Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from underway - surface observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from the CAPE HATTERAS in the Gulf of Mexico from 2009-01-09 to 2010-03-21 (NODC Accession 0115765)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115765 includes chemical, meteorological, physical and underway - surface data collected from CAPE HATTERAS in the Gulf of Mexico from 2009-01-09 to...

Rates of Dinitrogen Fixation and the Abundance of Diazotrophs in North American Coastal Waters Between Cape Hatteras and Georges Bank

Science.gov (United States)

Mulholland, M.R.; Bernhardt, P. W.; Blanco-Garcia, J. L.; Mannino, A.; Hyde, K.; Mondragon, E.; Turk, K.; Moisander, P. H.; Zehr, J. P.

2012-01-01

We coupled dinitrogen (N2) fixation rate estimates with molecular biological methods to determine the activity and abundance of diazotrophs in coastal waters along the temperate North American Mid-Atlantic continental shelf during multiple seasons and cruises. Volumetric rates of N2 fixation were as high as 49.8 nmol N L(sup -1) d(sup -1) and areal rates as high as 837.9 micromol N m(sup -2) d(sup -1) in our study area. Our results suggest that N2 fixation occurs at high rates in coastal shelf waters that were previously thought to be unimportant sites of N2 fixation and so were excluded from calculations of pelagic marine N2 fixation. Unicellular N2-fixing group A cyanobacteria were the most abundant diazotrophs in the Atlantic coastal waters and their abundance was comparable to, or higher than, that measured in oceanic regimes where they were discovered. High rates of N2 fixation and the high abundance of diazotrophs along the North American Mid-Atlantic continental shelf highlight the need to revise marine N budgets to include coastal N2 fixation. Integrating areal rates of N2 fixation over the continental shelf area between Cape Hatteras and Nova Scotia, the estimated N2 fixation in this temperate shelf system is about 0.02 Tmol N yr(sup -1), the amount previously calculated for the entire North Atlantic continental shelf. Additional studies should provide spatially, temporally, and seasonally resolved rate estimates from coastal systems to better constrain N inputs via N2 fixation from the neritic zone.

Endeavor cruise 071 navigation and bathymetry, northern Hatteras Abyssal Plain

International Nuclear Information System (INIS)

Laine, E.P.; Friedrich, N.E.; McCreery, C.; Dickson, S.; Baker, M.

1985-01-01

Sub-bottom seismic profiling was carried out by R/V Endeavor during the summers of 1980 and 1981. Data collection was concentrated in LLWODP study area E-N3, which encompasses the northern Hatteras Abyssal Plain and the adjacent lower continental rise. Time, position, and depth were logged and marked on the seismic record at 15-minute intervals. These navigational and bathymetric data have been used to produce a time/position/depth listing, and a detailed bathymetric map of the northern Hatteras Abyssal Plain and surrounding physiographic provinces. 6 figures, 1 table

Seismic echo character northern Hatteras Abyssal Plain

International Nuclear Information System (INIS)

McCreery, C.J.; Laine, E.P.

1985-01-01

Latest efforts in echo-character mapping of the northern Hatteras Abyssal Plain have discerned variations in thickness in a near-surface sedimentary sequence which has been designated seismic unit A. This unit probably represents the last episode of progradation of the Hatteras Deep Sea Fan in the southern part of the study area, and has infilled probable paleochannels from the Wilmington Canyon and Sohm Gap in the north. Unit A thins to a minimum in the central part of the plain, where older sediments come within 1 meter of the surface. Variations in the character of the surface reflector probably represent differing degrees of microtopography developed on a Late Pleistocene surface overlain by Holocene sediments. With the exception of one area identified as a relict surface outcropping in the western plain, this microtopography seems related to present-day thalweg locations on the abyssal plain. 11 references, 13 figures

Ocean-Bottom Topography: The Divide between the Sohm and Hatteras Abyssal Plains.

Science.gov (United States)

Pratt, R M

1965-06-18

A compilation of precision echo soundings has delineated the complex topography between the Sohm and Hatteras abyssal plains off the Atlantic coast of the United States. At present the divide between the two plains is a broad, flat area about 4950 meters deep; however, the configuration of channels and depressions suggests spillage of turbidity currents from the Sohm Plain into the Hatteras Plain and a shifting of the divide toward the northeast. Hudson Canyon terminates in the divide area and has probably fed sediment into both plains.

Late Quarternary evolution of the northern Hatteras Abyssal Plain

International Nuclear Information System (INIS)

Dickson, S.M.; Laine, E.P.

1986-05-01

The sedimentary history and seismic structure of a deep-water turbidite basin in the Western North Atlantic Ocean has been investigated to understand further the evolution of abyssal plains. This study integrates analyses of sedimentary and seismic facies in order to examine the temporal and spatial patterns of sedimentation on the northern Hatteras Abyssal Plain during the Late Quaternary. Forty deep-sea sediment cores and 6000 km of high resolution (3.5 kHz) seismic reflection profiles from within 31-34 0 N and 69-74 0 W include portions of the Hatteras Outer Ridge, Lower Continental Rise and Bermuda Rise as well as the northern Hatteras Abyssal Plain. Seismic profiles (within 32-33 0 N, 70-71.5 0 W) define two acoustically-transparent seismic units beneath the Plain. The composition of these seismic units has been investigated with sediment cores. This study has found two notable features in the sedimentary framework of the Plain that appear to have resulted from temporal changes in sediment supply. The most recent change, a postglacial decline in turbidity current activity, produced a diagenetic iron enrichment at the Pleistocene-Holocene boundary. The stratigraphic thickness affected by diagenesis is related spatially to patterns of turbidite sedimentation. An earlier change, discovered in this research, occurred during the Wisconsinian glaciation and brought coarser-grained turbidity currents to the northern Plain. Deposition of sands from these flows appears to have been locally controlled by a broad topographic feature with less than ten meters relief. As a result of the topographic influence, there are abrupt boundaries, both verically and laterally, between an older mud facies and a younger sandy turbidite facies of the Plain

cape_hatteras.grd

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NGDC builds and distributes high-resolution, coastal digital elevation models (DEMs) that integrate ocean bathymetry and land topography to support NOAA's mission to...

77 FR 50376 - Drawbridge Operation Regulation, Atlantic Intracoastal Waterway (AIWW); Wrightsville Beach, NC...

Science.gov (United States)

2012-08-21

... duration that the moveable bridges will be maintained in the closed position. The races have been reserved... of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8; and the Isabel S. Holmes...

77 FR 25652 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway (AIWW), at Wrightsville Beach, NC...

Science.gov (United States)

2012-05-01

... are expected to have minimal impacts on mariners due to the short duration that the moveable bridges... North Carolina Department of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8...

Patterns in stable isotope values of nitrogen and carbon in particulate matter from the Northwest Atlantic Continental Shelf, from the Gulf of Maine to Cape Hatteras

Directory of Open Access Journals (Sweden)

Autumn Oczkowski

2016-12-01

Full Text Available Stable isotope measurements of nitrogen and carbon (δ15N, δ13C are often used to characterize estuarine, nearshore, and open ocean ecosystems. Reliable information about the spatial distribution of base-level stable isotope values, often represented by primary producers, is critical to interpreting values in these ecosystems. While base-level isotope data are generally readily available for estuaries, nearshore coastal waters, and the open ocean, the continental shelf is less studied. To address this, and as a first step towards developing a surrogate for base-level isotopic signature in this region, we collected surface and deep water samples from the United States’ eastern continental shelf in the Western Atlantic Ocean, from the Gulf of Maine to Cape Hatteras, periodically between 2000 and 2013. During the study, particulate matter δ15N values ranged from 0.8 to 17.4 ‰, and δ13C values from -26.4 to -15.6 ‰ over the region. We used spatial autocorrelation analysis and random forest modeling to examine the spatial trends and potential environmental drivers of the stable isotope values. We observed general trends towards lower values for both nitrogen and carbon isotopes at the seaward edge of the shelf. Conversely, higher δ15N and δ13C values were observed on the landward edge of the shelf, in particular in the southern portion of the sampling area. Across all sites, the magnitude of the difference between the δ15N of subsurface and surface particulate matter (PM significantly increased with water depth (r2 = 0.41, df = 35, p < 0.001, while δ13C values did not change. There were significant positive correlation between δ15N and δ13C values for surface PM in each of the three marine ecoregions that make up the study area. Stable isotope dynamics on the shelf can inform both nearshore and open ocean research efforts, reflecting regional productivity patterns and, even possibly, large-scale climate fluctuations.

Primary cutaneous malignancies in the Northern Cape Province of ...

African Journals Online (AJOL)

size, the Northern Cape (NC) Province has the smallest population of the ... whether skin cancer incidence in SA has followed the global trend.[12] ... high risk of mortality.[16] As ... 2012 was conducted using public and private health sector databases. .... majority of KSs occurred in the younger age group 30 - 39 years.

Oceanography Branch Plankton Database

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Shelf-wide Research Vessel Surveys are conducted 4-8 times per year over the continental shelf from Cape Hatteras, North Carolina to Cape Sable, Nova Scotia, using...

Long-term monitoring reveals cold-water corals in extreme conditions off the southeast US coast

Science.gov (United States)

Mienis, F.; Duineveld, G.; Davies, A. J.; Ross, S. W.; Lavaleye, M.; Van Weering, T.

2011-12-01

Cold-water corals are common on the SE slope of the US (SEUS) from Florida to Cape Hatteras between depths of 400-600 m. Near Cape Hatteras cold-water corals have formed mound structures that are up to 60 m high, which are mainly covered by living colonies of the coral species Lophelia pertusa. Past explorations of major reef sites of N Carolina using remote and manned submersibles have shown living Lophelia pertusa colonies on the current facing side of the mound structures and a high biodiversity of associated fauna, especially fish. The coral areas lie in the vicinity of the Gulf Stream characterized by strong currents transporting relatively warm water northwards along the SEUS slope. Thus far little is known about the environmental conditions inside the SEUS coral communities and particularly the effects of the nearby Gulf Stream. In December 2009 two autonomous benthic landers were deployed amidst Lophelia reefs off Cape Lookout (NC) for a period of 6 months to define oceanographic patterns that are relevant for the development and persistence of cold-water coral ecosystems. Landers recorded temperature, fluorescence, turbidity, and current speed and direction. Furthermore, a sediment trap was mounted on the landers that collected material at a 16-days interval. A first analysis of the lander data shows that instability of the Gulf Stream causes rapid rises in temperature, current speed and turbidity lasting for days to more than a week. Peak temperature and turbidity levels are the highest measured in coral habitats studied so far. We did not see clear cut effects of Gulf Stream instabilities on the near bed flux of phytodetritus as opposed to reports of meanders inducing upwelling and enhanced production in the photic zone. Data analyzed so far suggest that cwc habitats of Cape Lookout experience extreme and adverse conditions for prolonged periods. The findings of this study are compared with methodologically similar studies that have been conducted in

Marine Environmental Planning Guide for the Hampton Roads/Norfolk Operating Area.

