the optical properties were examined, and the results showed that the cysteine nanosuspension has promising fluorescence properties. On the other hand, PVP was not determined to be a very suitable capping agent for the present system. In this case, the release of cadmium(II) was higher in comparison to the l-cysteine capped samples. The nanosuspensions were successfully used for in vitro studies on selected cancer cell lines. Using fluorescence microscopy, it was evidenced that the nanocrystals enter the cell and that they can serve as imaging agents in biomedical applications. Copyright © 2016. Published by Elsevier Inc.

  5. Trichosporon jirovecii-mediated synthesis of cadmium sulfide nanoparticles.

    Science.gov (United States)

    El-Baz, Ashraf Farag; Sorour, Noha Mohamed; Shetaia, Youssria Mohamed

    2016-05-01

    Cadmium sulphide is one of the most promising materials for solar cells and of great interest due to its useful applications in photonics and electronics, thus the development of bio-mediated synthesis of cadmium sulphide nanoparticles (CdS NPs) is one of the essential areas in nanoparticles. The present study demonstrates for the first time the eco-friendly biosynthesis of CdS NPs using the yeast Trichosporon jirovecii. The biosynthesis of CdS NPs were confirmed by UV-Vis spectrum and characterized by X-ray diffraction assay and electron microscopy. Scanning and transmission electron microscope analyses shows the formation of spherical CdS NPs with a size range of about 6-15 nm with a mean Cd:S molar ratio of 1.0:0.98. T. jirovecii produced hydrogen sulfide on cysteine containing medium confirmed by positive cysteine-desulfhydrase activity and the colony color turned yellow on 0.1 mM cadmium containing medium. T. jirovecii tolerance to cadmium was increased by the UV treatment and three 0.6 mM cadmium tolerant mutants were generated upon the UV radiation treatment. The overall results indicated that T. jirovecii could tolerate cadmium toxicity by its conversion into CdS NPs on cysteine containing medium using cysteine-desulfhydrase as a defense response mechanism. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Photocatalytic Reduction of Aqueous Cr(VI with CdS under Visible Light Irradiation: Effect of Particle Size

    Directory of Open Access Journals (Sweden)

    A. B. Makama

    2017-04-01

    Full Text Available Stringent environmental standards have made the removal of Cr(VI from water an important problem for environmental scientist and engineering. Heterogeneous photocatalysis using suspended photocatalyst is an interesting technique to consider for this application. In this work, the influence of particle size of suspended CdS on the photocatalytic reduction of aqueous Cr(VI ion was investigated. The efficiency of Cr(VI reduction was monitored through UV-visible analysis. The experimental results showed that the nanoparticle size has a dramatic effect on the adsorption and reduction of Cr(VI. As surface area increased from 44.2±0.6 to 98.7±0.5 m2/g due to particle size reduction, the rate of Cr(VI reduction nearly doubled in the first 20 min of visible light irradiation. The results evidenced the inverse relationship between the apparent reduction rate constant and the CdS particle size. Conversely, the half-life (t1/2 period of the photocatalytic reduction has a direct relationship with CdS particle sizes. Copyright © 2017 BCREC GROUP. All rights reserved Received: 14th July 2016; Revised: 11st October 2016; Accepted: 18th October 2016 How to Cite: Makama, A.B., Salmiaton, A., Saion, E.B., Choong, T.S.Y., Abdullah, N. (2017. Photocatalytic Reduction of Aqueous Cr(VI with CdS under Visible Light Irradiation: Effect of Particle Size. Bulletin of Chemical Reaction Engineering & Catalysis, 12(1: 62-70 (doi:10.9767/bcrec.12.1.593.62-70 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.12.1.593.62-70

  7. Self-assembly and alignment of semiconductor nanoparticles on cellulose nanocrystals

    Science.gov (United States)

    Sonal Padalkar; Jeff R. Capadona; Stuart J. Rowan; Christoph Weder; Robert J. Moon; Lia A. Stanciu

    2011-01-01

    The synthesis of cadmium sulfide (CdS), zinc sulfide (ZnS), and lead sulfide (PbS) nanoparticle chains on cellulose nanocrystal (CNC) templates can be accomplished by the reaction of the precursor salts. The use of a cationic surfactant, cetyltrimethylammonium bromide (CTAB), was critical for the synthesis of well-defined semiconductor nanoparticle chains on the...

  8. Optical sensor based on a single CdS nanobelt.

    Science.gov (United States)

    Li, Lei; Yang, Shuming; Han, Feng; Wang, Liangjun; Zhang, Xiaotong; Jiang, Zhuangde; Pan, Anlian

    2014-04-23

    In this paper, an optical sensor based on a cadmium sulfide (CdS) nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT) method. X-Ray Diffraction (XRD) and Transmission Electron Microscopy (TEM) results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL) technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 10⁴, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  9. Optical Sensor Based on a Single CdS Nanobelt

    Directory of Open Access Journals (Sweden)

    Lei Li

    2014-04-01

    Full Text Available In this paper, an optical sensor based on a cadmium sulfide (CdS nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT method. X-Ray Diffraction (XRD and Transmission Electron Microscopy (TEM results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 104, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  10. Phosphate Favors the Biosynthesis of CdS Quantum Dots in Acidithiobacillus thiooxidans ATCC 19703 by Improving Metal Uptake and Tolerance

    Directory of Open Access Journals (Sweden)

    Giovanni Ulloa

    2018-02-01

    Full Text Available Recently, we reported the production of Cadmium sulfide (CdS fluorescent semiconductor nanoparticles (quantum dots, QDs by acidophilic bacteria of the Acidithiobacillus genus. Here, we report that the addition of inorganic phosphate to Acidithiobacillus thiooxidans ATCC 19703 cultures favors the biosynthesis of CdS QDs at acidic conditions (pH 3.5. The effect of pH, phosphate and cadmium concentrations on QDs biosynthesis was studied by using Response Surface Methodology (RSM, a multivariate technique for analytical optimization scarcely used in microbiological studies to date. To address how phosphate affects intracellular biosynthesis of CdS QDs, the effect of inorganic phosphate on bacterial cadmium-uptake was evaluated. By measuring intracellular levels of cadmium we determined that phosphate influences the capacity of cells to incorporate this metal. A relation between cadmium tolerance and phosphate concentrations was also determined, suggesting that phosphate participates in the adaptation of bacteria to toxic levels of this metal. In addition, QDs-biosynthesis was also favored by the degradation of intracellular polyphosphates. Altogether, our results indicate that phosphate contributes to A. thiooxidans CdS QDs biosynthesis by influencing cadmium uptake and cadmium tolerance. These QDs may also be acting as a nucleation point for QDs formation at acidic pH. This is the first study reporting the effect of phosphates on QDs biosynthesis and describes a new cadmium-response pathway present in A. thiooxidans and most probably in other bacterial species.

  11. Synthesis of silver nanoparticles by sophorolipids: Effect of ...

    Indian Academy of Sciences (India)

    We report in situ synthesis of silver nanoparticles using biosurfactants called sophorolipids as reducing and capping agents. We further study the effect of temperature and the structure of sophorolipid on the size of silver nanoparticles obtained. The silver nanoparticles were characterized by UVvisible, transmission electron ...

  12. Cap-binding complex (CBC)

    Science.gov (United States)

    Gonatopoulos-Pournatzis, Thomas; Cowling, Victoria H.

    2013-01-01

    The 7mG (7-methylguanosine cap) formed on mRNA is fundamental to eukaryotic gene expression. Protein complexes recruited to 7mG mediate key processing events throughout the lifetime of the transcript. One of the most important mediators of 7mG functions is CBC (cap-binding complex). CBC has a key role in several gene expression mechanisms, including transcription, splicing, transcript export and translation. Gene expression can be regulated by signalling pathways which influence CBC function. The aim of the present review is to discuss the mechanisms by which CBC mediates and co-ordinates multiple gene expression events. PMID:24354960

  13. The North Zealand CAP Monitor

    DEFF Research Database (Denmark)

    Nielsen, Minna; Ravn, Pernille; Notander Clausen, Lise

    Contect We describe how we developed a monitoring system for community acquired pneumonia (CAP) at North Zealand Regional hospital. We serve 310.000 inhabitants and annually around 3200 patients with CAP are admitted. As part of a program of clinical pathways for common conditions, a pathway...... nurses and two senior doctors. Direct observations of the clinical processes revealed problems of coordination, complex disease trajectories that did not fit with the pneumonia pathway, unclear guidelines and variation in their interpretation. Intervention We designed a measurement system to monitor...

  14. Lamellar multilayer hexadecylaniline-modified gold nanoparticle ...

    Indian Academy of Sciences (India)

    Abstract. Organization of hexadecylaniline (HDA)-modified colloidal gold particles at the air–water interface and the formation thereafter of lamellar, multilayer films of gold nanoparticles by the Langmuir–Blodgett technique is described in this paper. Formation of HDA-capped gold nanoparticles is accomplished by a simple.

  15. Lamellar multilayer hexadecylaniline-modified gold nanoparticle ...

    Indian Academy of Sciences (India)

    Organization of hexadecylaniline (HDA)-modified colloidal gold particles at the air-water interface and the formation thereafter of lamellar, multilayer films of gold nanoparticles by the Langmuir-Blodgett technique is described in this paper. Formation of HDA-capped gold nanoparticles is accomplished by a simple biphasic ...

  16. The CDS and the Government Bonds Markets During the Last Financial Crisis

    Directory of Open Access Journals (Sweden)

    Križanič France

    2015-11-01

    Full Text Available Financial market had developed a special instrument to insure the buyers of bonds. This instrument is so called Credit Default Swap (CDS. The CDS price is a kind of insurance premium that the buyer of CDS pays to the seller of CDS in exchange for compensation of possible loss in operation. Paper analyses causality between CDS price and dynamics of bond yields and influence of macroeconomic factors on it in four selected countries during the last financial crisis. Analysis results show that there is no important macroeconomic variable included in the analysis that preceded the CDS prices connected with German government bonds. Sellers of CDS were apparently aware of the systemic nature of the financial crisis in the euro area. In the case of the United Kingdom, Russia and Slovenia we can observe the unemployment rate as the most important macroeconomic variable that preceded the CDS prices for government bonds.

  17. Influence of cadmium sulfide nanoparticles on structural and electrical properties of polyvinyl alcohol films

    Directory of Open Access Journals (Sweden)

    J. Koteswararao

    2016-11-01

    Full Text Available Cadmium sulfide (CdS nanoparticles have been synthesized by hydrothermal method and dispersed in poly vinyl alcohol (PVA matrix in varying amounts by weight. Subsequently, PVA/CdS nanocomposites have been synthesized with the objective of investigating the effect of CdS nanoparticles on structural and electrical properties of PVA films. Structural properties were analyzed by Fourier transform infrared spectroscopy (FTIR, X-ray diffraction (XRD and scanning electron microscopy (SEM techniques. Differential scanning calorimetry (DSC was used to investigate thermal properties of PVA/CdS nanocomposites. Electrical properties were measured by using high frequency LCR meter and were found to be strongly dependent on frequency and nano CdS content. Dielectric constant decreased with increase in frequency and with increase in nanofiller concentration. AC conductivity and dielectric loss increased with frequency and decreased with increase in nano CdS content.

  18. Oxidative injury induced by cadmium sulfide nanoparticles in A549 cells and rat lungs.

    Science.gov (United States)

    Wang, Junfeng; Jiang, Chunyang; Alattar, Mohamed; Hu, Xiaoli; Ma, Dong; Liu, Huibin; Meng, Chunyan; Cao, Fuyuan; Li, Weihong; Li, Qingzhao

    2015-01-01

    Rod-shaped cadmium sulfide nanoparticles (CdS NPs) are becoming increasingly important in many industrial fields, but their potential hazards remain unknown. This study aimed to explore the patterns and mechanisms of lung injury induced by CdS NPs. A549 cells and rats were exposed to two types of CdS NPs with a same diameter of 20-30 nm but different lengths, CdS1 (80-100 nm) and CdS2 (110-130 nm). The using doses were included 10 μg/ml and 20 μg/ml two types of CdS NPs for cellular experiments and five times dose of 20 mg/kg body weight for rats' exposure. Methylthiazolyldiphenyl-tetrazolium bromide (MTT) and trypan blue staining were used to detect the A549 cell mortality percentage. The levels of reactive oxygen species (ROS) were determined in A549 cell. The vigor of superoxide dismutase (SOD) and the contents of catalase (CAT) and malondialdehyde (MDA) were detected both in A549 cells and in rats' serum and lung tissues. The cellular morphological changes were observed under transmission electron microscopy (TEM) and the pathological changes were observed in rats' lung tissue. CdS NPs significantly increased A549 cell mortality percentage. The CdS NPs also increased the levels of ROS and MDA content, whereas they decreased SOD and CAT activities. In parallel, similar changes of the contents of MDA, SOD and CAT were also observed in the sera and lung tissues of CdS NP-treated rats. The cellular TEM detection revealed that two types of CdS nanorods appeared as orderly arranged rounded fat droplets separately and leading to nucleus condensation (CdS1). These cellular and rats' tissues changes in the group treated with CdS1 were more significant than the CdS2 groups. Furthermore, CdS NPs induced many pathological changes, including emphysematous changes in rat lung tissue. Especially visible lung consolidation can be observed in the CdS1 group. CdS NPs induce oxidative injury in the respiratory system, and their toxic effects may be related to grain length.