Science.gov (United States)

1974-05-01

algae of the American coast between Cape May, New Jersey, and Cape Hatteras, North Carolina, I. The Cyanophyta. Botanica Marina, 9, pp. 101-128, 1966...oBell, C. E. Marine microbiology, Chronica Botanica Co. Publ., Waltham, Mass., 240p., 194T. I 169 APPENDIX A. PHYSICAL DATA 169 76** 75 " 74 " 73 1264

Atlantic Surfclam and Ocean Quahog Survey

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The standardized NEFSC Atlantic Surfclam and Ocean Quahog Survey has covered an area from Cape Hatteras to Georges Bank. The survey was conducted every two or three...

Oceanographic data collected during the Atlantic Deep-Water Canyons: Pathways to the Abyss 2011 on NOAA Ship Nancy Foster in the North Atlantic Ocean from 2011-06-04 to 2011-06-17 (NODC Accession 0082240)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Submarine canyons are dominant features of the outer continental shelf and slope of the US East coast from Cape Hatteras to the Gulf of Maine. They are important...

Sea Scallop Survey

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The standardized NEFSC Sea Scallop Survey began in 1980 and has covered an area from Cape Hatteras to Georges Bank. The survey aims to determine the distribution and...

76 FR 38302 - Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA

Science.gov (United States)

2011-06-30

... the Town of Cape Charles will sponsor a fireworks display on the shoreline of the navigable waters of...-AA00 Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA AGENCY: Coast Guard... navigable waters of Cape Charles City Harbor in Cape Charles, VA in support of the Fourth of July Fireworks...

make up.contents pg

African Journals Online (AJOL)

spamer

canalized inlets on the south-west side of the harbour and supply minimal .... lometric turbidity units – NTU) were measured during the collection of each sample. ...... occurring in the western North Atlantic Ocean, Cape Hatteras to the southern ...

75 FR 8047 - Notice of Intent To Prepare a Draft Environmental Impact Statement for the Proposed Duke Energy...

Science.gov (United States)

2010-02-23

... communities of either Avon, Buxton, Frisco, or Hatteras, NC. Power generated by this project would be supplied... factors. These environmental considerations were combined with wind power, geology and foundation analyses... used in development of future wind power projects. Proposed Impacts to Wetlands and Surface Waters...

76 FR 27970 - Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA.

Science.gov (United States)

2011-05-13

... Charles will sponsor a fireworks display on the shoreline of the navigable waters of Cape Charles City...[deg]01'30'' W (NAD 1983). This safety zone will be established in the vicinity of Cape Charles, VA...-AA00 Safety Zone; Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA. AGENCY: Coast Guard...

77 FR 37324 - Safety Zone; Major Motion Picture Filming, Cape Fear River; Wilmington, NC

Science.gov (United States)

2012-06-21

... vessels from a portion of the Cape Fear River due to the filming of a movie involving high speed boat..., given the high risks of injury and damage that will be created during the filming of the movie, a delay... Planning and Review This rule is not a significant regulatory action under section 3(f) of Executive Order...

77 FR 29929 - Safety Zone; Town of Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA

Science.gov (United States)

2012-05-21

... section of this notice. Basis and Purpose On July 4, 2012 the Town of Cape Charles will sponsor a...-AA00 Safety Zone; Town of Cape Charles Fireworks, Cape Charles Harbor, Cape Charles, VA AGENCY: Coast... temporary safety zone on the waters of Cape Charles City Harbor in Cape Charles, VA in support of the Fourth...

77 FR 8449 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Nine Bexar...

Science.gov (United States)

2012-02-14

... Center for Biological Diversity, Citizens Alliance for Smart Expansion, and Aquifer Guardians in Urban... climate change, pollution, invasive species, and stochastic events. Our Response: While we agree that...'t of Interior, 344 F.Supp.2d 108, 124 (D.D.C. 2004) (``Cape Hatteras''); Home Builders Ass'n of...

Present and past Gulf Stream variability in a cold-water coral area off Cape Lookout, West Atlantic

Science.gov (United States)

Mienis, F.; Pedersen, A.; Duineveld, G.; Seidenkrantz, M.; Fischel, A.; Matos, L.; Bane, J. M.; Frank, N.; Hebbeln, D.; Ross, S.

2012-12-01

Cold-water coral mounds are common on the SE slope of the US from Florida to Cape Hatteras between depths of 400-600 m. All coral areas lie in the vicinity of the Gulf Stream, which is characterized by strong currents transporting relatively warm water northwards. Thus far little is known about the recent and past environmental conditions inside the cold-water coral habitats on the SE US slope and particularly the effect of changing patterns of the Gulf Stream. Near Cape Lookout, which is the northern most cold-water coral area on the SE US slope, cold-water corals have formed mounds up to 60 m high with a tear drop shape, which are oriented in a SSW-NNE direction. Past explorations of major reef sites of N Carolina using remote and manned submersibles have shown living Lophelia pertusa colonies on the current facing side of the mound structures and a high biodiversity of associated fauna, especially fish. Two autonomous benthic landers were deployed amidst Lophelia reefs off Cape Lookout (NC) for a period of 6 months to define oceanographic patterns that are relevant for the development and persistence of cold-water coral ecosystems. Furthermore, a 3.6 m long piston core was collected in 2010 during a cruise with the R.V. Pelagia. This pistoncore was used to determine the changes of current strength through time, using foraminiferal counts, stable oxygen and carbon isotopes on foraminifera, XRF and magnetic susceptibility measurements. Cold-water coral fragments were dated with U/Th and foraminifera from the same depth interval were dated with C14. Bottom landers have recorded a number of events that are characterized by of peaks in temperature and salinity, coinciding with increased flow and turbidity. The current during these events was directed to the NNE. During some of these events temperature rose up to 9 degrees in one day. The temporary replacement of the colder bottom water by warm (and saline) water in combination with the strong currents to the NNE

Cape Hatteras, North Carolina Coastal Digital Elevation Model

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's National Geophysical Data Center (NGDC) is building high-resolution digital elevation models (DEMs) for select U.S. coastal regions. These integrated...

The Capes Current: a summer countercurrent flowing past Cape Leeuwin and Cape Naturaliste, Western Australia

Science.gov (United States)

Pearce, Alan; Pattiaratchi, Charitha

1999-03-01

Although the dominant boundary current off Western Australia is the poleward-flowing Leeuwin Current, satellite imagery shows that there is a cool equatorward coastal countercurrent running close inshore in the extreme southwest during the summer months. This seasonal current has been named the Capes Current as it appears to be strongest between Cape Leeuwin (34°20'S) and Cape Naturaliste (33°30'S), and it is probably linked with the general northward shelf current which has been observed previously along most of the Western Australian coastline further north. Strong northwards wind stresses between November and March slow the Leeuwin Current (which moves offshore) and drive the Capes Current, and there may be localised upwelling as well (Gersbach et al., Continental Shelf Research, 1998). It has important implications for the salmon fishery as it may affect the migration of adult salmon around Cape Leeuwin at this time of year.

46 CFR 7.45 - Cape Henlopen, DE to Cape Charles, VA.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henlopen, DE to Cape Charles, VA. 7.45 Section 7.45... Atlantic Coast § 7.45 Cape Henlopen, DE to Cape Charles, VA. (a) A line drawn from the easternmost extremity of Indian River Inlet North Jetty to latitude 38°36.5′ N. longitude 75°02.8′ W. (Indian River...

Acoustic structure and echo character of surficial sediments of the northern Hatteras Abyssal Plain

International Nuclear Information System (INIS)

McCreery, C.J.; Laine, E.P.

1986-05-01

A study has been made of the high frequency acoustic response of abyssal plain depositional facies. Piston cores have been obtained at six stations and deep hydrophone recordings at three stations on the northern Hatteras Abyssal Plain. 3.5 kHz seismic profiles indicate acoustically transparent lobes of surficial sediment which thicken towards the Hatteral Transverse Canyon and Sohm Gap/Wilmington Fan. Physical property data from piston cores indicate a higher percentage of coarse sediment in the areas of transparent acoustic response. Many of the characteristics normally used in mapping of conventional 3.5 kHz profiler acoustic response varied only slightly in the study area. Regions of diffuse 3.5 kHz surface echoes, similar to prolonged echoes attributed to high percent sand beds, have been identified in the study area. High trace to trace variation in deep hydrophone/pinger recordings in these areas suggests that the diffuse echo returns are due to unresolved microtopography and are not necessarily associated with a sandy seafloor

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

The relevance of social contexts and social action in reducing substance use and victimization among women participating in an HIV prevention intervention in Cape Town, South Africa

Directory of Open Access Journals (Sweden)

Reed E

2013-06-01

Full Text Available Elizabeth Reed,1 Andrea N Emanuel,2 Bronwyn Myers,3,4 Kim Johnson,3 Wendee M Wechsberg2,5–7 1George Washington University School of Public Health, Department of Prevention and Community Health, Washington, DC, USA; 2RTI International, Research Triangle Park, NC, USA; 3Alcohol and Drug Abuse Research Unit, Medical Research Council, Cape Town, South Africa; 4Department of Psychiatry and Mental Health, University of Cape Town, Cape Town, South Africa; 5Gillings Global School of Public Health, University of North Carolina, Chapel Hill, NC, USA; 6Psychology in the Public Interest, North Carolina State University, NC, USA; 7Psychiatry and Behavioral Sciences, Duke University School of Medicine, NC, USA Objectives: To examine qualitatively how women's social context and community mobilization (eg, mobilizing women to take social action and engaging their community in social change influence substance use abstinence and victimization among women participating in a human immunodeficiency virus (HIV intervention in Cape Town, South Africa. Methods: Thirty women who had participated in a randomized controlled trial of a group-delivered intervention to address substance use, gender-based violence, and associated risk for HIV (The Women's Health CoOp were selected to participate in semi-structured interviews about their perceived impact of the intervention on their substance use and exposure to victimization. The Women's CoOp intervention involved creating a new positive social environment for women within a group setting that also fostered women's social action (eg, educating peers or family members in the community. Interviews were analyzed using content analysis and coded to examine women's descriptions of social contexts and social action, and the influence of these on women's substance use abstinence and exposure to victimization. Results: Social support (eg, via program staff and other participants and social action (eg, engaging others in the

33 CFR 80.505 - Cape Henlopen, DE to Cape Charles, VA.

Science.gov (United States)

2010-07-01

... to Cape Charles, VA. (a) A line drawn from the seaward extremity of Indian River Inlet North Jetty to Indian River Inlet South Jetty Light. (b) A line drawn from Ocean City Inlet Light 6, 225° true across... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Henlopen, DE to Cape Charles...