  19. Multiplexed Activity of perAuxidase: DNA-Capped AuNPs Act as Adjustable Peroxidase.

    Science.gov (United States)

    Hizir, Mustafa Salih; Top, Meryem; Balcioglu, Mustafa; Rana, Muhit; Robertson, Neil M; Shen, Fusheng; Sheng, Jia; Yigit, Mehmet V

    2016-01-05

    In this study, we have investigated the intrinsic peroxidase-like activity of citrate-capped AuNPs (perAuxidase) and demonstrated that the nanozyme function can be multiplexed and tuned by integrating oligonucleotides on a nanoparticle surface. Systematic studies revealed that by controlling the reaction parameters, the mutiplexing effect can be delayed or advanced and further used for aptasensor applications.

  20. The use of CDS/ISIS software in Africa | Abboy | Innovation

    African Journals Online (AJOL)

    CDS/ISIS is free-of-charge software that has been developed by UNESCO and is distributed through a network of country distributors and more recently through the World Wide Web. CDS/ISIS is ideally suited for the manipulation of bibliographic data. Literature sources reveal that the use of CDS/ISIS is widespread in Africa ...

  1. Titanium nitride : A new Ohmic contact material for n-type CdS

    NARCIS (Netherlands)

    Didden, A.; Battjes, H.; Machunze, R.; Dam, B.; Van de Krol, R.

    2011-01-01

    In devices based on CdS, indium is often used to make Ohmic contacts. Since indium is scarce and expensive, suitable replacement materials need to be found. In this work, we show that sputtered titanium nitride forms an Ohmic contact with n-type CdS. The CdS films, deposited with chemical bath

  2. Capping Drugs: Development of Prodrugs

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 2. Capping Drugs: Development of Prodrugs. H Surya Prakash Rao. General Article Volume 8 Issue 2 February 2003 pp 19-27. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/008/02/0019-0027 ...

  3. From Blogs to Bottle Caps

    Science.gov (United States)

    Edinger, Ted

    2012-01-01

    There is a wonderful community of art educators connecting a once-isolated profession through blogging. Art educators around the world are sharing ideas and communicating with their peers through this amazing resource. In this article, the author describes the bottle cap mural at Tulip Grove Elementary School which was inspired by this exchange of…

  4. The Learning Management System Evolution. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service (CDS) to better understand how higher education institutions approach learning management systems (LMSs). Information provided for this Spotlight was derived from Module 8 of the Core Data Service, which contains several questions regarding information systems and applications.…

  5. CdS films deposited by chemical bath under rotation

    Energy Technology Data Exchange (ETDEWEB)

    Oliva-Aviles, A.I., E-mail: aoliva@mda.cinvestav.mx [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico); Patino, R.; Oliva, A.I. [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico)

    2010-08-01

    Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl{sub 2}, KOH, NH{sub 4}NO{sub 3} and CS(NH{sub 2}){sub 2} as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

  6. Optical properties of CdS sintered film

    Indian Academy of Sciences (India)

    Chemical method has been used to prepare cadmium sulphide by using cadmium, hydrochloric acid and H2S. The reflection spectra of covered and uncovered sintered films of CdS have been recorded by 'Hitachi spectrophotometer' over the wavelength range 300–700 nm. The energy band gaps of these films have been ...

  7. Luminescence in Mn-doped CdS nanocrystals

    Indian Academy of Sciences (India)

    Wintec

    Abstract. We have synthesized Mn-doped CdS nanocrystals (NCs) with size ranging from 1⋅8–3 nm. Photo- luminescence (PL) spectra of the doped NCs differ from that of the undoped NCs with an additional peak due to Mn d–d transitions. Electron paramagnetic resonance spectra along with X-ray absorption ...

  8. Surface biofunctionalized CdS and ZnS quantum dot nanoconjugates for nanomedicine and oncology: to be or not to be nanotoxic?

    Science.gov (United States)

    Mansur, Alexandra AP; Mansur, Herman S; de Carvalho, Sandhra M; Lobato, Zélia IP; Guedes, Maria IMC; Leite, Maria F

    2016-01-01

    Herein, for the first time, we demonstrated that novel biofunctionalized semiconductor nanomaterials made of Cd-containing fluorescent quantum dot nanoconjugates with the surface capped by an aminopolysaccharide are not biologically safe for clinical applications. Conversely, the ZnS-based nanoconjugates proved to be noncytotoxic, considering all the parameters investigated. The results of in vitro cytotoxicity were remarkably dependent on the chemical composition of quantum dot (CdS or ZnS), the nature of the cell (human cancerous and embryonic types), and the concentration and time period of exposure to these nanomaterials, caused by the effects of Cd2+ on the complex nanotoxicity pathways involved in cellular uptake. Unexpectedly, no decisive evidence of nanotoxicity of CdS and ZnS conjugates was observed in vivo using intravenous injections in BALB/c mice for 30 days, with minor localized fluorescence detected in liver tissue specimens. Therefore, these results proved that CdS nanoconjugates could pose an excessive threat for clinical applications due to unpredicted and uncorrelated in vitro and in vivo responses caused by highly toxic cadmium ions at biointerfaces. On the contrary, ZnS nanoconjugates proved that the “safe by design” concept used in this research (ie, biocompatible core–shell nanostructures) could benefit a plethora of applications in nanomedicine and oncology. PMID:27695325

  9. 21 CFR 884.5250 - Cervical cap.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Cervical cap. 884.5250 Section 884.5250 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES... cap. (a) Identification. A cervical cap is a flexible cuplike receptacle that fits over the cervix to...

  10. 21 CFR 888.3000 - Bone cap.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Bone cap. 888.3000 Section 888.3000 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES ORTHOPEDIC DEVICES Prosthetic Devices § 888.3000 Bone cap. (a) Identification. A bone cap is a mushroom...

  11. Band-gap and sub-band-gap photoelectrochemical processes at nanocrystalline CdS grown on ZnO by successive ionic layer adsorption and reaction method

    Energy Technology Data Exchange (ETDEWEB)

    Malashchonak, M.V., E-mail: che.malasche@gmail.com [Belarusian State University, Nezalezhnastsi Av. 4, Minsk 220030 (Belarus); Streltsov, E.A., E-mail: streltea@bsu.by [Belarusian State University, Nezalezhnastsi Av. 4, Minsk 220030 (Belarus); Mazanik, A.V. [Belarusian State University, Nezalezhnastsi Av. 4, Minsk 220030 (Belarus); Kulak, A.I., E-mail: kulak@igic.bas-net.by [Institute of General and Inorganic Chemistry, National Academy of Sciences of Belarus, Surganova str., 9/1, Minsk 220072 (Belarus); Poznyak, S.K. [Belarusian State University, Nezalezhnastsi Av. 4, Minsk 220030 (Belarus); Stroyuk, O.L., E-mail: stroyuk@inphyschem-nas.kiev.ua [L.V. Pysarzhevsky Institute of Physical Chemistry of National Academy of Sciences of Ukraine, 31 prosp. Nauky, 03028 Kyiv (Ukraine); Kuchmiy, S.Ya. [L.V. Pysarzhevsky Institute of Physical Chemistry of National Academy of Sciences of Ukraine, 31 prosp. Nauky, 03028 Kyiv (Ukraine); Gaiduk, P.I. [Belarusian State University, Nezalezhnastsi Av. 4, Minsk 220030 (Belarus)

    2015-08-31

    Cadmium sulfide nanoparticle (NP) deposition by the successive ionic layer adsorption and reaction (SILAR) method on the surface of mesoporous ZnO micro-platelets with a large specific surface area (110 ± 10 m{sup 2}g{sup −1}) results in the formation of ZnO/CdS heterostructures exhibiting a high incident photon-to-current conversion efficiency (Y) not only within the region of CdS fundamental absorption (Y{sub max} = 90%; 0.1 M Na{sub 2}S + 0.1 M Na{sub 2}SO{sub 3}), but also in the sub-band-gap (SBG) range (Y{sub max} = 25%). The onset potentials of SBG photoelectrochemical processes are more positive than the band-gap (BG) onset potential by up to 100 mV. A maximum incident photon-to-current conversion efficiency value for SBG processes is observed at larger amount of deposited CdS in comparison with the case of BG ones. The Urbach energy (E{sub U}) of CdS NPs determined from the photocurrent spectra reaches a maximal value on an early deposition stage (E{sub U} = 93 mV at SILAR cycle number N = 5), then lowers somewhat (E{sub U} = 73 mV at N = 10) and remains steady in the range of N from 20 to 300 (E{sub U} = 67 ± 1 mV). High efficiency of the photoelectrochemical SBG processes are interpreted in terms of light scattering in the ZnO/CdS heterostructures. - Highlights: • ZnO/CdS films demonstrate high quantum efficiency (25%) for sub-band-gap transitions. • Onset photocurrent potentials for sub-band-gap processes differ than those for band-gap ones. • Sub-band-gap transitions are caused by band-tail states in CdS nanoparticles.

  12. Biosynthesis of gold nanoparticles using plant extracts.

    Science.gov (United States)

    Noruzi, Masumeh

    2015-01-01

    Because of the widespread use of metallic nanoparticles in biology, pharmaceuticals, and medicine, biosynthesis methods are being considered to prepare these nanoparticles. Among biosynthesis methods mentioned in the literature, the use of plant extracts has gained great importance due to the fact that most of the plants are generally inexpensive, available, and nontoxic. Moreover, plant extracts are rich in different types of reducing and capping agents. Therefore, these methods have a high potential for scale-up and can produce nanoparticles in different morphologies. In this paper, different green methods used to prepare metallic nanoparticles and the types of characterization methods for their identification have been comprehensively explained. Since gold nanoparticles are considered more biocompatible than other metallic nanoparticles, research studies performed on green synthesis of gold nanoparticles using plant extracts and different applications of these nanoparticles have been reviewed and discussed.

  13. Photocatalytic applications with CdS • block copolymer/exfoliated graphene nanoensembles: hydrogen generation and degradation of Rhodamine B.

    Science.gov (United States)

    Skaltsas, T; Karousis, N; Pispas, S; Tagmatarchis, N

    2014-11-07

    Amphiphilic block copolymer poly(isoprene-b-acrylic acid) (PI-b-PAA) was used to stabilize exfoliated graphene in water, allowing the immobilization of semiconductor CdS nanoparticles forming CdS • PI-b-PAA/graphene. Characterization using high-resolution transmission electron microscopy and energy-dispersive x-ray spectroscopy proved the success of the preparation method and revealed the presence of spherical CdS. Moreover, UV-Vis and photoluminescence assays suggested that electronic interactions within CdS • PI-b-PAA/graphene exist as evidenced by the significant quenching of the characteristic emission of CdS by exfoliated graphene. Photoillumination of CdS • PI-b-PAA/graphene, in the presence of ammonium formate as a quencher for the photogenerated holes, resulted in the generation of hydrogen by water splitting, monitored by the reduction of 4-nitroaniline to benzene-1,4-diamine (>80 ± 4% at 20 min; 100% at 24 min), much faster and more efficient compared to when reference CdS • PI-b-PAA was used as the photocatalyst (graphene, with fast kinetics under visible light illumination in the presence of air. The enhancement of both photocatalytic processes by CdS • PI-b-PAA/graphene was rationalized in terms of effective separation of holes and electrons, contrary to reference CdS • PI-b-PAA, in which rapid recombination of the hole-electron pair is inevitable due to the absence of exfoliated graphene as a suitable electron acceptor.

  14. Water-dispersible nanoparticles via interdigitation of sodium ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. This paper describes the formation of water-dispersible gold nano- particles capped with a bilayer of sodium dodecylsulphate (SDS) and octadecylamine. (ODA) molecules. Vigorous shaking of a biphasic mixture consisting of ODA-capped gold nanoparticles in chloroform and SDS in water results in the rapid ...

  15. Nonradiative and Radiative Recombination in CdS Polycrystalline Structures

    Directory of Open Access Journals (Sweden)

    E. Gaubas

    2013-01-01

    Full Text Available Properties of polycrystalline CdS layers, employed in formation of the CdS-Cu2S heterostructures, have been studied by combining contactless techniques of the time and spectrally resolved photoluminescence (TR-PL spectroscopy and microwave-probed photoconductivity (MW-PC transients. The confocal microscopy has been employed to correlate the homogeneity of photoluminescence and grain size in CdS layers. Three types of samples with crystallite grain size of <1 μm (the I-type and of 2–10 μm of homogeneous (II-type and inhomogeneous (III-type grain distribution have been separated. The simultaneous record of MW-PC and TR-PL responses ensures the same sampling area on the layer under investigation, as both (MW-PC and TR-PL signals are generated by the same UV laser excitation beam. Two PL bands peaked at 500 and 700 nm were revealed. It has been demonstrated that photoluminescence intensity strongly depends on the properties of the polycrystalline 15–26 μm thick CdS layers with equilibrium carrier density of about 1.5×1013 cm−3, which serve as the substrates to form CdS-Cu2S junctions. The different carrier decay components were ascribed to different microareas with characteristic MW-PC and PL decay lifetimes of 2–10 ns, ascribed to microcrystallites with PL instantaneous decay lifetimes of 40–200 ns, and MW-PC decay lifetimes in the range of 100–1000 μs attributed to the inter-crystallite areas of CdS polycrystalline material.