Intercomparison of the Gulf Stream in ocean reanalyses: 1993-2010

Science.gov (United States)

Chi, Lequan; Wolfe, Christopher L. P.; Hameed, Sultan

2018-05-01

In recent years, significant progress has been made in the development of high-resolution ocean reanalysis products. This paper compares aspects of the Gulf Stream (GS) from the Florida Straits to south of the Grand Banks-particularly Florida Strait transport, separation of the GS near Cape Hatteras, GS properties along the Oleander Line (from New Jersey to Bermuda), GS path, and the GS north wall positions-in 13 widely used global reanalysis products of various resolutions, including two unconstrained products. A large spread across reanalysis products is found. HYCOM and GLORYS2v4 stand out for their superior performance by most metrics. Some common biases are found in all discussed models; for example, the velocity structure of the GS near the Oleander Line is too symmetrical and the maximum velocity is too weak compared with observations. Less than half of the reanalysis products show significant correlations (at the 95% confidence level) with observations for the GS separation latitude at Cape Hatteras, the GS transport, and net transport across Oleander Line. The cross-stream velocity structure is further discussed by a theoretical model idealizing GS as a smoothed PV front.

Cape Verde

Science.gov (United States)

2007-01-01

This Mars Exploration Rover Opportunity Pancam 'super resolution' mosaic of the approximately 6 m (20 foot) high cliff face of the Cape Verde promontory was taken by the rover from inside Victoria Crater, during the rover's descent into Duck Bay. Super-resolution is an imaging technique which utilizes information from multiple pictures of the same target in order to generate an image with a higher resolution than any of the individual images. Cape Verde is a geologically rich outcrop and is teaching scientists about how rocks at Victoria crater were modified since they were deposited long ago. This image complements super resolution mosaics obtained at Cape St. Mary and Cape St. Vincent and is consistent with the hypothesis that Victoria crater is located in the middle of what used to be an ancient sand dune field. Many rover team scientists are hoping to be able to eventually drive the rover closer to these layered rocks in the hopes of measuring their chemistry and mineralogy. This is a Mars Exploration Rover Opportunity Panoramic Camera image mosaic acquired on sols 1342 and 1356 (November 2 and 17, 2007), and was constructed from a mathematical combination of 64 different blue filter (480 nm) images.

Cape Kennedy Thunderstorms Data

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Cape Kennedy Thunderstorms Data contains an account of all thunderstorms reported in weather observations taken at Cape Kennedy Air Force Station, Florida between...

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

A 'private adventure'? John Herschel's Cape voyage and the production of the 'Cape Results'

Science.gov (United States)

Ruskin, Steven William

2002-07-01

This dissertation considers the life of John Herschel (1792 1871) from the years 1833 to 1847. In 1833 Herschel sailed from London to Cape Town, southern Africa, to undertake (at his own expense) an astronomical exploration of the southern heavens, as well as a terrestrial exploration of the area around Cape Town. After his return to England in 1838, he was highly esteemed and became Britain's most recognized scientist. In 1847 his southern hemisphere astronomical observations were published as the Cape Results. The main argument of this dissertation is that Herschel's voyage, and the publication of the Cape Results, in addition to their contemporary scientific importance, were also significant for nineteenth-century politics and culture. This dissertation is a two-part dissertation. The first part is entitled “John Herschel's Cape Voyage: Private Science, Public Imagination, and the Ambitions of Empire”; and the second part, “The Production of the Cape Results.” In the first part it is demonstrated that the reason for Herschel's cultural renown was the popular notion that his voyage to the Cape was a project aligned with the imperial ambitions of the British government. By leaving England for one of its colonies, and pursuing there a significant scientific project, Herschel was seen in the same light as other British men of science who had also undertaken voyages of exploration and discovery. It is then demonstrated, in the second part of this work, that the production of the Cape Results, in part because of Herschel's status as Britain's scientific figurehead, was a significant political and cultural event. In addition to the narrow area of Herschel scholarship, this dissertation touches on other areas of research in the history of science as well: science and culture, science and empire, science and politics, and what has been called the “new” history of scientific books.

Species Profiles: Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates South Florida, Ladyfish and Tarpon

Science.gov (United States)

1989-07-01

Elops saurus England (but uncommon north of Cape Linnaeus (Robins et al. TW T Hatteras) to Rio de Janeiro , Brazil, Preferred common name... lagoons , and coastal habitats (Breder (1966) in the laboratory from Stage 1944; Dahlberg 1972; Gilmore et al. III larvae (18.1-22.7 mm SL; mean, 1981...Biological Report 82P1104)--’ T R EL.82.4. /c0.- July 1989. 0t Species Profiles: Life Histories and Environmental Requirements of Coastal Fishes DT

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

Synthesis and characterization of small size fluorescent LEEH caped blue emission ZnTe quantum dots

Directory of Open Access Journals (Sweden)

Patnaik Sumanta Kumar

2017-04-01

Full Text Available We report here for the first time the synthesis of LEEH caped very small size (2 nm ZnTe quantum dots at low temperature (less than 100 °C using a simple chemical route. The effects of aging and stirring time on the absorption spectra of the quantum dots were investigated. The synthesized nanocrystal (NC was characterized by PL, TEM, XRD and the formation of very small size quantum dots having FCC structure was confirmed. Further, blue emission from the prepared sample was observed during exposure to monochromatic UV radiation. ZnTe NCs obtained in this study were found to be more stable compared to those presented in literature reports. ZnTe NCs may be considered as a new material in place of CdTe for optoelectronics devices.

Extended late Holocene relative sea-level histories for North Carolina, USA

Science.gov (United States)

Kemp, Andrew C.; Kegel, Jessica J.; Culver, Stephen J.; Barber, Donald C.; Mallinson, David J.; Leorri, Eduardo; Bernhardt, Christopher E.; Cahill, Niamh; Riggs, Stanley R.; Woodson, Anna L.; Mulligan, Ryan P.; Horton, Benjamin P.

2017-03-01

We produced ∼3000-year long relative sea-level (RSL) histories for two sites in North Carolina (USA) using foraminifera preserved in new and existing cores of dated salt-marsh sediment. At Cedar Island, RSL rose by ∼2.4 m during the past ∼3000 years compared to ∼3.3 m at Roanoke Island. This spatial difference arises primarily from differential GIA that caused late Holocene RSL rise to be 0.1-0.2 mm/yr faster at Roanoke Island than at Cedar Island. However, a non-linear difference in RSL between the two study regions (particularly from ∼0 CE to ∼1250 CE) indicates that additional local- to regional-scale processes drove centennial-scale RSL change in North Carolina. Therefore, the Cedar Island and Roanoke Island records should be considered as independent of one another. Between-site differences on sub-millennial timescales cannot be adequately explained by non-stationary tides, sediment compaction, or local sediment dynamics. We propose that a period of accelerating RSL rise from ∼600 CE to 1100 CE that is present at Roanoke Island (and other sites north of Cape Hatteras at least as far as Connecticut), but absent at Cedar Island (and other sites south of Cape Hatteras at least as far as northeastern Florida) is a local-to regional-scale effect of dynamic ocean and/or atmospheric circulation.

Characteristics of storms driving wave-induced seafloor mobility on the U.S. East Coast continental shelf

Science.gov (United States)

Dalyander, P. Soupy; Butman, Bradford

2015-01-01

This study investigates the relationship between spatial and temporal patterns of wave-driven sediment mobility events on the U.S. East Coast continental shelf and the characteristics of the storms responsible for them. Mobility events, defined as seafloor wave stress exceedance of the critical stress of 0.35 mm diameter sand (0.2160 Pa) for 12 or more hours, were identified from surface wave observations at National Data Buoy Center buoys in the Middle Atlantic Bight (MAB) and South Atlantic Bight (SAB) over the period of 1997-2007. In water depths ranging from 36-48 m, there were 4-9 mobility events/year of 1-2 days duration. Integrated wave stress during events (IWAVES) was used as a combined metric of wave-driven mobility intensity and duration. In the MAB, over 67% of IWAVES was caused by extratropical storms, while in the SAB, greater than 66% of IWAVES was caused by tropical storms. On average, mobility events were caused by waves generated by storms located 800+ km away. Far-field hurricanes generated swell 2-4 days before the waves caused mobility on the shelf. Throughout most of the SAB, mobility events were driven by storms to the south, east, and west. In the MAB and near Cape Hatteras, winds from more northerly storms and low-pressure extratropical systems in the mid-western U.S. also drove mobility events. Waves generated by storms off the SAB generated mobility events along the entire U.S. East Coast shelf north to Cape Cod, while Cape Hatteras shielded the SAB area from swell originating to the north offshore of the MAB.

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

Morphological characteristics of Cape sugarbirds ( Promerops cafer ...

African Journals Online (AJOL)

Cape sugarbirds (Promerops cafer) are the largest nectarivores in the Western Cape and feed almost exclusively on protea nectar and associated arthropods. Helderberg Nature Reserve, Western Cape, South Africa, has a large diversity of Protea and supports breeding sugarbirds. As part of a larger study, we captured ...

Geologic history of Cape Cod, Massachusetts

Science.gov (United States)

,

1976-01-01

Cape Cod, a sandy peninsula built mostly during the Ice Age, juts into the Atlantic Ocean like a crooked arm. Because of its exposed location, Cape Cod was visited by many early explorers. Although clear-cut evidence is lacking, the Vikings may have sighted this land about 1,000 years ago. It was visited by Samuel de Champlain in 1605, and his detailed descriptions and charts have helped present-day scientists to determine the rate of growth of Nauset Beach marsh and Nauset spit. Bartholomew Gosnold, a lesser known explorer, settled for a short time on the Elizabeth Islands to the southwest and gave Cape Cod its name in 1602. The Pilgrims first landed in America on the tip of Lower Cape Cod after they were turned back from their more southerly destination by shoals between Cape Cod and Nantucket Island. On Cape Cod they found potable water and food and had their first fight with the natives. The Pilgrims, however, decided that this land was too isolated, too exposed, and too sandy to support them, and they sailed across Cape Cod Bay to establish Plymouth. These features remain today. Small villages are separated by large areas of forest, dune, beach, and marsh. This unspoiled natural beauty makes Cape Cod one of the most favored vacation areas for the people living in the thickly settled Northeastern States. Cape Cod is of particular interest to geologists because it was formed by glaciers very recently in terms of geologic time. During the Great Ice Age, (the Pleistocene Epoch which began 2 to 3 million years ago), glaciers advanced from the north into the temperate regions of the Earth. Glacial ice covered the land at least four times. Each advance was accompanied by a worldwide lowering of sea level because the source of the ice was water from the seas. When the glaciers melted, the climate and sea level were probably much like they are today. In fact, some scientists believe that the Earth is presently between glacial episodes and that ice once again will

33 CFR 117.823 - Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Fear River. 117.823 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.823 Cape Fear River. The draw of the Cape Fear Memorial Bridge, mile 26.8, at Wilmington need not open for the passage of vessel from 8...