  16. Stability, cytotoxicity and cell uptake of water-soluble dendron–conjugated gold nanoparticles with 3, 12 and 17 nm cores† †Electronic supplementary information (ESI) available: Additional characterization methods and procedures in addition to the data for the characterization of glutathione-capped gold nanoparticles and dendron-conjugated gold nanoparticles including FT-IR spectra (Fig. S1 and S2), UV-vis spectra (Fig. S3 and S6), TEM images (Fig. S4), MALDI-TOF/TOF spectra (Fig. S5), fluorescence spectra (Fig. S6 and S7), In vitro cytotoxic assay results (Fig. S9) and ICP-MS results (Tables 1 and 2). DOI: 10.1039/c5tb00608b Click here for additional data file.

    Science.gov (United States)

    Deol, Suprit; Weerasuriya, Nisala

    2015-01-01

    This article describes the synthesis of water-soluble dendron–conjugated gold nanoparticles (Den–AuNPs) with various average core sizes and the evaluation of stability, cytotoxicity, cell permeability and uptake of these materials. The characterization of Den–AuNPs using various techniques including transmission electron microscopy (TEM), matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF-MS), 1H NMR, FT-IR, and UV-vis spectroscopy confirms the dendron conjugation to the glutathione-capped gold nanoparticles (AuNPs). The stability of AuNPs and Den–AuNPs in solutions of different pH and salt concentration is determined by monitoring the changes in surface plasmon bands of gold using UV-vis spectroscopy. The stability of Den–AuNPs at different pH remained about the same compared to that of AuNPs. In comparison, the Den–AuNPs are found to be more stable than the precursor AuNPs maintaining their solubility in the aqueous solution with the salt concentration of up to 100 mM. The improved stability of Den–AuNPs suggests that the post-functionalization of thiol-capped gold nanoparticle surfaces with dendrons can further improve the physiological stability and biocompatibility of gold nanoparticle-based materials. Cytotoxicity studies of AuNPs and Den–AuNPs with and without fluorophores are also performed by examining cell viability for 3T3 fibroblasts using a MTT cell proliferation assay. The conjugation of dendrons to the AuNPs with a fluorophore is able to decrease the cytotoxicity brought about by the fluorophore. The successful uptake of Den–AuNPs in mouse fibroblast 3T3 cells shows the physiological viability of the hybrid materials. PMID:26366289

  17. Growth Mechanisms of CdS Nanocrystals in Aqueous Media

    Directory of Open Access Journals (Sweden)

    Loredana Latterini

    2012-06-01

    Full Text Available CdS nanocrystals were prepared in water-in-oil microemulsions. The nanocrystal properties, absorption and luminescence spectra and size distributions, were monitored at different times after mixing the microemulsions of the two precursors to obtain information on their growth mechanism. In particular, CdS nanocrystals were prepared using water-in-heptane or water-in-nonane microemulsions. The results obtained from the investigation of nanocrystals prepared using heptane as the organic phase, confirmed that nanocrystal nucleation is fast while their growth is determined by droplet exchange content rate. Size distribution histograms obtained from the sample at early time points after mixing presented a bimodal population having average sizes of 3.0 ± 0.1 and 5.8 ± 0.1 nm, thus indicating that surface process controls the nanocrystal growth. With longer reaction times the occurrence of water droplet coalescence is likely responsible for the formation of nanocrystal agglomerates. Using a water-in-nonane microemulsion, the droplet exchange rate can be modified, thus leading to smaller CdS nanocrystals. However, the development of structural defects cannot be excluded, as evidenced by the luminescence spectra of the suspension. In general, aging of the nanocrystal in the pristine microemulsion resulted in the development of cubic semiconductor nanostructures.

  18. The rebirth of the cervical cap.

    Science.gov (United States)

    Cappiello, J D; Grainger-Harrison, M

    1981-01-01

    In an effort to dispel myths surrounding the cervical cap, the historical and political factors affecting the cap's use in the U.S. are described. Clinical aspects of cap fitting are also included. The cervical cap has found only limited acceptance in the U.S. Skepticisms on the part of physicians may be the result of 2 factors: confusion of the cervical cap with intracervical devices used for artificial insemination and confusion with stem pessaries; and the lack of clinical research and statistical evaluation of efficacy rates. The latter factor prompted Tietze et al. to conduct the only U.S. statistical study of the cap in 1953. Of the 143 women studied, the pregnancy rate was 7.6/100 years of use. Of the 28 unplanned pregnancies, 6 were related to faulty technique or omission of a spermicide and 10 were instances of admittedly irregular use. When these failures are omitted, the theoretical effectiveness rate is about 98%. Some practitioners are concerned about an increased incidence of cervical erosion with cap use. Possibly currently conducted studies will show that cap and spermicide users have a lower incidence of cervical erosion than women using no contraceptive method. Study findings suggest that the cervical cap may afford protection without any spermicidal supplement, but the use of spermicides continues to be recommended to clients. Advantages of the cervical cap include the following: it can be left in place longer than a diaphragm without additional applications of spermicide in the vagina; and the insertion of the cap is unrelated to the time of intercourse. Despite research on toleration of the cap for 3 weeks at a time, it is recommended that the cap be worn for only a few days at a time. At this time there are no manufacturers of cervical caps for contraceptive use in the U.S. The cap is now being imported from England and it costs $6.00. A factor that has made the cap unpopular with many physicians is the lengthy time required for fitting. An

  19. Beet juice utilization: Expeditious green synthesis of nobel metal nanoparticles (Ag, Au, Pt, and Pd) using microwaves

    Science.gov (United States)

    Metal nanoparticles of Ag, Au, Pt, and Pd were prepared in aqueous solutions via a rapid microwave-assisted green method using beet juice, an abundant sugar-rich agricultural produce, served as both a reducing and a capping reagent. The Ag nanoparticles with capping prepared by b...

  20. Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2011-08-31

    Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

  1. Damage caps and defensive medicine, revisited.

    Science.gov (United States)

    Paik, Myungho; Black, Bernard; Hyman, David A

    2017-01-01

    Does tort reform reduce defensive medicine and thus healthcare spending? Several (though not all) prior studies, using a difference-in-differences (DiD) approach, find lower Medicare spending for hospital care after states adopt caps on non-economic or total damages ("damage caps"), during the "second" reform wave of the mid-1980s. We re-examine this issue in several ways. We study the nine states that adopted caps during the "third reform wave," from 2002 to 2005. We find that damage caps have no significant impact on Medicare Part A spending, but predict roughly 4% higher Medicare Part B spending. We then revisit the 1980s caps, and find no evidence of a post-adoption drop (or rise) in spending for these caps. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Ocular injuries from flying bottle caps.

    Science.gov (United States)

    Fonseka, C

    1993-12-01

    Three cases of serious eye injury are described from flying metal caps of carbonated drink bottles. The injuries occurred while attempting to open the bottle in an unconventional and dangerous way. Though injuries from flying bottle caps have been described before, they have occurred when the bottle exploded. This is the first report of eye injuries caused by bottle caps while opening and are similar to the injuries caused by champagne corks.

  3. Chemical bath deposition of CdS thin films doped with Zn and Cu

    Indian Academy of Sciences (India)

    Zn- and Cu-doped CdS thin films were deposited onto glass substrates by the chemical bath technique. ZnCl2 and CuCl2 were incorporated as dopant agents into the conventional CdS chemical bath in order to promote the CdS doping process. The effect of the deposition time and the doping concentration on the physical ...

  4. Chemical bath deposition of CdS thin films doped with Zn and Cu

    Indian Academy of Sciences (India)

    Abstract. Zn- and Cu-doped CdS thin films were deposited onto glass substrates by the chemical bath technique. ZnCl2 and CuCl2 were incorporated as dopant agents into the conventional CdS chemical bath in order to promote the CdS doping process. The effect of the deposition time and the doping concentration on the ...

  5. Nanocomposites Based on Technical Polymers and Sterically Functionalized Soft Magnetic Magnetite Nanoparticles: Synthesis, Processing, and Characterization

    Directory of Open Access Journals (Sweden)

    S. Kirchberg

    2012-01-01

    The distribution of the nanoparticles is characterized by microscopy. Besides a minor number of agglomerates and aggregates the nanoparticles are distributed homogeneously in the PVB composites. Furthermore, the injection molded specimens are characterized with regard to their thermal degradation, polymer structure, and their mechanical and magnetic properties. The presence of nanoparticles capped with ricinoleic acid shows significant decrease in degradation temperature and in glass transition temperature of PVB. The degradation temperature of PMMA is increased by adding nanoparticles capped with oleic acid. Dynamic-mechanical properties as well as the magnetic permeability of PVB and PMMA are improved significantly by adding nanoparticles.

  6. Luminescence properties of Eu3+/CDs/PVA composite applied in light conversion film

    Science.gov (United States)

    He, Jiangling; He, Youling; Zhuang, Jianle; Zhang, Haoran; Lei, Bingfu; Liu, Yingliang

    2016-12-01

    In this work, blue-light-emitting carbon dots (CDs) were composited with red-light-emitting europium ions (Eu3+) solutions under the synergistic reaction of polyvinyl alcohol (PVA) to prepare the light conversion film. The formation mechanism of Eu3+/CDs/PVA film was detailedly discussed. It is the first report that this composite was synthesized through direct recombination of CDs and Eu3+ solutions instead of traditional methods based on Eu3+ coordination compound. Furthermore, tunable photoluminescence property can be successfully achieved by controlling the ratio of CDs to doped Eu3+, this property can meet the variable light component requirements for different species of plants.

  7. Impact of the Cornea Donor Study (CDS) on Acceptance of Corneas from Older Donors

    Science.gov (United States)

    Sugar, Alan; Montoya, Monty M.; Beck, Roy; Cowden, John W.; Dontchev, Mariya; Gal, Robin L.; Kollman, Craig; Malling, Jackie; Mannis, Mark J.; Tennant, Bradley

    2014-01-01

    Purpose Evaluate retrospectively whether findings from the Cornea Donor Study (CDS) led to changes in the transplantation of corneas from older donors. Methods United States eye banks provided complete data on donor age and placement (domestic or international) for 86,273 corneas from 1998 to 2009. The data were analyzed by 3 time periods: preceding CDS (1998–1999), during CDS (2000–2007) and after publication of CDS 5 year results (2008–2009), and separately for corneas placed within vs. outside the United States. Results For corneal tissues transplanted in the United States, the percentage of donors ≥66 years old increased from 19% before CDS to 21% during CDS and 25% after CDS (pcorneas distributed outside the United States with the percentage of donors ≥66 years old decreasing from 56% to 42% to 34%, respectively. Donor age trends over time varied by eye bank. Conclusions There was a modest overall increase in the donor age of corneas transplanted in the United States from 1998 to 2009, but the retrospective nature of the study limits our ability to attribute this change to the CDS. The modest increases in the donor age of corneas transplanted is a positive finding, but wider acceptance of older corneal donor tissue should be encouraged based on the five-year evidence generated by the CDS. PMID:22262218

  8. Assured information flow capping architecture

    Science.gov (United States)

    Black, M. D.; Carvin, N. A.

    1985-05-01

    The Tactical Air Control System (TACS) is that set of Tactical Air Force assets used to assess the air and ground situation, and to plan, allocate, commit, and control assigned resources. Previous studies noted that the TACS elements should be more highly distributed to improve survivability in the battlefield of the future. This document reports on the results of the Assured Information Flow Capping Architecture study, which developed governing concepts for communications architectures that can support the information flow requirements of a future, distributed TACS. Architecture comprising existing and planned communications equipment were postulated and compared with a set of goals to identify deficiencies. Architectures using new equipment that resolve many of the deficiencies were then postulated, and areas needing further investigation were identified.

  9. Revealing the interparticle magnetic interactions of iron oxide nanoparticles-carbon nanotubes hybrid materials

    NARCIS (Netherlands)

    Douvalis, A.P.; Georgakilas, V.; Tsoufis, T.; Gournis, D.; Kooi, B.; Bakas, T.

    2010-01-01

    Spinel iron oxide nanoparticles capped with organic molecules have been successfully prepared and used to produce iron oxide nanoparticles-single wall carbon nanotubes hybrid materials, which were characterized by a number of experimental techniques. The nanoparticles in both samples have an average

  10. Synthesis and characterization of nanoparticles capped with medicinal plant extracts

    Science.gov (United States)

    Rekulapally, Sujith R.

    In this study, synthesis, characterization and biological application of series nanometal (silver, Ag) and nanometal oxide (titania, TiO2) were carried out. These nanomaterials were prepared using wet-chemistry method and then coated using natural plant extract. Three medicinal plants, namely Zingiber officinale (Ginger), Allium sativum (Garlic) and Capsicum annuum (Chili) were chosen as grafting agent to decrease the side-effects and increase the efficiency of NPs towards living organism. Extraction conditions were controlled under 60-100 °C for 8 hrs. Ag and TiO2 NPs were fabricated using colloidal chemistry and variables were controlled at ambient condition. The band gap of TiO2 NPs used as disinfectant was also modified through coating the medicinal plant extracts. The medicinal plant extracts and coated NPs were measured using spectroscopic methods. Ultraviolet-visible spectra indicated the Ag NPs were formed. The peak at 410 nm resulted from the electrons transferred from their ground to the excited state. The broadened full width at half maximum (FWHM) suggested the ultrafine particles were obtained. The lipid soluble compounds, phenols, tri-terpenoids, flavanoids, capsaicinoids, flavonoids, carotenoids, steroids steroidal glycosides, and vitamins were determined from the high performance liquid chromatographical analyses. X-ray powder diffraction indicated that the face-centered cubic Ag (PDF: 00-004-0783, a = 4.0862A, a = 90°) and anatase TiO2 (PDF: 01-08-1285, a = 3.7845, c = 9.5143A, a = 90°) were obtained using colloidal chemistry. Bactericidal activity indicated that these core-shelled TiO 2 were effective (MBC=0.6 ppm, within 30 mins) at inactivating Gram-positive and Gram-negative bacteria. It is proposed that the medicinal extracts enhanced the potency of NPs against bacteria. From our previous study, the Ag NPs were highly effective at inactivating both bacteria.