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

Extended late Holocene relative sea-level histories for North Carolina, USA

Science.gov (United States)

Kemp, Andrew C.; Kegel, Jessica J.; Culver, Stephen J.; Barber, Donald C.; Mallinson, David J.; Leorri, Eduardo; Bernhardt, Christopher E.; Cahill, Niamh; Riggs, Stanley R.; Woodson, Anna L.; Mulligan, Ryan P.; Horton, Benjamin P.

2017-01-01

We produced ∼3000-year long relative sea-level (RSL) histories for two sites in North Carolina (USA) using foraminifera preserved in new and existing cores of dated salt-marsh sediment. At Cedar Island, RSL rose by ∼2.4 m during the past ∼3000 years compared to ∼3.3 m at Roanoke Island. This spatial difference arises primarily from differential GIA that caused late Holocene RSL rise to be 0.1–0.2 mm/yr faster at Roanoke Island than at Cedar Island. However, a non-linear difference in RSL between the two study regions (particularly from ∼0 CE to ∼1250 CE) indicates that additional local- to regional-scale processes drove centennial-scale RSL change in North Carolina. Therefore, the Cedar Island and Roanoke Island records should be considered as independent of one another. Between-site differences on sub-millennial timescales cannot be adequately explained by non-stationary tides, sediment compaction, or local sediment dynamics. We propose that a period of accelerating RSL rise from ∼600 CE to 1100 CE that is present at Roanoke Island (and other sites north of Cape Hatteras at least as far as Connecticut), but absent at Cedar Island (and other sites south of Cape Hatteras at least as far as northeastern Florida) is a local-to regional-scale effect of dynamic ocean and/or atmospheric circulation.

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

The Humansdorp Cape Griffon Site

African Journals Online (AJOL)

ZeldaH

Figure 1. The cliff north-west of the town of Humansdorp, Eastern Cape, South Africa, where a small group of Cape Griffons Gyps coprotheres roosted, and reportedly bred, until the end of the. 19 th century. The trees seen in the picture are all alien, invasive, black wattles Acacia mearnsii. (Photo: A Boshoff).

Simulation Of Aqua-Ammonia Refrigeration System Using The Cape-Open To Cape-Open COCO Simulator

Directory of Open Access Journals (Sweden)

Janavi Gohil

2017-03-01

Full Text Available In this paper we have simulated a flow sheet of aqua ammonia refrigeration system using Cape Open simulator. The main aim of writing this paper is to compare the results obtained from thermodynamic simulation of aqua ammonia refrigeration system and the results obtained from the flow sheet simulation in Cape-Open to Cape-Open COCO simulator. The corresponding COP values obtained from both the sources are calculated and compared. With the error being very minute the calculations using simulator prove to be more efficient and timesaving when compared to the results obtained by calculations done using tedious thermodynamic simulations and constant mass balance for different process conditions.

33 CFR 117.829 - Northeast Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast Cape Fear River. 117... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.829 Northeast Cape... the Seaboard System Railroad Bridge across the Northeast Cape Fear River, mile 27.0, at Castle Hayne...

Patterns of plant speciation in the Cape floristic region.

Science.gov (United States)

van der Niet, Timotheüs; Johnson, Steven D

2009-04-01

Plant species have accumulated in the Cape region of southern Africa to a much greater degree than in areas of equivalent size in the rest of the subcontinent. Although this could be a consequence simply of lower extinction rates in the Cape, most researchers have invoked high rates of ecological speciation, driven by unique aspects of the Cape environment, as the primary explanation for this richness. To assess these ideas, we analyzed the frequencies of ecological shifts among 188 sister species pairs obtained from molecular phylogenies of eight Cape clades. Ecological shifts were evident in 80% of sister species pairs, with general habitat, pollinator, and fire-survival strategy shifts being especially frequent. Contrary to an established idea that shifts in soil type are frequently associated with speciation of Cape taxa, these shifts were relatively rare, occurring in just 17% of species pairs. More cases of sister species divergence are accompanied solely by floral than by vegetative diversification, suggesting an important role for pollinator-driven speciation. In an analysis of two large orchid genera that have radiated in both the Cape and the rest of southern Africa, the frequency of ecological shifts (general habitat, soil type, altitude and flowering time), did not differ between sister species pairs in the Cape region and those outside it. Despite suggestions that Cape plants tend to have small range sizes and show fine-scale patterns of speciation, range size did not differ significantly between species in the Cape and those outside it. We conclude that ecological speciation is likely to have been important for radiation of the Cape flora, but there is no evidence as yet for special "Cape" patterns of ecological speciation.

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

H08249: NOS Hydrographic Survey , Cape Hatteras, North Carolina, 1955-07-22

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

High resolution near-bed observations in winter near Cape Hatteras, North Carolina

Science.gov (United States)

Martini, Marinna A.; Armstrong, Brandy N.; Warner, John C.

2010-01-01

The U.S. Geological Survey (USGS) Coastal and Marine Science Center in Woods Hole, Massachusetts, is leading an effort to understand the regional sediment dynamics along the coastline of North and South Carolina. As part of the Carolinas Coastal Change Processes Project, a geologic framework study in June of 2008 by the Woods Hole Coastal and Marine Science Center's Sea Floor Mapping Group focused on the seaward limit of Diamond Shoals and provided high resolution bathymetric data, surficial sediment characteristics, and subsurface geologic stratigraphy. These data also provided unprecedented guidance to identify deployment locations for tripods and moorings to investigate the processes that control sediment transport at Diamond Shoals. Equipment was deployed at three sites from early January, 2009 through early May, 2009: north and south of the shoals at 15 m depth, and at the tip at 24 m depth. Many strong storm systems were recorded during that time period. Mounted on the tripods were instruments to measure surface waves, pressure, current velocity, bottom turbulence, suspended-sediment profiles, and sea-floor sand-ripple bedforms. Many instruments were designed and programmed to sample in high resolution in time and space, as fast as 8 Hz hourly bursts and as small as 6 cm bin sizes in near bottom profiles. A second tripod at the north site also held a visual camera system and sonar imaging system which document seafloor bedforms. The region is known for its dynamics, and one of the tripods tipped over towards the end of the experiment. A preliminary look at the data suggests the region is characterized by high energy. Raw data from a burst recorded at the south site on Mar. 26th show instantaneous flow speed at 150 cm/s at 0.5 m above the seabed. This paper reports preliminary highlights of the observations, based on raw data, and lessons learned from a deployment of large tripod systems in such a dynamic location.

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

Foraging range and habitat use by Cape Vulture Gyps coprotheres from the Msikaba colony, Eastern Cape province, South Africa

Directory of Open Access Journals (Sweden)

Morgan B. Pfeiffer

2015-05-01

Full Text Available Despite the extent of subsistence farmland in Africa, little is known about endangered species that persist within them. The Cape Vulture (Gyps coprotheres is regionally endangered in southern Africa and at least 20% of the population breeds in the subsistence farmland area previously known as the Transkei in the Eastern Cape province of South Africa. To understand their movement ecology, adult Cape Vultures (n = 9 were captured and fitted with global positioning system/global system for mobile transmitters. Minimum convex polygons (MCPs,and 99% and 50% kernel density estimates (KDEs were calculated for the breeding and non breeding seasons of the Cape Vulture. Land use maps were constructed for each 99% KDE and vulture locations were overlaid. During the non-breeding season, ranges were slightly larger(mean [± SE] MCP = 16 887 km2 ± 366 km2 than the breeding season (MCP = 14 707 km2 ± 2155 km2. Breeding and non-breeding season MCPs overlapped by a total of 92%. Kernel density estimates showed seasonal variability. During the breeding season, Cape Vultures used subsistence farmland, natural woodland and protected areas more than expected. In the non-breeding season, vultures used natural woodland and subsistence farmland more than expected, and protected areas less than expected. In both seasons, human-altered landscapes were used less, except for subsistence farmland. Conservation implications: These results highlight the importance of subsistence farm land to the survival of the Cape Vulture. Efforts should be made to minimise potential threats to vultures in the core areas outlined, through outreach programmes and mitigation measures.The conservation buffer of 40 km around Cape Vulture breeding colonies should be increased to 50 km.

Surviving gangs, violence and racism in cape town

DEFF Research Database (Denmark)

Lindegaard, Marie Rosenkrantz

Surviving Gangs, Violence and Racism in Cape Town offers an ethnographic study of young men in Cape Town and considers how they stay safe in when growing up in post-apartheid South Africa. Breaking away from previous studies looking at structural inequality and differences, this unique book focus...... they move between "black" or "coloured" township areas and the "white" suburbs of Cape Town....

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Comparison of nectar foraging efficiency in the Cape honeybee ...

African Journals Online (AJOL)

1987-03-17

Mar 17, 1987 ... Comparison of nectar foraging efficiency in the Cape honeybee, Apis mellifera capensis Escholtz, and the African honeybee, Apis mellifera adansonii Latreille,. , in the western Cape Province. P.V. W-Worswick*. Department of Zoology, University of Cape Town, Rondebosch 7700 Republic of South Africa.

Cape anchovy Engraulis capensis spawn mainly east of Cape Point ...

African Journals Online (AJOL)

spamer

In the southern Benguela, successful recruitment of Cape anchovy Engraulis capensis is ... Based on the total area of 16–19°C water on the western Agulhas. Bank, Richardson et al. .... in the zone, φ the new value, and β is a relaxation pa-.

Development of STEP-NC Adaptor for Advanced Web Manufacturing System

Science.gov (United States)

Ajay Konapala, Mr.; Koona, Ramji, Dr.

2017-08-01

Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

Pore water geochemistry and the oxidation of sedimentary organic matter: Hatteras Abyssal Plain 1981

International Nuclear Information System (INIS)

Heggie, D.; Lewis, T.; Graham, D.

1985-01-01

This report presents the pore water geochemistry from R/V an Endeavor cruise to an area of the Hatteras Abyssal Plain between 31 0 45' - 34 0 00'N and 69 0 37.5 - 72 0 07.5'W. The authors report on the down core variations of the products of organic matter oxidation, the stoichiometry of reactions and make a preliminary assessment of the rates of organic matter oxidation at several core locations. The authors found concentrations of total inorganic nitrogen species; nitrate, nitrite and ammonia in pore waters to be less than those predicted from a model of organic matter oxidation (Froelich et al. 1979) in sediments. The observations indicate that nitrogen is depleted over carbon as compared to typical marine organic matter. The down-core nitrate profiles over the study area were used to infer depths at which oxygen is near totally consumed in the sediments and hence to compute rates of oxygen consumption. The authors found oxygen consumption rates to vary by nearly an order of magnitude between core locations (1.7 - >15μmO 2 cm -2 yr -1 ). A simple model which combines the computed rates of oxidant consumption and the stoichiometry of organic matter oxidation was used to make estimates of organic carbon oxidation rates. These latter were found to vary between 1.3 and > 11.5 μm C cm -2 yr -1 . Highest carbon oxidation rates were found at the western boundary of the study area, and in all cases oxygen consumption was responsible for >85% of carbon oxidized. 11 references, 5 figures, 4 tables

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

Stock-environment recruitment analysis for Namibian Cape hake ...

African Journals Online (AJOL)

Stock-environment recruitment analysis for Namibian Cape hake Merluccius capensis. ... The factors modulating recruitment success of Cape hake Merluccius capensis in Namibian waters are still unresolved. ... AJOL African Journals Online.

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

75 FR 81637 - Commercial Lease for the Cape Wind Energy Project

Science.gov (United States)

2010-12-28

... Commercial Lease for the Cape Wind Energy Project AGENCY: Bureau of Ocean Energy Management, Regulation and... Renewable Energy Development on the Outer Continental Shelf (``OCS'') for the Cape Wind Energy Project... requirements of 30 CFR 285.231. The Lease is for the Cape Wind Energy Project (``Project'') which grants Cape...

The Cape doctor 1807-1910: perspectives.

Science.gov (United States)

Phillips, Howard

2004-01-01

This chapter contrasts the Cape doctor in 1807 and in 1910, and finds that, in a whole variety of ways, the differences between the two were not of degree but of kind. Underlying this sea-change was the germ revolution of the late Victorian era, which transformed the Cape doctor out of all recognition, thereby laying important foundations for the development of the twentieth-century South African doctor.

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

Cape Kennedy Weather Data

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Digitized data taken from original weather observations taken at Cape Kennedy Air Force Station, Florida. Elements recorded are wind speed and direction,...

GREENHOUSE-GROWN CAPE GOOSEBERRY

African Journals Online (AJOL)

/2006 S 4,00. Printed in Uganda. All rights reserved O2006, African Crop Science Society. SHORT COMMINICATION. EFFECT OF GIBBERRELLIC ACID ON GROWTH AND FRUIT YIELD OF. GREENHOUSE-GROWN CAPE GOOSEBERRY.

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

The Cape Times's portrayal of school violence

Directory of Open Access Journals (Sweden)

Corene de Wet

2016-05-01

Full Text Available This study explores the Cape Times's portrayal of school violence in the Western Cape (WC, South Africa, reporting on findings from a qualitative content analysis of 41 news articles retrieved from the SA Media database. The findings shed light on the victims and their victimisation, the perpetrators, as well as the context of the violence, identifying gangsterism, as well as school administrative and community factors as the reasons for violence in WC schools. It is argued that school violence and gangsterism are inextricably linked to the Cape Flats in particular, and that the interaction of forms of inequality and oppression such as racism, class privilege and gender oppression are structural root causes for school violence in this area of the WC. The study highlights the negative consequences of school violence on teaching and learning and on the economy. It is concluded that even if the Cape Times paints an exaggerated and atypical picture of violence in the gang-riddled parts of the WC, the detrimental effects thereof on the regions cannot be denied. The study therefore recommends a holistic approach to addressing the structural root causes of school violence where it takes place in the WC.

Final Report of the Mid-Atlantic Marine Wildlife Surveys, Modeling, and Data

Energy Technology Data Exchange (ETDEWEB)

Saracino-Brown, Jocelyn [Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States); Smith, Courtney [Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States); Gilman, Patrick [Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)

2013-07-01

The Wind Program hosted a two-day workshop on July 24-25, 2012 with scientists and regulators engaged in marine ecological survey, modeling, and database efforts pertaining to the waters of the Mid-Atlantic region. The workshop was planned by Federal agency, academic, and private partners to promote collaboration between ongoing offshore ecological survey efforts, and to promote the collaborative development of complementary predictive models and compatible databases. The meeting primarily focused on efforts to establish and predict marine mammal, seabird, and sea turtle abundance, density, and distributions extending from the shoreline to the edge of the Exclusive Economic Zone between Nantucket Sound, Massachusetts and Cape Hatteras, North Carolina.

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

Memories and identities redefinitions around the independence process in Cape Verde. The case of the Argentine-Cape Verdeans from Buenos Aires

Directory of Open Access Journals (Sweden)

Maria Cecilia Martino

2017-12-01

Full Text Available The article analyzes, from an ethnographic and historical perspective, the relations between memory, identity and Afro-descendant political activism among the Argentine-Cape Verdeans from Buenos Aires. The article highlights the memories and stories of the independence of Cape Verde, and the role played in it by Amílcar Cabral, the main political leader of this process. These narratives, whose specific expression are reflected in the institutional space of the Cape Verdean Society of Dock Sud, are updated from different perspectives and redefine the changing identity borders that allow the delineation of specific forms of political activism in Buenos Aires.

Geostationary Coastal and Air Pollution Events (GEO-CAPE) Sensitivity Analysis Experiment

Science.gov (United States)

Lee, Meemong; Bowman, Kevin

2014-01-01

Geostationary Coastal and Air pollution Events (GEO-CAPE) is a NASA decadal survey mission to be designed to provide surface reflectance at high spectral, spatial, and temporal resolutions from a geostationary orbit necessary for studying regional-scale air quality issues and their impact on global atmospheric composition processes. GEO-CAPE's Atmospheric Science Questions explore the influence of both gases and particles on air quality, atmospheric composition, and climate. The objective of the GEO-CAPE Observing System Simulation Experiment (OSSE) is to analyze the sensitivity of ozone to the global and regional NOx emissions and improve the science impact of GEO-CAPE with respect to the global air quality. The GEO-CAPE OSSE team at Jet propulsion Laboratory has developed a comprehensive OSSE framework that can perform adjoint-sensitivity analysis for a wide range of observation scenarios and measurement qualities. This report discusses the OSSE framework and presents the sensitivity analysis results obtained from the GEO-CAPE OSSE framework for seven observation scenarios and three instrument systems.

Reconstruction of major maternal and paternal lineages of the Cape Muslim population

Directory of Open Access Journals (Sweden)

Shafieka Isaacs

2013-01-01

Full Text Available The earliest Cape Muslims were brought to the Cape (Cape Town -South Africa from Africa and Asia from 1652 to 1834. They were part of an involuntary migration of slaves, political prisoners and convicts, and they contributed to the ethnic diversity of the present Cape Muslim population of South Africa. The history of the Cape Muslims has been well documented and researched however no in-depth genetic studies have been undertaken. The aim of the present study was to determine the respective African, Asian and European contributions to the mtDNA (maternal and Y-chromosomal (paternal gene pool of the Cape Muslim population, by analyzing DNA samples of 100 unrelated Muslim males born in the Cape Metropolitan area. A panel of six mtDNA and eight Y-chromosome SNP markers were screened using polymerase chain reaction-restriction fragment length polymorphisms (PCR-RFLP. Overall admixture estimates for the maternal line indicated Asian (0.4168 and African mtDNA (0.4005 as the main contributors. The admixture estimates for the paternal line, however, showed a predominance of the Asian contribution (0.7852. The findings are in accordance with historical data on the origins of the early Cape Muslims.

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

The "Cape Times"'s Portrayal of School Violence

Science.gov (United States)

de Wet, Corene

2016-01-01

This study explores the "Cape Times"'s portrayal of school violence in the Western Cape (WC), South Africa, reporting on findings from a qualitative content analysis of 41 news articles retrieved from the SA Media database. The findings shed light on the victims and their victimisation, the perpetrators, as well as the context of the…

Strategies GeoCape Intelligent Observation Studies @ GSFC

Science.gov (United States)

Cappelaere, Pat; Frye, Stu; Moe, Karen; Mandl, Dan; LeMoigne, Jacqueline; Flatley, Tom; Geist, Alessandro

2015-01-01

This presentation provides information a summary of the tradeoff studies conducted for GeoCape by the GSFC team in terms of how to optimize GeoCape observation efficiency. Tradeoffs include total ground scheduling with simple priorities, ground scheduling with cloud forecast, ground scheduling with sub-area forecast, onboard scheduling with onboard cloud detection and smart onboard scheduling and onboard image processing. The tradeoffs considered optimzing cost, downlink bandwidth and total number of images acquired.

76 FR 76453 - Notice of Applications for Deregistration Under Section 8(f) of the Investment Company Act of 1940

Science.gov (United States)

2011-12-07

... of Investment Management, Office of Investment Company Regulation, 100 F Street NE., Washington, DC... liquidation were paid by Hatteras Capital Investment Management, LLC, investment adviser to the master fund in... held by its investment adviser, Hatteras Capital Investment Management, LLC (``Hatteras Capital...

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

Petrography, geochemistry, and geochronology of the Cenozoic Cape Crossfire, Cape King, and No Ridge igneous complexes (northern Victoria Land, Antarctica)

International Nuclear Information System (INIS)

Rocchi, S.; Fioretti, A.M.; Cavazzini, G.

2002-01-01

The Meander Intrusive Group is the plutonic-subvolcanic counterpart of the McMurdo Volcanic Group, and extends along 200 km of the Ross Sea coast of Northern Victoria Land. The three largest occurrences of the Meander Intrusive Group between the Icebreaker and Borchgrevink glaciers are the Cape Crossfire, the No Ridge, and the Cape King igneous complexes. These have an area of 40-80 square km and are composed of dominant monzogabbros and monzodiorites along with minor syenites and alkali feldspar microgranites. A significant compositional gap exists between mafic and felsic facies, which show geometrical relationships varying from subhorizontal alternating layers to complex pillowing and fragmentation of the mafic into the felsic facies. Two whole rock biotite Rb-Sr internal isochrons constrain the cooling age of Cape Crossfire Igneous Complex at 31 Ma, a few million years older than No Ridge and Cape King igneous complexes. Thus, the ages of these complexes (≤ 31 Ma) are younger than the plutons and dikes (≥ 35 Ma) cropping out in the southernmost area between the Campbell and Icebreaker glaciers. (author). 28 refs., 8 figs., 3 tabs

A Cretaceous origin for fire adaptations in the Cape flora.