  11. Radical Scavenging Efficacy of Thiol Capped Silver Nanoparticles

    Indian Academy of Sciences (India)

    Author Affiliations. Kumudini Chandraker1 Sandeep Kumar Vaishanav1 Rekha Nagwanshi2 Manmohan L Satnami1. School of Studies in Chemistry, Pt. Ravishankar Shukla University, Raipur 492 010, India; Department of Chemistry, Govt. Madhav Science P. G. College, Ujjain (M.P.), 456 010 India ...

  12. Radical Scavenging Efficacy of Thiol Capped Silver Nanoparticles

    Indian Academy of Sciences (India)

    picryl hydrazil (DPPH), nitric oxide (NO) and hydroxyl (OH) radicals as spectrophotometric assay. The hydrogen peroxide (H2O2) scaveng- ing efficacy has been determined by titration method. Ascorbic acid has been used as standard for all ...

  13. Controlling the morphology of TiO{sub 2} nano crystals with different capping agents

    Energy Technology Data Exchange (ETDEWEB)

    Calatayud, D. G.; Rodriguez, M.; Jardiel, T.

    2015-10-01

    This paper provides direct evidence to support the role of capping agents in controlling the evolution of TiO{sub 2} seeds into nano crystals with a specific shape. Starting with Ti(OBut){sub 4} and using oleid acid, oleylamine, dioleamide, 11-aminoundecanoic acid, arginine, trifluroacetic acid or HF as capping agents, mainly TiO{sub 2} truncated octahedrons enclosed by {1 0 1} and {0 0 1} facets were obtained. We could also selectively obtain square, rods and rounded rhombic-shaped nanoparticles by growing of {0 1 0} facets by adding oleic acid and oleylamine in ratio 6:4, respectively, while all other parameters were kept the same. This research not only offers new insights into the role played by a capping agent in shape-controlled synthesis but also provides, a versatile approach to controlling the shape of metal oxide nano crystals. (Author)

  14. Controlling the morphology of TiO2 nanocrystals with different capping agents

    Directory of Open Access Journals (Sweden)

    David G. Calatayud

    2015-07-01

    Full Text Available This paper provides direct evidence to support the role of capping agents in controlling the evolution of TiO2 seeds into nanocrystals with a specific shape. Starting with Ti(OBut4 and using oleid acid, oleylamine, dioleamide, 11-aminoundecanoic acid, arginine, trifluroacetic acid or HF as capping agents, mainly TiO2 truncated octahedrons enclosed by {1 0 1} and {0 0 1} facets were obtained. We could also selectively obtain square, rods and rounded rhombic-shaped nanoparticles by growing of {0 1 0} facets by adding oleic acid and oleylamine in ratio 6:4, respectively, while all other parameters were kept the same. This research not only offers new insights into the role played by a capping agent in shape-controlled synthesis but also provides, a versatile approach to controlling the shape of metal oxide nanocrystals.

  15. CMS Hadronic EndCap Calorimeter Upgrade R&D Studies

    CERN Document Server

    Akgun, Ugur; Onel, Yasar

    2012-01-01

    Due to an expected increase in radiation damage in LHC, we propose to replace the active material of the CMS Hadronic EndCap calorimeters with radiation hard quartz plate. Quartz is proven to be radiation hard with radiation damage tests using electron, proton, neutron and gamma beams. However, the light produced in quartz is from Cerenkov process, which yields drastically fewer photons than scintillators. To increase the light collection efficiency we pursue two separate methods: First method: use wavelength shifting (WLS) fibers, which have been shown to collect efficiently the Cerenkov light generated in quartz plates. A quartz plate calorimeter prototype with WLS fibers has been constructed and tested at CERN that shows this method is feasible. Second proposed solution is to treat the quartz plates with radiation hard wavelength shifters, p-terphenyl, doped zinc oxide, or doped CdS. Another calorimeter prototype has been constructed with p-terphenyl deposited quartz plates, and showed superior calorimeter...

  16. Cambridge English First 2 audio CDs : authentic examination papers

    CERN Document Server

    2016-01-01

    Four authentic Cambridge English Language Assessment examination papers for the Cambridge English: First (FCE) exam. These examination papers for the Cambridge English: First (FCE) exam provide the most authentic exam preparation available, allowing candidates to familiarise themselves with the content and format of the exam and to practise useful exam techniques. The Audio CDs contain the recorded material to allow thorough preparation for the Listening paper and are designed to be used with the Student's Book. A Student's Book with or without answers and a Student's Book with answers and downloadable Audio are available separately. These tests are also available as Cambridge English: First Tests 5-8 on Testbank.org.uk

  17. Direct coating of mesoporous titania on CTAB-capped gold nanorods

    Science.gov (United States)

    Zhao, Junwei; Xu, Pengyu; Li, Yue; Wu, Jian; Xue, Junfei; Zhu, Qiannan; Lu, Xuxing; Ni, Weihai

    2016-03-01

    We demonstrate a CTAB-templated approach towards direct coating of mesoporous titania on gold nanorods in aqueous solutions. The formation of the mesoporous shell is found to be closely correlated with CTAB concentration and the amount of the titania precursor. This approach can be readily extended to form mesoporous titania shells on other CTAB-capped nanoparticles.We demonstrate a CTAB-templated approach towards direct coating of mesoporous titania on gold nanorods in aqueous solutions. The formation of the mesoporous shell is found to be closely correlated with CTAB concentration and the amount of the titania precursor. This approach can be readily extended to form mesoporous titania shells on other CTAB-capped nanoparticles. Electronic supplementary information (ESI) available: Experimental details including chemicals, sample preparation, and characterization methods. UV-Vis extinction spectra, SEM images, and TEM images of AuNR@mTiO2 nanostructures. See DOI: 10.1039/c5nr05692f

  18. Silver Nanoparticles with Broad Multiband Linear Optical Absorption

    KAUST Repository

    Bakr, Osman M.

    2009-07-06

    A simple one-pot method produces silver nanoparticles coated with aryl thiols that show intense, broad nonplasmonic optical properties. The synthesis works with many aryl-thiol capping ligands, including water-soluble 4-mercaptobenzoic acid. The nanoparticles produced show linear absorption that is broader, stronger, and more structured than most conventional organic and inorganic dyes.

  19. A review on marine based nanoparticles and their potential ...

    African Journals Online (AJOL)

    Infonet

    2015-05-06

    May 6, 2015 ... amino functional groups, which can serve both as effective metal-reducing agents and as capping agents to provide a robust coating on the metal nanoparticles in a single step. MARINE ANIMALS-BASED NANOPARTICLES. Dolphins and whales have rough skin surface due to the presence of nanoridges.

  20. Highly concentrated synthesis of copper-zinc-tin-sulfide nanocrystals with easily decomposable capping molecules for printed photovoltaic applications.

    Science.gov (United States)

    Kim, Youngwoo; Woo, Kyoohee; Kim, Inhyuk; Cho, Yong Soo; Jeong, Sunho; Moon, Jooho

    2013-11-07

    Among various candidate materials, Cu2ZnSnS4 (CZTS) is a promising earth-abundant semiconductor for low-cost thin film solar cells. We report a facile, less toxic, highly concentrated synthetic method utilizing the heretofore unrecognized, easily decomposable capping ligand of triphenylphosphate, where phase-pure, single-crystalline, and well-dispersed colloidal CZTS nanocrystals were obtained. The favorable influence of the easily decomposable capping ligand on the microstructural evolution of device-quality CZTS absorber layers was clarified based on a comparative study with commonly used oleylamine-capped CZTS nanoparticles. The resulting CZTS nanoparticles enabled us to produce a dense and crack-free absorbing layer through annealing under a N2 + H2S (4%) atmosphere, demonstrating a solar cell with an efficiency of 3.6% under AM 1.5 illumination.

  1. Unbonded capping for concrete masonry units

    Energy Technology Data Exchange (ETDEWEB)

    Crouch, L.K.; Knight, M.L.; Henderson, R.C.; Sneed, W.A. Jr.

    1999-07-01

    Due to the manufacturing process, the bearing surfaces of concrete masonry units are often somewhat rough and uneven. Therefore, concrete masonry units must be capped when tested in compression according to ASTM C 140-96, Standard Test Methods of Sampling and Testing Concrete Masonry Units. Capping of concrete masonry units is time consuming and expensive. Several studies of compression tests on concrete cylinders indicate that use of elastic pads in rigid retaining caps give similar compressive strength results to approved capping methods.An unbonded capping system for concrete masonry units similar to that described in ASTM C 1231-93, Standard Practice for Use of Unbonded Caps in Determination of Compressive Strength of Hardened Concrete Cylinders, was developed. The average compressive strength results obtained when using the unbonded capping system ranged from 92--94% of the average compressive strength results obtained when using ASTM C 140-96 approved methods. Further, use of the unbonded capping system was found to increase productivity and substantially reduce testing cost.

  2. Nature mangement, landscape and the CAP

    NARCIS (Netherlands)

    Brouwer, F.M.; Godeschalk, F.E.

    2004-01-01

    The integration of nature management, landscape and environmental concerns into the Common Agricultural Policy (CAP) has gained momentum with the CAP reforms adopted in June 2003. The report explores instruments and approaches that contribute to the inte-gration of nature conservation and landscape

  3. Synthesis of TOPO-capped Nanocrystals of Copper Sulphide from a ...

    African Journals Online (AJOL)

    Nearly mono-dispersed TOPO-capped copper sulphide nanocrystals of ca. 4.5 nm (diameter) have been synthesized from [Cu(S2CNMe(nHex))2]. The absorption spectrum of the (Cu2S) nanoparticles shows a large blue shift (2.09 eV) in relation to bulk Cu2S (1022 nm, 1.21 eV). The PL gives a broad spectrum with an ...

  4. CAP binding proteins associated with the nucleus.

    Science.gov (United States)

    Patzelt, E; Blaas, D; Kuechler, E

    1983-01-01

    Cap binding proteins of HeLa cells were identified by photo-affinity labelling using the cap analogue gamma-[32P]-[4-(benzoyl-phenyl)methylamido]-7-methylguanosine-5'- triphosphate. Photoreaction with whole cell homogenates resulted in specific labelling of five major polypeptides. The small molecular weight polypeptide appeared to be identical to the 24 000 to 26 000 dalton cap binding protein previously identified in initiation factors. A cap binding protein of 37 000 dalton was found in initiation factors as well as in preparations of crude nuclei. It was released from nuclei by washing with buffer of moderate salt concentration. Three high molecular weight cap binding proteins (approximately 120 000, approximately 89 000, approximately 80 000 dalton) were found in the nuclear fraction and were only partly released upon nuclease digestion and high salt extraction. Images PMID:6889136

  5. The Financial Management System: A Pivotal Tool for Fiscal Viability. CDS Spotlight. ECAR Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This spotlight focuses on data from the 2013 CDS to better understand how higher education institutions approach financial management systems. Information provided for this spotlight was derived from Module 8 of Core Data Service (CDS), which asked several questions regarding information systems and applications. Responses from 525 institutions…

  6. [Biosynthesis of CdS quantum dots in Saccharomyces cerevisiae and spectroscopic characterization].

    Science.gov (United States)

    Huang, Huai-qing; He, Ming-xin; Wang, Wen-xing; Liu, Jin-ling; Mi, Cong-cong; Xu, Shu-kun

    2012-04-01

    In the present work, CdS quantum dots (QDs) were successfully biosynthesized at room temperature by using saccharomyces cerevisiae yeast as a carrier. Fluorescence emission spectra, ultraviolet-visible (UV/Vis) absorption spectra, and inverted fluorescence microscope images confirmed that saccharomyces cerevisiae can be used to biosynthesize CdS QDs. The as-prepared CdS QDs show the fluorescence emission peak at 443 nm and emit blue-green fluorescence under UV light (with excitation at 365 nm). Transmission electron microscopy (TEM) was applied to characterize the as-prepared CdS QDs and the TEM results showed that the as-prepared CdS QDs had the structure of hexagonal wurtzite. Fluorescence emission spectrum and UV/Vis absorption spectrum were used as the performance indicatiors to study the effects of saccharomyces cerevisiae yeast incubation times, reactant Cd2+ concentrations and reaction times on CdS QDs synthesis. Saccharomyces cerevisiae yeast grown in early stable phase can get the highest fluorescence intensity of CdS QDs when they were co-cultured with 0.5 mmol x L(-1) of Cd2+ with 24 h incubation time. Furthermore, much more CdS QDs can be obtained by changing the culture medium during the synthesis process.