Science.gov (United States)

He, Tianhua; Lamont, Byron B; Manning, John

2016-10-05

Fire has had a profound effect on the evolution of worldwide biotas. The Cape Floristic Region is one of the world's most species-rich regions, yet it is highly prone to recurrent fires and fire-adapted species contribute strongly to the overall flora. It is hypothesized that the current fire regimes in the Cape could be as old as 6-8 million years (My), while indirect evidence indicates that the onset of fire could have reached 18 million years ago (Ma). Here, we trace the origin of fire-dependent traits in two monocot families that are significant elements in the fire-prone Cape flora. Our analysis shows that fire-stimulated flowering originated in the Cape Haemodoraceae 81 Ma, while fire-stimulated germination arose in the African Restionaceae at least 70 Ma, implying that wildfires have been a significant force in the evolution of the Cape flora at least 60 My earlier than previous estimates. Our results provide strong evidence for the presence of fire adaptations in the Cape from the Cretaceous, leading to the extraordinary persistence of a fire-adapted flora in this biodiversity hotspot, and giving support to the hypothesis that Cretaceous fire was a global phenomenon that shaped the evolution of terrestrial floras.

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

A review of Khoi-San and Cape Dutch medical ethnobotany.

Science.gov (United States)

van Wyk, B-E

2008-10-28

ETHNOPHARMACOLOGICAL CONTEXT: Cape herbal medicine as a distinct and unique healing system is conceptualized for the first time, together with a first compilation of the authentic materia medica of the system. The early literature on Khoikhoi (Hottentot), San (Bushman) and Cape Dutch medicinal plants and medical practices is reviewed, with a focus on the Cape Floristic Region (from Namaqualand to the Eastern Cape). To avoid recent additions and modern cultural influences in the results, the date of publication of the last volume of Marloth's Flora of South Africa (1932) was chosen as a cut-off date. The recorded Cape materia medica (up to 1932) is briefly summarized, giving the scientific names, vernacular names (in Afrikaans or Khoi-San/Nama) and main uses. It comprises about 170 items and includes mainly indigenous and endemic plant species, some exotic (garden) plants, and a few other items (fungi, seaweeds, lichens, hyraceum and natural potassium nitrate). Most of the plants (and hyraceum) are still widely used today, especially in rural areas. The combination of unique cultural practices and a diverse, highly endemic flora has led to the development of a distinct herbal healing system, here called Cape herbal medicine, but hitherto rather vaguely and inaccurately referred to as Khoi-San medicine, Cape Dutch medicine or boererate (farm remedies). The data allows for a more informed consideration of indigenous knowledge and intellectual property rights associated with particular plants (e.g. Hoodia and Pelargonium). It also offers opportunities for linking modern ethnobotanical field studies with historical data.

The biomes of the eastern Cape with emphasis on their conservation

Directory of Open Access Journals (Sweden)

R. A. Lubke

1986-10-01

Full Text Available The four major phytochoria of southern Africa, the Cape. Tongoland-Pondoland. Karoo-Namib and Afromontane regions, converge in the complex transition zone of the eastern Cape. The area is rich in species and communities with a complex vegetation in which are represented all the major vegetation formations of southern Africa — Cape Fynbos. Cape Transitional Shrublands, Subtropical Thicket. Karoo, Savanna, Afromontane Forest, Grasslands and Littoral Strand Vegetation. Our results support previous findings that, although species-rich and of great diversity, the flora has fewer endemics (205 or 5,6% than the Cape (73% or Karoo-Namib (35%.  The communities with the largest proportion of endemics (30%, and threatened plants (18% are those of the Subtropical Thicket. On the basis of these data and an index of conserv ation status, the Subtropical Thicket was determined to be highest on the priority list for conservation in the eastern Cape. Subtropical Thicket is being cleared at an increasing rate and is most vulnerable due to changing farming practice.

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

The biogeochemistry of carbon in continental slope sediments: The North Carolina margin

Energy Technology Data Exchange (ETDEWEB)

Blair, N.; Levin, L.; DeMaster, D.; Plaia, G.; Martin, C.; Fornes, W.; Thomas, C.; Pope, R.

1999-12-01

The responses of the continental slope benthos to organic detritus deposition were studied with a multiple trace approach. Study sites were offshore of Cape Fear (I) and Cape Hatteras (III), N.C. (both 850 m water depth) and were characterized by different organic C deposition rates, macrofaunal densities (III>I in both cases) and taxa. Natural abundances of {sup 13}C and {sup 12}C in particulate organic carbon (POC), dissolved inorganic carbon (DIC) and macrofauna indicate that the reactive organic detritus is marine in origin. Natural abundance levels of {sup 14}C and uptake of {sup 13}C-labeled diatoms by benthic animals indicate that they incorporate a relatively young component of carbon into their biomass. {sup 13}C-labeled diatoms (Thalassiorsira pseudonana) tagged with {sup 210}Pb, slope sediment tagged with {sup 113}Sn and {sup 228}Th-labeled glass beads were emplaced in plots on the seafloor at both locations and the plots were sampled after 30 min., 1-1.5 d and 14 mo. At Site I, tracer diatom was intercepted at the surface primarily by protozoans and surface-feeding annelids. Little of the diatom C penetrated below 2 cm even after 14 months. Oxidation of organic carbon appeared to be largely aerobic. At Site III, annelids were primarily responsible for the initial uptake of tracer. On the time scale of days, diatom C was transported to a depth of 12 cm and was found in animals collected between 5-10 cm. The hoeing of tracer from the surface by the maldanid Praxillela sp. may have been responsible for some of the rapid nonlocal transport. Oxidation of the diatom organic carbon was evident to at least 10 cm depth. Anaerobic breakdown of organic matter is more important at Site III. Horizontal transport, which was probably biologically mediated, was an order of magnitude more rapid than vertical displacement over a year time scale. If the horizontal transport was associated with biochemical transformations of the organic matter, it may represent an

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Prefabricated solution to modular construction in Cape Verde

Science.gov (United States)

Vieira, Nuno; Amado, Miguel; Pinho, Fernando

2017-02-01

Nowadays, the lack of adequate housing in Cape Verde is a growing problem. The migration of the population living in the countryside to the major cities generates an increase of the diameter of the cities. With the lack of economic power, the migrating families tend to occupy the land with houses which don't present proper conditions to living. Praia is the capital of Cape Verde and so on the biggest city of the country. This fact leads Praia to being the city with major economic power and job offer in all country. Consequently, Praia has developed the biggest slum of the Cape Verde and it is urgent to approach this problem in order to create solutions that reveal capacity to start solving it. Cape Verde's unique dry subtropical climate turns indispensable a careful resolution of the housing, in order to ensure the comfort of the occupants. The modular construction is a solution with potential to approach this problem with a fast and economic response. In order to answer the situation, this article introduces a modular solution in order to reach the needing of thermal comfort to the specific case of Praia.

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

Latitudinal variation of a defensive symbiosis in the Bugula neritina (Bryozoa sibling species complex.

Directory of Open Access Journals (Sweden)

Jonathan Linneman

Full Text Available Mutualistic relationships are beneficial for both partners and are often studied within a single environment. However, when the range of the partners is large, geographical differences in selective pressure may shift the relationship outcome from positive to negative. The marine bryozoan Bugula neritina is a colonial invertebrate common in temperate waters worldwide. It is the source of bioactive polyketide metabolites, the bryostatins. Evidence suggests that an uncultured vertically transmitted symbiont, "Candidatus Endobugula sertula", hosted by B. neritina produces the bryostatins, which protect the vulnerable larvae from predation. Studies of B. neritina along the North American Atlantic coast revealed a complex of two morphologically similar sibling species separated by an apparent biogeographic barrier: the Type S sibling species was found below Cape Hatteras, North Carolina, while Type N was found above. Interestingly, the Type N colonies lack "Ca. Endobugula sertula" and, subsequently, defensive bryostatins; their documented northern distribution was consistent with traditional biogeographical paradigms of latitudinal variation in predation pressure. Upon further sampling of B. neritina populations, we found that both host types occur in wider distribution, with Type N colonies living south of Cape Hatteras, and Type S to the north. Distribution of the symbiont, however, was not restricted to Type S hosts. Genetic and microscopic evidence demonstrates the presence of the symbiont in some Type N colonies, and larvae from these colonies are endowed with defensive bryostatins and contain "Ca. Endobugula sertula". Molecular analysis of the symbiont from Type N colonies suggests an evolutionarily recent acquisition, which is remarkable for a symbiont thought to be transmitted only vertically. Furthermore, most Type S colonies found at higher latitudes lack the symbiont, suggesting that this host-symbiont relationship is more flexible than

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

Intraplate seismicity across the Cape Verde swell

Science.gov (United States)

Vales, Dina; Matias, Luís.; Haberland, Christian; Silveira, Graça.; Weber, Michael; Carrilho, Fernando; Dias, Nuno

2010-05-01

The Cape Verde Archipelago ((15-17°N, 23-26°W) is located within the African plate, about 500km west of Senegal, in the African coast. The islands are located astride the Cape Verde mid-plate topographic swell, one of the largest features of its type in the world's ocean basins. The origin of this Cape Verde swell is still in debate. Previous determinations of the elastic thickness (Te) reveal a normal Te and a modest heat flow anomaly which suggest that the swell cannot be fully explained by uplift due to thermal reheating of the lithosphere by an underlying ‘‘hot spot'' and that other, deep-seated, mantle processes must be involved. The CV-PLUME (An investigation on the geometry and deep signature of the Cape Verde mantle plume) project intends to shape the geometry and deep origin of the Cape Verde mantle plume, via a combined study of seismic, magnetic, gravimetric and geochemical observations. Through this study we intend to characterize the structure beneath the archipelago from the surface down to the deep mantle. The core of this 3-year project was a temporary deployment of 39 Very Broad Band seismometers, across all the inhabited islands, to recorder local and teleseismic earthquakes. These instruments were operational from November 2007 to September 2008. In this work we report on the preliminary results obtained from the CV-PLUME network on the characterization of the local and regional seismicity. To detect the small magnitude seismic events the continuous data stream was screened using spectrograms. This proved to be a very robust technique in the face of the high short-period noise recorded by many of the stations, particularly during day time. The 10 month observation time showed that the background seismic activity in the Archipelago and surrounding area is low, with only a very few events recorded by the complete network. However, two clusters of earthquakes were detected close to the Brava Island, one to the NW and a second one, more active

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

Knowledge and attitudes in the rural Western Cape towards ...

African Journals Online (AJOL)

The study found that farm residents in the Western Cape are potentially exposed to pesticides through various environmental routes including water. This emphasises the need to monitor water for pesticides in the Western Cape, but in order to do this, human and laboratory resources and capacities to conduct routine ...

Risk factors for meningococcal disease in Cape Town | Moodley ...

African Journals Online (AJOL)

Objective. To determine the risk factors associated with meningococcal disease among children living in Cape Town. Design. A case-control study was conducted from October 1993 to January 1995. Setting. The study population consisted of all children tmder the age of 14 years who were resident in the Cape Town ...

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

The 1992 measles epidemic in Cape Town - a changing ...

African Journals Online (AJOL)

Over the last 6 years there has been a decline in the incidence of measles in Cape Town. However, during August 1992 an outbreak occurred, with cases reported at many schools in children presumably immunised. The objectives of this study were to characterise the epidemic in Cape Town and to determine possible ...

Perspectives of wild medicine harvesters from Cape Town, South Africa

Directory of Open Access Journals (Sweden)

Leif Petersen

2017-09-01

Full Text Available Cape Town is a fast-growing cityscape in the Cape Floristic Region in South Africa with 24 formally protected conservation areas including the World Heritage Table Mountain National Park. These sites have been protected and managed as critical sites for local biodiversity, representing potentially one-third of all Cape Floristic Region flora species and 18% of South Africa's plant diversity. Cape Town is also inhabited by a rapidly growing culturally and economically diverse citizenry with distinct and potentially conflicting perspectives on access to, and management of, local natural resources. In a qualitative study of 58 locally resident traditional healers of distinct cultural groups, we examined motivations underlying the generally illicit activity of harvesting of wild resources from Cape Town protected areas. Resource harvester motivations primarily link to local economic survival, health care and cultural links to particular resources and practices, 'access for all' outlooks, and wholesale profit-seeking perspectives. We describe these motivations, contrast them with the current formal, legal and institutional perspectives for biodiversity protection in the city, and propose managerial interventions that may improve sustainability of ongoing harvest activities. Significance: The study reveals, for the first time in the Cape Floristic Region, informal economy viewpoints on terrestrial nature and how its direct use has important economic and cultural roles – specifically in wild medicine harvesting and trade. We contrast the formal and informal approaches to nature conservation in the city and propose new considerations for conservation managers.

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

Radiation sensitization by CAPE on human HeLa cells of cervical cancer

International Nuclear Information System (INIS)

Wang Xiaoqiang; Cao Jianping; Fan Saijun; Zun Wei; Huang Xiaofei; Liu Yang; Chen Xialin; Gong Xiaomei; Peng Xiaomei; Zeng Jing

2009-01-01

Objective: To study the radiosensitizing effect of caffic acid phenethyl ester (CAPE) on human cervical cancer HeLa cells. Methods: MTT assay was used to measure the relation between the inhibition effect and CAPE concentrations by CAPE with different concentrations on HeLa cells for 24 hours. HeLa cells were divided into the control and experimental groups, both of which were given 0, 2, 4, 6 and 8 Gy of 60Co γ-irradiation, respectively. The cell clones were counted. Meanwhile HeLa cells were divided into the control, CAPE, irradiation and combination groups. Flow cytometric analysis was adopted to detect the changes of cell cycle distribution induced by CAPE. Results: The inhibition rate of CAPE acting on Hela cells increased with concentrations (F=126. 49 ∼ 3654.88, P 0 ) (1.45 and 1.82 Gy) and the quasi-threshold dose (D q ) (1.89 and 3.21 Gy) of HeLa cells in experimental group decreased comparing with control group, SER was 1.26. Compared with the sole irradiation group, cells in G 2 /M phase of the CAPE group and the sole irradiation group increased (P 2 /M arrest and may be related to the inhibition of the sub-lethal damage repair. (authors)

Over the past decades, the Cape anchovy Engraulis capensis has ...

African Journals Online (AJOL)

spamer

Data on the thermal structure, copepod biomass and production, and total number of eggs of the Cape anchovy ... To identify factors controlling the area of this water mass, a cluster ...... thesis, University of Cape Town: [vii] + 278 pp. SHANNON ...

Ekman estimates of upwelling at cape columbine based on ...

African Journals Online (AJOL)

Ekman estimates of upwelling at cape columbine based on measurements of longshore wind from a 35-year time-series. AS Johnson, G Nelson. Abstract. Cape Columbine is a prominent headland on the south-west coast of Africa at approximately 32°50´S, where there is a substantial upwelling tongue, enhancing the ...

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

Comparison of age determination techniques for known-age Cape ...

African Journals Online (AJOL)

Known-age teeth were used to validate age determination techniques for the Cape fur seal (Arctocephalus ... The reliability with which age can be estimated for the Cape fur seal has also been improved. ... The acid solution, with a volume at least 10 times that of ... old female [0 show (he absence of GLGs in the cemenlUnl.

cutaneous manifestatio s of tuberculosis i the wester cape

African Journals Online (AJOL)

lEA WALKER, M.B., CH.B. (CAPE TOWN). Department of Dermatology, University of Cape Town and Croote Schuur Ho pital. Skin tuberculosis has been chosen as the subject of ... are fairly representative of the total number of skin cases seeking advice. .... results of vitamin D2 in the treatment of lupus."5-7. At -about the ...

Ensuring water supply for all towns and villages in the Eastern Cape ...

African Journals Online (AJOL)

Eastern Cape and Western Cape Provinces of South Africa. ER Hay1, K .... The current water balance (see Fig. 1) and the .... in selected towns in the Eastern and Western Cape. Town .... work in order to reduce the risk of failure in the water supply to the town. .... Asset management, to prolong the life of the infrastructure.

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

Tourist Profile and Destination Brand Perception: The Case of Cape Town, South Africa

Directory of Open Access Journals (Sweden)

Ikechukwu O. Ezeuduji

2016-08-01

Full Text Available Tourists pay for destination brands. This study checked for the relationships between tourists’ profile and how they perceived the destination brand of Cape Town. A questionnaire survey of 220 tourists visiting Cape Town was done. This study found that repeat visit, age of tourist, length of stay, and tourist origin, have significant influences on how tourists visiting Cape Town perceived the destination. The top three destination attributes of Cape Town (cognitive images, which enhance visitor experience satisfaction are (1 the overall level of service quality at facilities in Cape Town, (2 the city being one of the best places the tourists have visited, and (3 the destination’s good value for money. The top three emotional valuations of destination attributes (affective images which enhance visitor experience satisfaction in Cape Town include (1 memorable visit, (2 valuable visit, and (3 friendly and hospitable population. It is therefore recommended that tourism businesses in Cape Town develop relationship marketing tools to attract and retain its tourists segments of loyal, advanced in age, long-staying and domestic tourists. Results from this research could be compared with related findings in the international arena and have related implications, especially for developing economies

The Cape commercial linefishery consists of about 2 500 vessels ...

African Journals Online (AJOL)

spamer

assessing the ecosystem effects of fishing and evaluating the benefits of ... Such information would assist in the ... Traditional Cape linefish may be broadly divided into ... gressively farther offshore (and into deeper. Griffiths: ... (Griffiths 1997c); this process controls avail- ... of shallow-water Cape hake Merluccius capensis,.

Explicit flow equations and recursion operator of the ncKP hierarchy

International Nuclear Information System (INIS)

He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong

2011-01-01

The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

April 1977 The Cape gurnard is a commercially exploited species of ...

African Journals Online (AJOL)

The Cape gurnard is a commercially exploited species of which the annual landings between ... fishing operations took place along the eastern Cape coast of South Africa ..... Handbook of computation for biological statistics offish populations.

Narrating Muslim women’s identities in Cape Town

OpenAIRE

Boswell, R.

2011-01-01

This paper considers the complexity of Muslim women’s identities in the city of Cape Town in 2010. It is argued that emerging super-diversity in the form of African immigration, the commercialisation of Islam and increasing freedoms for women in South Africa impact on women’s engagement with religion and diversifies their identity. The paper also offers glimpses into the diversity of Islam in Cape Town, suggesting that this religion is not monolithic in the city and that it is continuously di...

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

The continental slope current system between Cape Verde and the Canary Islands

Directory of Open Access Journals (Sweden)

Jesús Peña-Izquierdo

2012-08-01

Full Text Available We use hydrographic, velocity and drifter data from a cruise carried out in November 2008 to describe the continental slope current system in the upper thermocline (down to 600 m between Cape Verde and the Canary Islands. The major feature in the region is the Cape Verde Frontal Zone (CVFZ, separating waters from tropical (southern and subtropical (northern origin. The CVFZ is found to intersect the slope north of Cape Blanc, between 22°N and 23°N, but we find that southern waters are predominant over the slope as far north as 24°N. South of Cape Blanc (21.25°N the Poleward Undercurrent (PUC is a prominent northward jet (50 km wide, reaching down to 300 m and indistinguishable from the surface Mauritanian Current. North of Cape Blanc the upwelling front is found far offshore, opening a near-slope northward path to the PUC. Nevertheless, the northward PUC transport decreases from 2.8 Sv at 18°N to 1.7 Sv at 24°N, with about 1 Sv recirculating ofshore just south of Cape Blanc, in agreement with the trajectory of subsurface drifters. South of the CVFZ there is an abrupt thermohaline transition at σϴ=26.85 kg m–3, which indicates the lower limit of the relatively pure (low salt and high oxygen content South Atlantic Central Water (SACW variety that coexists with the dominant locally-diluted (salinity increases through mixing with North Atlantic Central Water but oxygen diminishes because of enhanced remineralization Cape Verde (SACWcv variety. At 16°N about 70% of the PUC transport corresponds to the SACW variety but but this is transformed into 40% SACWcv at 24°N. However, between Cape Verde and Cape Blanc and in the 26.85 < σϴ < 27.1 layer, we measure up to 0.8 Sv of SACWcv being transported south. The results strongly endorse the idea that the slope current system plays a major role in tropical-subtropical water-mass exchange.

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

ORF Alignment: NC_003228 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

ORF Sequence: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003064 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Sequence: NC_001145 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

Short Communications: First record of freshwater fish on the Cape ...

African Journals Online (AJOL)

During a non-exhaustive survey of freshwater bodies on five islands of the archipelago, the first presence of a freshwater fish was recorded. Using barcoding sequences, the species was identified as the guppy (Poecilia reticulata), a highly invasive species alien to the Cape Verdean Islands. Key words: Cape Verde, guppy, ...

Research collaboration 2011-2012: A joint publication highlighting the research partnerships between the CSIR and University of the Western Cape, University of Cape Town, Stellenbosch University

CSIR Research Space (South Africa)

CSIR

2012-01-01

Full Text Available CSIR’s partnerships with the University of the Western Cape (UWC), University of Cape Town (UCT) and Stellenbosch University (SU) seek to conduct research that improves the quality of the lives of the people of South Africa by responding...