  7. BI Reporting, Data Warehouse Systems, and Beyond. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service [CDS] to better understand how higher education institutions approach business intelligence (BI) reporting and data warehouse systems (see the Sidebar for definitions). Information provided for this Spotlight was derived from Module 8 of CDS, which contains several questions regarding…

  8. A comparative study of CdS thin films deposited by different techniques

    Energy Technology Data Exchange (ETDEWEB)

    Pérez-Hernández, G., E-mail: german.perez@ujat.mx [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Pantoja-Enríquez, J. [Centro de Investigación y Desarrollo Tecnológico en Energías Renovables, UNICACH, Libramiento Norte No 1150, Tuxtla Gutiérrez, Chiapas 29039 (Mexico); Escobar-Morales, B. [Instituto Tecnológico de Cancún, Avenida Kábah Km 3, Cancún, Quintana Roo 77500 (Mexico); Martinez-Hernández, D.; Díaz-Flores, L.L.; Ricardez-Jiménez, C. [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Mathews, N.R.; Mathew, X. [Centro de Investigación en Energía, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico)

    2013-05-01

    Cadmium sulfide thin-films were deposited on glass slides and SnO{sub 2}:F coated glass substrates by chemical bath deposition, sputtering and close-spaced sublimation techniques. The films were studied for the structural and opto-electronic properties after annealing in an ambient identical to that employed in the fabrication of CdTe/CdS devices. Quantum efficiency of the CdTe/CdS solar cells fabricated with CdS buffer films prepared by the three methods were investigated to understand the role of CdS film preparation method on the blue response of the devices. The higher blue response observed for the devices fabricated with chemical bath deposited CdS film is discussed. - Highlights: ► CdS films were prepared by different techniques. ► Role of CdS on the blue response of device was studied. ► Structural and optical properties of CdS were analyzed. ► Chemically deposited CdS has high blue transmittance. ► CdS deposition method influences diffusion of S and Te.

  9. A new synthesis strategy for chiral CdS nanotubes based on a homochiral MOF template.

    Science.gov (United States)

    Kuang, Xuan; Ma, Yu; Zhang, Caiyun; Su, Hao; Zhang, Jine; Tang, Bo

    2015-04-07

    We describe for the first time a convenient technique to prepare helical CdS nanotubes, with a MOF as the template. The prepared helical CdS nanotubes were remarkably sensitive to D/L-aspartic acid (Asp) and can be used as a potential sensor for enantioselective recognition of D/L-Asp.

  10. Temperature dependence of the luminescence intensity in optical fibers of oxyfluoride glass with CdS and CdS x Se1 - x quantum dots

    Science.gov (United States)

    Agafonova, D. S.; Kolobkova, E. V.; Sidorov, A. I.

    2013-07-01

    The temperature dependences of the integral luminescence intensity in optical fibers of oxyfluoride glass with CdS and CdS x Se1 - x quantum dots have been studied in a temperature range of 25-250°C. It is established that heating in this range leads to luminescence quenching in accordance with a nearly linear law. This effect can be used for the creation of fiber-optic temperature sensors.

  11. Molecular recognition by gold, silver and copper nanoparticles

    OpenAIRE

    Tauran, Yannick; Brioude, Arnaud; Coleman, Anthony W.; Rhimi, Moez; Kim, Beonjoom

    2013-01-01

    The intrinsic physical properties of the noble metal nanoparticles, which are highly sensitive to the nature of their local molecular environment, make such systems ideal for the detection of molecular recognition events. The current review describes the state of the art concerning molecular recognition of Noble metal nanoparticles. In the first part the preparation of such nanoparticles is discussed along with methods of capping and stabilization. A brief discussion of the three common metho...

  12. RELIABILITY, VALIDITY, AND PSYCHOMETRIC PROPERTIES OF THE GREEK TRANSLATION OF THE CAMBRIDGE DEPERSONALIZATION SCALE (CDS).

    Science.gov (United States)

    Kontoangelos, Konstantinos; Tsiori, Sofia; Poulakou, Garyfalia; Protopapas, Konstantinos; Katsarolis, Ioannis; Sakka, Vissaria; Kavatha, Dimitra; Papadopoulos, Antonios; Antoniadou, Anastasia; Papageorgiou, Charalambos C

    2016-10-01

    The Cambridge Depersonalisation Scale is meant to capture the frequency and duration of depersonalisation symptoms over the 'last 6 months'. In order to develop a Greek version of CDS scale, the CDS scale was translated in Greek by 2 psychiatrists. Then, the Greek version of CDS scale was back-translated by a person who did not knew the original English version. The back-translated version was reviewed in order to establish whether is consistent with the original English version. After this procedure we administered the Greek version of CDS scale to a sample of 294 Greeks in order to assess the reliability and the validity of the Greek version of scale. The five components solution accounted for 58.204% of the total variation. Initial eigenvalues of the five components were: factor 1=11.555, factor 2=1.564, factor 3=1.356, factor 4=1.247 and factor 5=1.157. Six items did not load on any factor. Correlations between factors were low ranged from 0.134 to 0.314 and no complex variables were found. Cronbach's alpha and Guttman split-half coefficient were used to evaluate interval consistency of CDS scale in 294 individuals. The alpha coefficients and Guttman split-half coefficient of the CDS scale were 0.938 and 0.921, respectively. The test-retest reliability proved to be satisfactory. The intraclass correlation coefficients for the total CDS score was very good and equal to 0,883. The CDS scale correlated highly with the SCL-90 and all subscales (p-value<0.0001). The psychometric strength of CDS - Greek its reliable for its future use, particularly for screening for subjects with possible diagnosis of CDS.

  13. Analyses of hydraulic performance of velocity caps

    DEFF Research Database (Denmark)

    Christensen, Erik Damgaard; Degn Eskesen, Mark Chr.; Buhrkall, Jeppe

    2014-01-01

    The hydraulic performance of a velocity cap has been investigated. Velocity caps are often used in connection with offshore intakes. CFD (computational fluid dynamics) examined the flow through the cap openings and further down into the intake pipes. This was combined with dimension analyses...... in order to analyse the effect of different layouts on the flow characteristics. In particular, flow configurations going all the way through the structure were revealed. A couple of suggestions to minimize the risk for flow through have been tested....

  14. Anaerobic Toxicity of Cationic Silver Nanoparticles

    Science.gov (United States)

    The microbial toxicity of silver nanoparticles (AgNPs) stabilized with different capping agents was compared to that of Ag+ under anaerobic conditions. Three AgNPs were investigated: (1) negatively charged citrate-coated AgNPs (citrate-AgNPs), (2) minimally charged p...

  15. C-CAP Niihau 2005 Land Cover

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set consists of land cover derived from high resolution imagery according to the Coastal Change Analysis Program (C-CAP) protocol. This data set utilized 1...

  16. Circumpolar Active-Layer Permafrost System (CAPS)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Circumpolar Active-Layer Permafrost System (CAPS) contains over 100 data sets pertaining to permafrost and frozen ground topics. It also contains detailed...

  17. DESIGN CONSIDERATION INVOLVING ACTIVE SEDIMENT CAPS (PRESENTATION)

    Science.gov (United States)

    When contaminated sediments pose unacceptable risks to human health and the environment, management activities such as removal, treatment, or isolation of contaminated sediments may be required. Various capping designs are being considered for isolating contaminated sediment are...

  18. Mapping of p140Cap phosphorylation sites

    DEFF Research Database (Denmark)

    Repetto, Daniele; Aramu, Simona; Boeri Erba, Elisabetta

    2013-01-01

    Protein phosphorylation tightly regulates specific binding of effector proteins that control many diverse biological functions of cells (e. g. signaling, migration and proliferation). p140Cap is an adaptor protein, specifically expressed in brain, testis and epithelial cells, that undergoes...... phosphorylation and tunes its interactions with other regulatory molecules via post-translation modification. In this work, using mass spectrometry, we found that p140Cap is in vivo phosphorylated on tyrosine (Y) within the peptide GEGLpYADPYGLLHEGR (from now on referred to as EGLYA) as well as on three serine...... residues. Consistently, EGLYA has the highest score of in silico prediction of p140Cap phosphorylation. To further investigate the p140Cap function, we performed site specific mutagenesis on tyrosines inserted in EGLYA and EPLYA, a second sequence with the same highest score of phosphorylation. The mutant...

  19. C-CAP Land Cover, Maui, Hawaii

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set consists of land derived from high resolution imagery and was analyzed according to the Coastal Change Analysis Program (C-CAP) protocol to determine...

  20. DESIGN CONSIDERATION INVOLVING ACTIVE SEDIMENT CAPS

    Science.gov (United States)

    When contaminated sediments pose unacceptable risks to human health and the environment, management activities such as removal, treatment, or isolation of contaminated sediments may be required. Various capping designs are being considered for isolating contaminated sediment are...

  1. Righting an ATLAS end-cap

    CERN Document Server

    Maximilien Brice

    2003-01-01

    Each component of the giant ATLAS detector must be moved and transported with great caution so that delicate components are not damaged. Therefore, tests are performed, like the one shown. The end-cap weighs 160 tonnes, making the delicate moving process a non-trivial feat. A special crane and supports have been designed so that the end-cap can be raised using a pivot.

  2. Butea monosperma bark extract mediated green synthesis of silver nanoparticles: Characterization and biomedical applications

    National Research Council Canada - National Science Library

    Sutanuka Pattanayak; Md. Masud Rahaman Mollick; Dipanwita Maity; Sharmila Chakraborty; Sandeep Kumar Dash; Sourav Chattopadhyay; Somenath Roy; Dipankar Chattopadhyay; Mukut Chakraborty

    2017-01-01

    The work deals with an environmentally benign process for the synthesis of silver nanoparticle using Butea monosperma bark extract which is used both as a reducing as well as capping agent at room temperature...

  3. Synthesis and characterization of Ag-containing calcium phosphates with various Ca/P ratios

    Energy Technology Data Exchange (ETDEWEB)

    Gokcekaya, Ozkan, E-mail: gokcekaya@dc.tohoku.ac.jp [Department of Materials Processing, Tohoku University, 6-6-02 Aza Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Ueda, Kyosuke; Narushima, Takayuki [Department of Materials Processing, Tohoku University, 6-6-02 Aza Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Ergun, Celaletdin [Faculty of Mechanical Engineering, Istanbul Technical University, 65 Inonu Street, Gumussuyu, Istanbul 34437 (Turkey)

    2015-08-01

    Ag-containing calcium phosphate (CaP) powders were synthesized by a precipitation method using aqueous solutions of calcium nitrate, silver nitrate, and ammonium phosphate. The powders were sintered at temperatures ranging from 1173 to 1473 K. The charged atomic ratios of (Ca + Ag)/P and Ag/(Ca + Ag) in solution were varied from 1.33 to 1.67 and from 0 to 0.30, respectively. The Ag content in the as-precipitated CaP powders increased with the charged Ag/(Ca + Ag) atomic ratio in solution and was lower than the charged Ag/(Ca + Ag) value. The as-precipitated CaP powders consisted of hydroxyapatite (HA) as the main phase. Ag nanoparticles were observed on the as-precipitated HA particles under all conditions of Ag addition. After the sintering, HA, β-TCP (tricalcium phosphate), α-TCP, and β-CPP (calcium pyrophosphate) were mainly detected as CaPs on the basis of the Ca/P atomic ratio of the as-precipitated powders. The addition of Ag stabilized the β-TCP phase, and the distribution of Ag in β-TCP was homogeneous. A metallic Ag phase coexisted with HA. The solubility of Ag in HA was estimated to be 0.0019–0.0061 (Ag/(Ca + Ag)) atomic ratio, which was lower than that in β-TCP (higher than 0.0536) and higher than that of β-CPP (below the detection limit of analyses). - Highlights: • The HA powders with Ag nanoparticles were synthesized by a precipitation method. • Metallic Ag particles were detected with the HA phase after sintering. • The distribution of Ag in β-TCP was homogeneous after sintering. • The addition of Ag stabilized the β-ΤCP phase. • β-TCP exhibited higher solubility of Ag than HA and β-CPP.

  4. Fullerene (C60)/CdS nanocomposite with enhanced photocatalytic activity and stability

    Science.gov (United States)

    Cai, Qiang; Hu, Zhuofeng; Zhang, Qian; Li, Boyuan; Shen, Zhurui

    2017-05-01

    Herein, the fullerene (C60)/CdS nanocomposite has been fabricated by a facile one-pot hydrothermal method. Its photocatatlytic hydrogen (H2) evolution rate and degradation efficiency of Rhodamine B (Rh B) are evaluated under visible light irradiation (λ ≥ 420 nm). The content of C60 has been changed from 0.4 wt% to 8 wt%, and the optimal value for photocatalytic activity is determined to be 0.4 wt%. The H2 evolution rate over this optimal sample reaches 1.73 mmol h-1 g-1 and its apparent degradation rate of Rh B is 0.089 min-1 (degradation efficiency of 97% within 40 min), which is 2.3 times and 1.5 times compared to that of pure CdS reference. Moreover, the photocorrosion of CdS in composite is effectively suppressed, and its photocatalytic activity can be well maintained after three recycles (97.8% retaining for composite vs. 84.4% retaining for CdS). Then, the enhanced photocatalytic activity and stability of C60/CdS nanocomposite are further studied by spectroscopic and electrochemical methods. Results show that the C60 species covering on the surface of CdS can efficiently accelerate the separation and transfer of photoexcited charge carriers, which can improve its activity, and reduce the photocorrosion of CdS.

  5. Broad spectral response photodetector based on individual tin-doped CdS nanowire

    Directory of Open Access Journals (Sweden)

    Weichang Zhou

    2014-12-01

    Full Text Available High purity and tin-doped 1D CdS micro/nano-structures were synthesized by a convenient thermal evaporation method. SEM, EDS, XRD and TEM were used to examine the morphology, composition, phase structure and crystallinity of as-prepared samples. Raman spectrum was used to confirm tin doped into CdS effectively. The effect of impurity on the photoresponse properties of photodetectors made from these as-prepared pure and tin-doped CdS micro/nano-structures under excitation of light with different wavelength was investigated. Various photoconductive parameters such as responsivity, external quantum efficiency, response time and stability were analyzed to evaluate the advantage of doped nanowires and the feasibility for photodetector application. Comparison with pure CdS nanobelt, the tin-doped CdS nanowires response to broader spectral range while keep the excellect photoconductive parameters. Both trapped state induced by tin impurity and optical whispering gallery mode microcavity effect in the doped CdS nanowires contribute to the broader spectral response. The micro-photoluminescence was used to confirm the whispering gallery mode effect and deep trapped state in the doped CdS nanowires.

  6. Studies on cadmium sulphide nanoparticles formed by the Langmuir- Blodgett technique

    CERN Document Server

    Iwantono, M

    2003-01-01

    In this project, the formation and characterisation of CdS nanoparticles embedded within Langmuir-Blodgett (LB) films have been studied systematically. CdS nanoparticles were formed within calix[8]arene (CA) and stearic acid (SA) Cd-salt LB films by exposure to H sub 2 S gas at room temperature. The AFM images of the treated SA and CA bilayers show CdS clusters with lateral dimensions in the range of 20-30 nm and 10-15 nm, respectively. These particles are pseudo two-dimensional and have a shape of hexagonal platelets which is most likely consequence of their wurtzite structure. Calculations of the cluster thickness L sub z yield the value of 2 nm (Photoluminescence excitation-PLE) and 1.9 nm (UV-visible) for CdS clusters in SA matrix and two values of 1.2 nm and 1.6 nm (PLE) and 1.08 nm and 1.42 nm (UV-visible) for CA LB films. The PL spectra demonstrate a large Stokes shift, indicating the formation of 'dark excitons' in the platelet CdS clusters. The transformations of the absorption spectra caused by agei...

  7. Facile method to prepare CdS nanostructure based on the CdTe films

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Ligang; Chen, Yuehui; Wei, Zelu; Cai, Hongling; Zhang, Fengming; Wu, Xiaoshan, E-mail: xswu@nju.edu.cn

    2015-09-15

    Graphical abstract: - Highlights: • CdS nanostructure is directly fabricated on CdTe film only by heating treatment under H{sub 2}S/N{sub 2} mixed atmosphere at a relatively low temperature (450 °C) with gold layer as the intermediate. • Nanostructure of CdS layer, varying from nanowires to nanosheets, may be controlled by the thickness of gold film. • The change of morphology adjusts its luminescence properties. - Abstract: Nanostructured cadmium sulfide (CdS) plays critical roles in electronics and optoelectronics. In this paper, we report a method to fabricate CdS nanostructure directly on CdTe film, via a thermal annealing method in H{sub 2}S/N{sub 2} mixed gas flow at a relatively low temperature (450 °C). The microstructure and optical properties of CdS nanostructure are investigated by X-ray diffraction, transmission electron microscopy, Raman, and photoluminescence. The morphology of CdS nanostructure, evolving from nanowires to nanosheets, can be controlled by the thickness of Au film deposited on the CdTe film. And CdS nanostructures are single crystalline with the hexagonal wurtzite structure. Raman spectroscopy under varying the excitation wavelengths confirm that synthesized CdS-CdTe films contain two layers, i.e., CdS nanostructure (top) and CdTe layer (bottom). The change of morphology modifies its luminescence properties. Obviously, through simply thermal annealing in H{sub 2}S/N{sub 2} mixed gas, fabricating CdS nanostructure on CdTe film can open up the new possibility for obtaining high efficient CdTe solar cell.

  8. Fullerene (C{sub 60})/CdS nanocomposite with enhanced photocatalytic activity and stability

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Qiang [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Hu, Zhuofeng, E-mail: st04hzhf@gmail.com [Department of Chemistry, The Chinese University of Hong Kong, Shatin, New Territories, Hong Kong (China); Zhang, Qian; Li, Boyuan [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Shen, Zhurui, E-mail: shenzhurui@tju.edu.cn [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China)

    2017-05-01

    Highlights: • C{sub 60}/CdS nanocomposite has been fabricated as a novel visible-light-driven photocatalyst. • It exhibits enhanced photocatalytic activity and photostability than that of pure CdS reference. • The C{sub 60} improved the charge separation and transfer of nanocomposite due to its high electron affinity. - Abstract: Herein, the fullerene (C{sub 60})/CdS nanocomposite has been fabricated by a facile one-pot hydrothermal method. Its photocatatlytic hydrogen (H{sub 2}) evolution rate and degradation efficiency of Rhodamine B (Rh B) are evaluated under visible light irradiation (λ ≥ 420 nm). The content of C{sub 60} has been changed from 0.4 wt% to 8 wt%, and the optimal value for photocatalytic activity is determined to be 0.4 wt%. The H{sub 2} evolution rate over this optimal sample reaches 1.73 mmol h{sup −1} g{sup −1} and its apparent degradation rate of Rh B is 0.089 min{sup −1} (degradation efficiency of 97% within 40 min), which is 2.3 times and 1.5 times compared to that of pure CdS reference. Moreover, the photocorrosion of CdS in composite is effectively suppressed, and its photocatalytic activity can be well maintained after three recycles (97.8% retaining for composite vs. 84.4% retaining for CdS). Then, the enhanced photocatalytic activity and stability of C{sub 60}/CdS nanocomposite are further studied by spectroscopic and electrochemical methods. Results show that the C{sub 60} species covering on the surface of CdS can efficiently accelerate the separation and transfer of photoexcited charge carriers, which can improve its activity, and reduce the photocorrosion of CdS.

  9. Biphasic quantum dots of cubic and hexagonal Mn doped CdS; necessity of Rietveld analysis

    Energy Technology Data Exchange (ETDEWEB)

    Heiba, Zein K., E-mail: zein_kh@yahoo.com [Ain Shams University, Faculty of Science, Physics Department, Cairo (Egypt); Taif University, Faculty of Science, Physics Department (Saudi Arabia); Mohamed, Mohamed Bakr [Ain Shams University, Faculty of Science, Physics Department, Cairo (Egypt); Imam, N.G. [Experimental Physics Department, Nuclear Research Center, Atomic Energy Authority, 13759 Cairo (Egypt)

    2015-01-05

    Highlights: • Mn{sup 2+} doped CdS quantum dots (QDs) were prepared via a simple chemical synthesis procedure. • Biphasic composite of CdS QDs was revealed with maximum magnetism at 10 at.% of Mn{sup 2+}. • Rietveld structural analysis is a necessity for dealing with nano or quantum dots chalcogenides. • Full investigation of effects of Mn doping on the structural, optical and magnetic parameters. - Abstract: Mn{sup 2+} doped CdS quantum dots (QDs) were prepared via a simple chemical synthesis method. Incorporation of Mn ions into CdS QDs was monitored by structural, magnetic and optical spectroscopy analysis. Although the diffraction patterns seemed to be single wurtzite hexagonal structure, analysis revealed biphasic composite of CdS QDs hexagonal wurtzite and cubic zinc blende. The band gap, crystal phase and the morphology of CdS QDs were found not to be greatly affected by Mn{sup 2+} doping, however there was an optimal Mn{sup 2+} doping content of 10% where the magnetism is maximum. The recorded photoluminescence (PL) emission spectra, excited at 370 nm, depict emission lines in the UV and blue-shift regions. The emission band reveals that the band gap of pure CdS QDs is around 3 eV which is greater than that of bulk CdS (2.42 eV). The band gap of Mn:CdS QDs is almost independent of Mn content (x) and the crystallite size remains almost the same for all values of x. The observed structural, magnetic and optical properties have been explained on the basis of formation of two phases of CdS doped with Mn. This work aims to highlight recent advances in the synthesis of Mn:CdS diluted magnetic semiconductor quantum dots and their wonderful performance.

  10. Interactions of Native Cyclodextrins with Metal Ions and Inorganic Nanoparticles: Fertile Landscape for Chemistry and Materials Science.

    Science.gov (United States)

    Prochowicz, Daniel; Kornowicz, Arkadiusz; Lewiński, Janusz

    2017-11-22

    Readily available cyclodextrins (CDs) with an inherent hydrophobic internal cavity and hydrophilic external surface are macrocyclic entities that display a combination of molecular recognition and complexation properties with vital implications for host-guest supramolecular chemistry. While the host-guest chemistry of CDs has been widely recognized and led to their exploitation in a variety of important functions over the last five decades, these naturally occurring macrocyclic systems have emerged only recently as promising macrocyclic molecules to fabricate environmentally benign functional nanomaterials. This review surveys the development in the field paying special attention to the synthesis and emerging uses of various unmodified CD-metal complexes and CD-inorganic nanoparticle systems and identifies possible future directions. The association of a hydrophobic cavity of CDs with metal ions or various inorganic nanoparticles is a very appealing strategy for controlling the inorganic subunits properties in the very competitive water environment. In this review we provide the most prominent examples of unmodified CDs' inclusion complexes with organometallic guests and update the research in this field from the past decade. We discuss also the coordination flexibility of native CDs to metal ions in CD-based metal complexes and summarize the progress in the synthesis and characterization of CD-metal complexes and their use in catalysis and sensing as well as construction of molecular magnets. Then we provide a comprehensive overview of emerging applications of native CDs in materials science and nanotechnology. Remarkably, in the past few years CDs have appeared as attractive building units for the synthesis of carbohydrate metal-organic frameworks (CD-MOFs) in a combination of alkali-metal cations. The preparation of this new class of highly porous materials and their applications in the separation of small molecules, the loading of drug molecules, as well as

  11. Effect of the nature of cationic precursors for SILAR deposition on the performance of CdS and PbS/CdS quantum dot-sensitized solar cells

    Science.gov (United States)

    Liu, Yingbo; Li, Zhen; Yu, Libo; Sun, Shuqing

    2015-03-01

    In this work, the influences of cationic precursors on the quality of photoelectrode, consequently on the performance of the quantum dot-sensitized solar cells (QDSCs) have been studied. CdS QDSCs have been prepared using successive ionic layer absorption and reaction (SILAR) method. Three cadmium precursors including nitrate (Cd(NO3)2), chloride (CdCl2), and acetate (Cd(Ac)2) were employed for the synthesis and absorption of CdS nanoparticles on nanostructure TiO2 film. The loading amount and nanoparticle size of the CdS on mesoporous TiO2 film showed a significant difference while using various cadmium precursors in the same SILAR cycles. Both the light-harvesting ability and the obtained incident photon-to-current conversion efficiency values show the trend of deposition rate caused by cadmium precursors. Further, it was proposed that an effective cationic precursor could provide a good connection between QD sensitizer and TiO2 interface by electrochemical impedance spectroscopy analysis. Under AM 1.5 G full one sun illumination, the final power conversion efficiency of CdS QDSC based on Cd(Ac)2 was 2.10 %, and PCE values of 1.57 and 1.20 % were obtained for solar cells sensitized by CdS QDs prepared by CdCl2 and Cd(NO3)2, respectively. The cationic precursor effect was further applied in PbS/CdS co-sensitized solar cells. The PbS/CdS QDSCs based on acetate cationic precursors provide a photocurrent of 19.24 mA/cm2 and PCE of 3.23 % in comparison with 11.26 mA and 2.13 % obtained with nitrate acetate salts. Noticeably, the CdS and PbS/CdS QDSCs based on various cationic precursors prepared by SILAR exhibited good photocurrent stability under several light on-off cycles.

  12. Raman spectroscopy of optical properties in CdS thin films

    Directory of Open Access Journals (Sweden)

    Trajić J.

    2015-01-01

    Full Text Available Properties of CdS thin films were investigated applying atomic force microscopy (AFM and Raman spectroscopy. CdS thin films were prepared by using thermal evaporation technique under base pressure 2 x 10-5 torr. The quality of these films was investigated by AFM spectroscopy. We apply Raman scattering to investigate optical properties of CdS thin films, and reveal existence of surface optical phonon (SOP mode at 297 cm-1. Effective permittivity of mixture were modeled by Maxwell - Garnet approximation. [Projekat Ministarstva nauke Republike Srbije, br. 45003

  13. Effects of Capping Agent and Surfactant on the Morphology and Size of CoFe2O4 Nanostructures and Photocatalyst Properties

    Directory of Open Access Journals (Sweden)

    Mazyar Ahmadi Golsefidi

    2016-04-01

    Full Text Available In this work firstly CoFe2O4 nanoparticles were synthesized via a hydrothermal method. The temperature, surfactant and capping agent effects on the size of CoFe2O4 nanoparticles were investigated. 2-hydroxyacetophenone used as a good capping agent to produce cubic-like nanostructure. When SDBS used as surfactant, particles had spherical morphology. Nanoparticle was studied by scanning electron microscopy, X-ray diffraction, and Fourier transform infrared. We found that the CoFe2O4 nanoparticles were prepared exhibit a ferromagnetic behavior with a saturation magnetization of 20emu/g and a coercivity of 250 Oe. The photocatalytic behavior of CoFe2O4 was studied by the degradation of a methylene blue aqueous solution under ultraviolet light irradiation.

  14. 75 FR 49527 - Caps Visual Communications, LLC; Black Dot Group; Formerly Known as Caps Group Acquisition, LLC...

    Science.gov (United States)

    2010-08-13

    ... Employment and Training Administration Caps Visual Communications, LLC; Black Dot Group; Formerly Known as... Adjustment Assistance on June 24, 2010, applicable to workers of Caps Visual Communications, LLC, Black Dot..., Caps Visual Communications, LLC, Black Dot Group, formerly known as Caps Group Acquisition, LLC...

  15. Development of a Higher Fidelity Model for the Cascade Distillation Subsystem (CDS)

    Science.gov (United States)

    Perry, Bruce; Anderson, Molly

    2014-01-01

    Significant improvements have been made to the ACM model of the CDS, enabling accurate predictions of dynamic operations with fewer assumptions. The model has been utilized to predict how CDS performance would be impacted by changing operating parameters, revealing performance trade-offs and possibilities for improvement. CDS efficiency is driven by the THP coefficient of performance, which in turn is dependent on heat transfer within the system. Based on the remaining limitations of the simulation, priorities for further model development include: center dot Relaxing the assumption of total condensation center dot Incorporating dynamic simulation capability for the buildup of dissolved inert gasses in condensers center dot Examining CDS operation with more complex feeds center dot Extending heat transfer analysis to all surfaces

  16. Growth and characterization of CdS thin films on polymer substrates for photovoltaic applications.

    Science.gov (United States)

    Park, Yongseob; Kim, Eung Kwon; Lee, Suho; Lee, Jaehyeong

    2014-05-01

    In this work, cadmium sulfide (CdS) films were deposited on flexible polymer substrates such as polycarbonate (PC) and polyethylene terephthalate (PET). The r.f. magnetron sputtering, which is cost-effective scalable technique, was used for the film deposition. The structural and optical properties of the films grown at different sputtering pressures were investigated. When the CdS film was deposited at lower pressure, the crystallinity and the preferred orientation toward c-axis in hexagonal phase was improved. However, the optical transmittance was reduced as the sputtering pressure was decreased. Compared with the glass substrate, CdS films grown on polymer substrates were exhibited some wore structural and optical characteristics. CdTe thin film solar cell applied to sputtered CdS as a window layer showed a maximum efficiency of 11.6%.

  17. Enhanced Performance of DSSCs Based on the Insertion Energy Level of CdS Quantum Dots

    Directory of Open Access Journals (Sweden)

    Xiaoping Zou

    2014-01-01

    Full Text Available Cadmium sulfide (CdS quantum dots (QDs are assembled onto the TiO2 films by chemical bath deposition method (CBD. And the QDs size is controlled by the times of CBD cycles. They are characterized by UV-visible absorption. To avoid the photo corrosion and electrolyte corrosion, CdS and N719 are sequentially assembled onto the nanocrystalline TiO2 films to prepare a CdS/N719 cosensitized photo electrode for the dye-sensitized solar cells. In the structure of TiO2/CdS/N719 electrode, the reorganization of energy levels between CdS and N719 forms a stepwise structure of band-edge levels which is advantageous to the electron injection and hole recovery of CdS and N719 QDs. The open circuit voltage (Voc, short circuit current density (Jsc, and efficiency are increased.

  18. The preparation and degradation performance of CdS photocatalysts to methyl orange solution.

    Science.gov (United States)

    Duan, Limei; Zhao, Weiqiang; Xu, Ling; Chen, Xiaohong; Lita, A; Liu, Zongrui

    2013-03-01

    In this paper, the CdS samples were prepared using thiourea or sodium sulfide as sulfur source by hydrothermal or solvothermal synthesis method, the results of XRD, TEM and SEM showed all the samples belong to hexagonal CdS nano-material with different morphologies. Using the degradation of methyl orange solution as a model reaction, the photocatalytic performance of different CdS samples was measured, and the samples prepared using thiourea as sulfur source exhibited better photocatalytic activity than those using sodium sulfide as sulfur source. The factors on degradation effect were discussed including the pH value of degradation system and the type of light source. The degradation effect of CdS samples increased with the pH value decreased, and the degradation effect was better when the methyl orange solution was irradiated under sunlight than under 250 W mercury lamp.

  19. Smugglers, Fayuqueros, Piratas: Transitory Commodities and Illegality in the Trade of Pirated CDs in Mexico

    National Research Council Canada - National Science Library

    Aguiar, José Carlos G

    2013-01-01

    .... Based on ethnographic material, this article documents the rise of copied CDs in the San Juan de Dios market in Guadalajara, a marketplace that works as a hub for the smuggling of piracy in Mexico...

  20. Converting Homogeneous to Heterogeneous in Electrophilic Catalysis using Monodisperse Metal Nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Witham, Cole A.; Huang, Wenyu; Tsung, Chia-Kuang; Kuhn, John N.; Somorjai, Gabor A.; Toste, F. Dean

    2009-10-15

    A continuing goal in catalysis is the transformation of processes from homogeneous to heterogeneous. To this end, nanoparticles represent a new frontier in heterogeneous catalysis, where this conversion is supplemented by the ability to obtain new or divergent reactivity and selectivity. We report a novel method for applying heterogeneous catalysts to known homogeneous catalytic reactions through the design and synthesis of electrophilic platinum nanoparticles. These nanoparticles are selectively oxidized by the hypervalent iodine species PhICl{sub 2}, and catalyze a range of {pi}-bond activation reactions previously only homogeneously catalyzed. Multiple experimental methods are utilized to unambiguously verify the heterogeneity of the catalytic process. The discovery of treatments for nanoparticles that induce the desired homogeneous catalytic activity should lead to the further development of reactions previously inaccessible in heterogeneous catalysis. Furthermore, our size and capping agent study revealed that Pt PAMAM dendrimer-capped nanoparticles demonstrate superior activity and recyclability compared to larger, polymer-capped analogues.

  1. Chemically deposited TiO2/CdS bilayer system for ...

    Indian Academy of Sciences (India)

    Chemical bath deposition (CBD)method was employed to deposit CdS thin film on pre-deposited TiO2 film. A further study has beenmade for structural, surface morphological, optical and photoelectrochemical (PEC) properties of FTO/TiO2, FTO/CdS and FTO/TiO2/CdS bilayers system. PEC behaviour of FTO/TiO2/CdS ...

  2. Morphology and properties of electrodeposited CdS films in nonaqueous solvents

    Energy Technology Data Exchange (ETDEWEB)

    Fatas, E.; Herrasti, P.; Garcia, T.; Arjona, F.; Garcia Camarero, E.

    1985-11-01

    Semiconducting films of CdS are produced by cathodic deposition of Cd on stainless steel electrodes in the presence of dissolved S/sub 8/ in dimethylsulfoxide and diethylene glycol solutions. Uniform CdS films have been obtained by controlling growth parameters like current density and electrodeposition times. The transmittance spectra have been recorded and the band gap determined. The deposited phase has been examined by XRD analysis. (orig.).

  3. Gentamicin coated iron oxide nanoparticles as novel antibacterial agents

    Science.gov (United States)

    Bhattacharya, Proma; Neogi, Sudarsan

    2017-09-01

    Applications of different types of magnetic nanoparticles for biomedical purposes started a long time back. The concept of surface functionalization of the iron oxide nanoparticles with antibiotics is a novel technique which paves the path for further application of these nanoparticles by virtue of their property of superparamagnetism. In this paper, we have synthesized novel iron oxide nanoparticles surface functionalized with Gentamicin. The average size of the particles, concluded from the HR-TEM images, came to be around 14 nm and 10 nm for unmodified and modified nanoparticles, respectively. The magnetization curve M(H) obtained for these nanoparticles are typical of superparamagnetic nature and having almost zero values of coercivity and remanance. The release properties of the drug coated nanoparticles were studied; obtaining an S shaped profile, indicating the initial burst effect followed by gradual sustained release. In vitro investigations against various gram positive and gram negative strains viz Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa and Bacillus subtilis indicated significant antibacterial efficiency of the drug-nanoparticle conjugate. The MIC values indicated that a small amount like 0.2 mg ml-1 of drug capped particles induce about 98% bacterial death. The novelty of the work lies in the drug capping of the nanoparticles, which retains the superparamagnetic nature of the iron oxide nanoparticles and the medical properties of the drug simultaneously, which is found to extremely blood compatible.

  4. Green chemistry for nanoparticle synthesis.

    Science.gov (United States)

    Duan, Haohong; Wang, Dingsheng; Li, Yadong

    2015-08-21

    The application of the twelve principles of green chemistry in nanoparticle synthesis is a relatively new emerging issue concerning the sustainability. This field has received great attention in recent years due to its capability to design alternative, safer, energy efficient, and less toxic routes towards synthesis. These routes have been associated with the rational utilization of various substances in the nanoparticle preparations and synthetic methods, which have been broadly discussed in this tutorial review. This article is not meant to provide an exhaustive overview of green synthesis of nanoparticles, but to present several pivotal aspects of synthesis with environmental concerns, involving the selection and evaluation of nontoxic capping and reducing agents, the choice of innocuous solvents and the development of energy-efficient synthetic methods.

  5. Synthesis and characterization of CdS and CdSe nanoparticles ...

    Indian Academy of Sciences (India)

    2 [E = S (1), Se (2); M = Cd; Ox = 2-(4,4-dimethyl-2-oxazolinyl)benzene] by thermolysing in tri--octylphosphine oxide (TOPO) at 280°C, and their characterization by X-ray powder diffraction (XRD), transmission electron microscope (TEM) and ...

  6. Re-dispersible Li+ and Eu3+ co-doped CdS nanoparticles ...

    Indian Academy of Sciences (India)

    dispersible. PACS Nos 61.72.w; 61.46.Df; 81.20.Rg; 78.55.Qr; 76.30.Kg. 1. Introduction. Studies on the electronic and optical properties of semiconductor spherical quan- tum dots are important for various potential applications afforded by their size ...

  7. Thin CdS films prepared by metalorganic chemical vapor deposition

    Energy Technology Data Exchange (ETDEWEB)

    Hiroshi Uda; Yonezawa, Hideo; Ohtsubo, Yoshikazu; Kosaka, Manabu; Sonomura, Hajimu [Kinki Univ., Osaka (Japan). Faculty of Science and Technology

    2003-01-01

    Polycrystalline CdS thin films have been deposited on borosilicate glass substrates coated with ITO film by metalorganic chemical vapor deposition using dimethyl cadmium and diethyl sulfide as source materials. The growth of CdS film occurred at substrate temperatures within the range of 280-360{sup o}C. The deposition rate increased with increasing VI/II molar ratio at any substrate temperature and showed a maximum value at the VI/II molar ratio of 4. The grain size of as-deposited CdS film prepared at substrate temperatures from 300{sup o}C to 360{sup o}C was about 0.1 {mu}m. The CdS films consist of hexagonal form with a preferential orientation of the (0 0 2) plane parallel to the substrate. Thin CdS film with high optical transmittance was prepared at 350{sup o}C with the VI/II molar ratio of 4. The CdS film deposited by MOCVD may be used as a window layer for CdS/CdTe solar cell.(author)

  8. Tunable emission and conductivity enhancement by tellurium doping in CdS nanowires for optoelectronic applications

    Science.gov (United States)

    Kamran, Muhammad Arshad; Nabi, Ghulam; Majid, Abdul; Iqbal, Muhammad Waqas; Alharbi, Thamer; Zhang, Yongyou; Zou, Bingsuo

    2017-02-01

    Improvement of the optical and electrical characteristics is essential to get advanced performance from one dimensional (1D) material. Here, we report the first synthesis of a single crystalline Te-doped CdS nanowires (NWs) by a chemical-vapor-deposition (CVD) method. Room temperature photoluminescence (PL) spectra showed that Te concentration plays an important role in tuning emission color from orange to infrared (IR). Decrease in bandgap and PL intensity with increase in Te concentration was observed as compared to undoped CdS NWs. Red and IR emissions were found at 736.5 and 881 nm for doping concentration >6.06%. To our best knowledge, IR emission band has been observed for the first time in CdS NWs. Red-shift of LO phonon mode and its overtone in Raman spectra, and lifetime of red and IR emissions are longer than bandgap of host indicating the doping effect of CdS NWs. Energy-dispersive X-ray spectroscopy (EDS) and X-ray diffraction (XRD) of the Te-doped CdS NWs further confirms the presence of Te in the CdS NWs. Output characteristics confirm enhanced output current Ids with the increase in doping concentration. A possible growth mechanism was proposed. Doping technique offers to develop high-quality, a very stable, effective, and easily-applicable way to enhance the performance of one dimensional optoelectronic devices and solar cell applications.

  9. Optical and structural properties of sputtered CdS films for thin film solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Donguk [School of Electronic and Electrical Engineering, Sungkyunkwan University, Cheoncheon-dong 300, Jangan-gu, Suwon 440-746 (Korea, Republic of); Park, Young [High-Speed Railroad Infrastructure System Research Team, Korea Railroad Research Institute, Uiwang 437-757 (Korea, Republic of); Kim, Minha [School of Electronic and Electrical Engineering, Sungkyunkwan University, Cheoncheon-dong 300, Jangan-gu, Suwon 440-746 (Korea, Republic of); Choi, Youngkwan [Water Facility Research Center, K-water, 125, 1689 Beon-gil, Yuseong-daero, Yuseong-gu, Daejeon 305-730 (Korea, Republic of); Park, Yong Seob [Department of Photoelectronics Information, Chosun College of Science and Technology, Gwangju (Korea, Republic of); Lee, Jaehyoeng, E-mail: jaehyeong@skku.edu [School of Electronic and Electrical Engineering, Sungkyunkwan University, Cheoncheon-dong 300, Jangan-gu, Suwon 440-746 (Korea, Republic of)

    2015-09-15

    Graphical abstract: Photo current–voltage curves (a) and the quantum efficiency (QE) (b) for the solar cell with CdS film grown at 300 °C. - Highlights: • CdS thin films were grown by a RF magnetron sputtering method. • Influence of growth temperature on the properties of CdS films was investigated. • At higher T{sub g}, the crystallinity of the films improved and the grains enlarged. • CdS/CdTe solar cells with efficiencies of 9.41% were prepared at 300 °C. - Abstract: CdS thin films were prepared by radio frequency magnetron sputtering at various temperatures. The effects of growth temperature on crystallinity, surface morphology and optical properties of the films were characterized with X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), Raman spectra, UV–visible spectrophotometry, and photoluminescence (PL) spectra. As the growth temperature was increased, the crystallinity of the sputtered CdS films was improved and the grains were enlarged. The characteristics of CdS/CdTe thin film solar cell appeared to be significantly influenced by the growth temperature of the CdS films. Thin film CdS/CdTe solar cells with efficiencies of 9.41% were prepared at a growth temperature of 300 °C.

  10. CdS thin films prepared by laser assisted chemical bath deposition

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, L.V.; Mendivil, M.I.; Garcia Guillen, G.; Aguilar Martinez, J.A. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G.A.; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2015-05-01

    Highlights: • CdS thin films by conventional CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • Improved dark conductivity and good photocurrent response for the LACBD CdS. - Abstract: In this work, we report the preparation and characterization of CdS thin films by laser assisted chemical bath deposition (LACBD). CdS thin films were prepared from a chemical bath containing cadmium chloride, triethanolamine, ammonium hydroxide and thiourea under various deposition conditions. The thin films were deposited by in situ irradiation of the bath using a continuous laser of wavelength 532 nm, varying the power density. The thin films obtained during deposition of 10, 20 and 30 min were analyzed. The changes in morphology, structure, composition, optical and electrical properties of the CdS thin films due to in situ irradiation of the bath were analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV–vis spectroscopy. The thin films obtained by LACBD were nanocrystalline, photoconductive and presented interesting morphologies. The results showed that LACBD is an effective synthesis technique to obtain nanocrystalline CdS thin films having good optoelectronic properties.

  11. Simulation of sovereign CDS market based on interaction between market participant

    Science.gov (United States)

    Ko, Bonggyun; Kim, Kyungwon

    2017-08-01

    A research for distributional property of financial asset is the subject of intense interest not only for financial theory but also for practitioner. Such respect is no exception to CDS market. The CDS market, which began to receive attention since the global financial debacle, is not well researched despite of the importance of research necessity. This research introduces creation of CDS market and use Ising system utilizing occurrence characteristics (to shift risk) as an important factor. Therefore the results of this paper would be of great assistance to both financial theory and practice. From this study, not only distributional property of the CDS market but also various statistics like multifractal characteristics could promote understanding about the market. A salient point in this study is that countries are mainly clustering into 2 groups and it might be because of market situation and geographical characteristics of each country. This paper suggested 2 simulation parameters representing this market based on understanding such CDS market situation. The estimated parameters are suitable for high and low risk event of CDS market respectively and these two parameters are complementary and can cover not only basic statistics but also multifractal properties of most countries. Therefore these estimated parameters can be used in researches preparing for a certain event (high or low risk). Finally this research will serve as a momentum double-checking indirectly the performance of Ising system based on these results.

  12. Synthesis, optical, structural, and electrical properties of single-crystalline CdS nanobelts

    Energy Technology Data Exchange (ETDEWEB)

    Alqahtani, Mohammed S. [King Saud University, Department of Physics and Astronomy, Riyadh (Saudi Arabia); Hadia, N.M.A.; Mohamed, S.H. [Sohag University, Physics Department, Faculty of Science, Sohag (Egypt)

    2017-04-15

    CdS nanobelts (NBs) were synthesized by vapor transport of CdS powders. The growth was carried out without any catalyst on quartz and Si (100) substrates. The synthesized CdS NBs were examined by transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM) and selected area electron diffraction (SAED), high-resolution transmission electron microscopy (HR-TEM), X-ray powder diffraction (XRD), energy dispersion analysis of X-ray (EDAX), spectrophotometer, and photoluminescence spectroscopy. CdS NBs were indexed as hexagonal wurtzite structure. The growth was via vapor-solid growth mechanism and along the [100] direction. The refractive index was evaluated in the transparent region, as suggested by Swanepoel, using the envelope method. The refractive index values and the extinction coefficient were decreased by increasing the wavelength. The calculated optical band gap was 2.50 eV. The photoluminescence (PL) spectrum of the synthesized CdS NBs exhibited a green emission peak at 510 nm and a broad red emission peak at 696 nm. The conductivity measurements were achieved, in the temperature range from 300 to 600 K, using the conventional two-probe technique. Two different slopes with different activation energies of 0.618 and 0.215 eV were obtained. The CdS NBs are likely being novel functional materials. Thus, they can be used in the manufacture of innovative optoelectronic nanodevices. (orig.)

  13. Synthesis, optical, structural, and electrical properties of single-crystalline CdS nanobelts

    Science.gov (United States)

    Alqahtani, Mohammed S.; Hadia, N. M. A.; Mohamed, S. H.

    2017-04-01

    CdS nanobelts (NBs) were synthesized by vapor transport of CdS powders. The growth was carried out without any catalyst on quartz and Si (100) substrates. The synthesized CdS NBs were examined by transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM) and selected area electron diffraction (SAED), high-resolution transmission electron microscopy (HR-TEM), X-ray powder diffraction (XRD), energy dispersion analysis of X-ray (EDAX), spectrophotometer, and photoluminescence spectroscopy. CdS NBs were indexed as hexagonal wurtzite structure. The growth was via vapor-solid growth mechanism and along the [100] direction. The refractive index was evaluated in the transparent region, as suggested by Swanepoel, using the envelope method. The refractive index values and the extinction coefficient were decreased by increasing the wavelength. The calculated optical band gap was 2.50 eV. The photoluminescence (PL) spectrum of the synthesized CdS NBs exhibited a green emission peak at 510 nm and a broad red emission peak at 696 nm. The conductivity measurements were achieved, in the temperature range from 300 to 600 K, using the conventional two-probe technique. Two different slopes with different activation energies of 0.618 and 0.215 eV were obtained. The CdS NBs are likely being novel functional materials. Thus, they can be used in the manufacture of innovative optoelectronic nanodevices.

  14. Seismic explosion sources on an ice cap

    DEFF Research Database (Denmark)

    Shulgin, Alexey; Thybo, Hans

    2015-01-01

    Controlled source seismic investigation of crustal structure below ice covers is an emerging technique. We have recently conducted an explosive refraction/wide-angle reflection seismic experiment on the ice cap in east-central Greenland. The data-quality is high for all shot points and a full...... crustal model can be modelled. A crucial challenge for applying the technique is to control the sources. Here, we present data that describe the efficiency of explosive sources in the ice cover. Analysis of the data shows, that the ice cap traps a significant amount of energy, which is observed...... as a strong ice wave. The ice cap leads to low transmission of energy into the crust such that charges need be larger than in conventional onshore experiments to obtain reliable seismic signals. The strong reflection coefficient at the base of the ice generates strong multiples which may mask for secondary...

  15. Martian north polar cap summer water cycle

    Science.gov (United States)

    Brown, Adrian J.; Calvin, Wendy M.; Becerra, Patricio; Byrne, Shane

    2016-10-01

    A key outstanding question in Martian science is "are the polar caps gaining or losing mass and what are the implications for past, current and future climate?" To address this question, we use observations from the Compact Reconnaissance Imaging Spectrometer for Mars (CRISM) of the north polar cap during late summer for multiple Martian years, to monitor the summertime water cycle in order to place quantitative limits on the amount of water ice deposited and sublimed in late summer. We establish here for the first time the summer cycle of water ice absorption band signatures on the north polar cap. We show that in a key region in the interior of the north polar cap, the absorption band depths grow until Ls = 120, when they begin to shrink, until they are obscured at the end of summer by the north polar hood. This behavior is transferable over the entire north polar cap, where in late summer regions 'flip' from being net sublimating into net condensation mode. This transition or 'mode flip' happens earlier for regions closer to the pole, and later for regions close to the periphery of the cap. The observations and calculations presented herein estimate that on average a water ice layer ∼70 microns thick is deposited during the Ls = 135-164 period. This is far larger than the results of deposition on the south pole during summer, where an average layer 0.6-6 microns deep has been estimated by Brown et al. (2014) Earth Planet. Sci. Lett., 406, 102-109.

  16. Photon correlation spectroscopic and spectrophotometric studies of the formation of cadmium sulfide nanoparticles in ammonia-thiourea solutions

    Science.gov (United States)

    Bulavchenko, A. I.; Kolodin, A. N.; Podlipskaya, T. Yu.; Demidova, M. G.; Maksimovskii, E. A.; Beizel', N. F.; Larionov, S. V.; Okotrub, A. V.

    2016-05-01

    Nucleation of CdS in an aqueous ammonia solution of thiourea and cadmium chloride was studied by photon correlation spectroscopy (PCS), static light scattering, and spectrophotometry. The hydrodynamic diameter of nanoparticles, light scattering intensity, and optical density of the solutions increased with temperature and synthesis time. The processes of formation, growth, and coagulation of nanoparticles can be transferred from solution to the filter surface by continuously filtering the reaction mixture through a 200-nm filter.

  17. Green synthesis of silver nanoparticle using Bambusa arundinacea leaves

    Science.gov (United States)

    Kataria, Bharat; Shyam, Vasvani; Kaushik, Babiya; Vasoya, Jaydeep; Joseph, Joyce; Savaliya, Chirag; Kumar, Sumit; Parikh, Sachin P.; Thakar, C. M.; Pandya, D. D.; Ravalia, A. B.; Markna, J. H.; Shah, N. A.

    2017-05-01

    The synthesis of nanoparticles using ecofriendly way is an interesting area in advance nanotechnology. Silver (Ag) nanoparticles are usually synthesized by chemicals route, which are quite flammable and toxic in nature. This study deals with a biosynthesis process (environment friendly) of silver nanoparticles using Bambusa arundinacea leaves for its antibacterial activity. The formation and characterization of AgNPs was confirmed by UV-Vis spectroscopy. Silver nanoparticles were successfully synthesized from AgNO3 through a simple green route using the latex of Bambusa arundinacea leaves as reducing as well as capping agent. Scanning Electron Microscopy (SEM) study indicates the formation of grains (particles) with different size and shape.

  18. Assembling the CMS yoke end-caps

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    A crane is used to piece together one of the end-caps that will provide the path for magnetic flux return on the CMS experiment. A total of six end-cap discs will be assembled before being positioned on the barrel yoke to complete the huge 12 500 tonne cylinder yoke. The magnetic field produced will be greater than any other solenoid created to date at 4 T, 100 000 times greater than the Earth's natural magnetic field, and will store enough energy to melt 18 tonnes of gold.

  19. Does uncertainty justify intensity emission caps?

    OpenAIRE

    Quirion, Philippe

    2005-01-01

    International audience; Environmental policies often set ‘‘relative'' or ‘‘intensity'' emission caps, i.e. emission limits proportional to the polluting firm's output. One of the arguments put forth in favour of relative caps is based on the uncertainty on business-as-usual output: if the firm's production level is higher than expected, so will be business-as-usual emissions, hence reaching a given level of emissions will be more costly than expected.As a consequence, it is argued, a higher e...

  20. Cytotoxicity and oxidative stress induced by different metallic nanoparticles on human kidney cells

    Directory of Open Access Journals (Sweden)

    Ohayon-Courtès Céline

    2011-03-01

    Full Text Available Abstract Background Some manufactured nanoparticles are metal-based and have a wide variety of applications in electronic, engineering and medicine. Until now, many studies have described the potential toxicity of NPs on pulmonary target, while little attention has been paid to kidney which is considered to be a secondary target organ. The objective of this study, on human renal culture cells, was to assess the toxicity profile of metallic nanoparticles (TiO2, ZnO and CdS usable in industrial production. Comparative studies were conducted, to identify whether particle properties impact cytotoxicity by altering the intracellular oxidative status. Results Nanoparticles were first characterized by size, surface charge, dispersion and solubility. Cytotoxicity of NPs was then evaluated in IP15 (glomerular mesangial and HK-2 (epithelial proximal cell lines. ZnO and CdS NPs significantly increased the cell mortality, in a dose-dependent manner. Cytotoxic effects were correlated with the physicochemical properties of NPs tested and the cell type used. Analysis of reactive oxygen species and intracellular levels of reduced and oxidized glutathione revealed that particles induced stress according to their composition, size and solubility. Protein involved in oxidative stress such as NF-κb was activated with ZnO and CdS nanoparticles. Such effects were not observed with TiO2 nanoparticles. Conclusion On glomerular and tubular human renal cells, ZnO and CdS nanoparticles exerted cytotoxic effects that were correlated with metal composition, particle scale and metal solubility. ROS production and oxidative stress induction clearly indicated their nephrotoxic potential.