ORF Alignment: NC_006371 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

Clausius-Clapeyron Scaling of Convective Available Potential Energy (CAPE) in Cloud-Resolving Simulations

Science.gov (United States)

Seeley, J.; Romps, D. M.

2015-12-01

Recent work by Singh and O'Gorman has produced a theory for convective available potential energy (CAPE) in radiative-convective equilibrium. In this model, the atmosphere deviates from a moist adiabat—and, therefore, has positive CAPE—because entrainment causes evaporative cooling in cloud updrafts, thereby steepening their lapse rate. This has led to the proposal that CAPE increases with global warming because the strength of evaporative cooling scales according to the Clausius-Clapeyron (CC) relation. However, CAPE could also change due to changes in cloud buoyancy and changes in the entrainment rate, both of which could vary with global warming. To test the relative importance of changes in CAPE due to CC scaling of evaporative cooling, changes in cloud buoyancy, and changes in the entrainment rate, we subject a cloud-resolving model to a suite of natural (and unnatural) forcings. We find that CAPE changes are primarily driven by changes in the strength of evaporative cooling; the effect of changes in the entrainment rate and cloud buoyancy are comparatively small. This builds support for CC scaling of CAPE.

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

Evaluating private land conservation in the Cape Lowlands, South Africa.

Science.gov (United States)

Von Hase, Amrei; Rouget, Mathieu; Cowling, Richard M

2010-10-01

Evaluation is important for judiciously allocating limited conservation resources and for improving conservation success through learning and strategy adjustment. We evaluated the application of systematic conservation planning goals and conservation gains from incentive-based stewardship interventions on private land in the Cape Lowlands and Cape Floristic Region, South Africa. We collected spatial and nonspatial data (2003-2007) to determine the number of hectares of vegetation protected through voluntary contractual and legally nonbinding (informal) agreements with landowners; resources spent on these interventions; contribution of the agreements to 5- and 20-year conservation goals for representation and persistence in the Cape Lowlands of species and ecosystems; and time and staff required to meet these goals. Conservation gains on private lands across the Cape Floristic Region were relatively high. In 5 years, 22,078 ha (27,800 ha of land) and 46,526 ha (90,000 ha of land) of native vegetation were protected through contracts and informal agreements, respectively. Informal agreements often were opportunity driven and cheaper and faster to execute than contracts. All contractual agreements in the Cape Lowlands were within areas of high conservation priority (identified through systematic conservation planning), which demonstrated the conservation plan's practical application and a high level of overlap between resource investment (approximately R1.14 million/year in the lowlands) and priority conservation areas. Nevertheless, conservation agreements met only 11% of 5-year and 9% of 20-year conservation goals for Cape Lowlands and have made only a moderate contribution to regional persistence of flora to date. Meeting the plan's conservation goals will take three to five times longer and many more staff members to maintain agreements than initially envisaged. © 2010 Society for Conservation Biology.

Anemia and associated factors among school-age children in Cape ...

African Journals Online (AJOL)

Anemia is a problem affecting a large group of school children in sub-Saharan Africa, contributing to morbidity in this region. In Cape Verde the magnitude of anemia in school-age children is unknown. The study aimed to assess the prevalence of anemia and associated factors among children in Cape Verde. The data are ...

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006349 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

ORF Alignment: NC_000964 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

ORF Alignment: NC_002570 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_003237 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

ORF Alignment: NC_002771 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Sequence: NC_001141 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_002976 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

ORF Alignment: NC_002951 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

Fate of corrosion products released from stainless steel in marine sediments and seawater. Part 4: Hatteras abyssal red clay

International Nuclear Information System (INIS)

Schmidt, R.L.

1982-07-01

A study in which neutron-activated 347 stainless steel was exposed to surficial sediment from a site in the Hatteras Abyssal Plain of the Northwest Atlantic Ocean is described. This sediment consists of approx. 20% CaCO 3 , which could lead to the formation of calcareous scale on the metal surface and reduce the corrosion rate. The distribution of indigenous metals among different chemical fractions shows that extractable Cr, Mn, Fe, Co, and Zn were associated with amorphous Mn and Fe oxides. Most of the remaining extractable Cr, and about a third of the extractable Cu appear to have been weakly complexed. Major fractions (25 to 36%) of extractable Mn, Co and Ni were present as adsorbed cations. Organic complexation appears to account for a large amount of extractable Fe, Ni, Cu and Zn. Neutron-activated 347 stainless steel specimens were exposed to sediment slurry under aerobic and non-oxygenated conditions for a period of 94 days. The redox potential measurements for air-sparged and N 2 , CO 2 -sparged sediment slurries were +410 and +60 mv, respectively. The presence of 0 2 produced increased amounts of corrosion products. Chemical extraction showed that relatively labile substances constituted about 84% of the 60 Co activity released in aerated sediment. Relatively labile substances constitute about 82% of the total 60 Co activity released under non-oxygenated conditions. A large fraction of 60 Co which was in the soluble or easily dissolved forms under non-oxygenated conditions appears to have been more strongly adsorbed to the sediment under aerated conditions

RECURRENT CONVULSIONS IN CAPE TOWN CHILDREN*

African Journals Online (AJOL)

1970-11-03

Nov 3, 1970 ... Child Health, Medical School, University of Cape Town studied and the .... Sex Distribution (Table III) ... family history in children with brain damage is surprisingly high. .... nized that more male infants develop the respiratory.

Cell killing and radiosensitization by caffeic acid phenethyl ester (CAPE) in lung cancer cells

International Nuclear Information System (INIS)

Chen, Miao-Fen; Chen, Wen-Cheng; Wu, Chun-Te; King, P.C.

2004-01-01

Caffeic acid phenethyl ester (CAPE) is a biologically active ingredient of honeybee propoplis. The cytotoxicity and radiation sensitization effects of CAPE were evaluated in human lung cancer A549 cells and normal lung fibroblast WI-38 cells. A549 cells treated with 6 μg/ml CAPE showed marked growth inhibition (60%) at 48 hr after treatments. During the same time, the number of viable cells decreased to 46% of the control value. In contrast, WI-38 cells showed 20% growth inhibition with no change in the number of viable cells under the same treatment conditions. At 72 hr after CAPE treatment (6 μg/ml), the percentage of apoptotic cells in A549 cultures increased significantly to 67% and an S/G2 arrest was also detected in the culture. Furthermore, there was a significant decrease in the level of intracellular glutathione and hydrogen peroxide contents within one hr after CAPE treatment, and the expression of cyclin B 1 was reduced 6 hr after treatment. The radiation sensitization effect of CAPE on A549 cells was determined from the clonogenic survival curves, and the results showed a small but significant difference in radiation survival between cells treated with or without CAPE. Taken together, our results suggest that the effects of CAPE on differential cytotoxicity, apoptosis, and radiosensitization are associated with glutathione depletion that occurred shortly after treatments. (author)

The role of eclogite in the mantle heterogeneity at Cape Verde

DEFF Research Database (Denmark)

Barker, Abigail Katrine; Holm, Paul Martin; Troll, Valentin R.

2014-01-01

The Cape Verde hotspot, like many other Ocean Island Basalt provinces, demonstrates isotopic heterogeneity on a 100–200 km scale. The heterogeneity is represented by the appearance of an EM1-like component at several of the southern islands and with a HIMU-like component present throughout...... have been limited. We apply the minor elements in olivine approach (Sobolev et al. in Nature 434:590–597, 2005; Science, doi:10.1126/science.1138113, 2007), to determine and quantify the contributions of peridotite, pyroxenite and eclogite melts to the mantle heterogeneity observed at Cape Verde. Cores...... of olivine phenocrysts of the Cape Verde volcanics have low Mn/FeO and low Ni*FeO/MgO that deviate from the negative trend of the global array. The global array is defined by mixing between peridotite and pyroxenite, whereas the Cape Verde volcanics indicate contribution of an additional eclogite source...

Aspects of the digestion in the Cape porcupine | van Jaarsveld ...

African Journals Online (AJOL)

The digestive capabilities of the Cape porcupine (Hystrix africaeaustralis) were studied using captive and field animals. The stomach contents comprised 6,47% of the body mass and had a low pH (2,0).The Cape porcupine also has a long small intestine (670 em). The large stomach and small intestine form a very efficient ...

Tourism Policies and the Space Economy of the Eastern Cape ...

African Journals Online (AJOL)

The key objective of this paper is to x-ray the situation in the tourism development process of the post-1994 tourism sector of the Eastern Cape Province. This paper uses empirical data to examine the extent to which actors in the Eastern Cape tourism sector interpreted the national tourism policies. The White Paper on ...

ORF Alignment: NC_004331 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

ORF Alignment: NC_003366 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

ORF Alignment: NC_000853 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

ORF Alignment: NC_002944 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_004722 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

AMPR BRIGHTNESS TEMPERATURE CAPE EXPERIMENT V2

Data.gov (United States)

National Aeronautics and Space Administration — The Advanced Microwave Precipitation Radiometer (AMPR) was deployed during the Convection and Precipitation/Electrification Experiment (CaPE). AMPR data...

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

ORF Alignment: NC_004350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

ORF Alignment: NC_002946 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

ORF Alignment: NC_003106 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

ORF Alignment: NC_006509 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

ORF Alignment: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004061 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

ORF Sequence: NC_001146 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

ORF Alignment: NC_004917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

National Research Council Canada - National Science Library

Kim, Byung

1997-01-01

.... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil

2017-04-07

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer\\'s disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining.

Science.gov (United States)

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B

2017-07-03

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

DES-ncRNA: A knowledgebase for exploring information about human micro and long noncoding RNAs based on literature-mining

KAUST Repository

Salhi, Adil; Essack, Magbubah; Alam, Tanvir; Bajic, Vladan P.; Ma, Lina; Radovanovic, Aleksandar; Marchand, Benoit; Schmeier, Sebastian; Zhang, Zhang; Bajic, Vladimir B.

2017-01-01

Noncoding RNAs (ncRNAs), particularly microRNAs (miRNAs) and long ncRNAs (lncRNAs), are important players in diseases and emerge as novel drug targets. Thus, unraveling the relationships between ncRNAs and other biomedical entities in cells are critical for better understanding ncRNA roles that may eventually help develop their use in medicine. To support ncRNA research and facilitate retrieval of relevant information regarding miRNAs and lncRNAs from the plethora of published ncRNA-related research, we developed DES-ncRNA ( www.cbrc.kaust.edu.sa/des_ncrna ). DES-ncRNA is a knowledgebase containing text- and data-mined information from public scientific literature and other public resources. Exploration of mined information is enabled through terms and pairs of terms from 19 topic-specific dictionaries including, for example, antibiotics, toxins, drugs, enzymes, mutations, pathways, human genes and proteins, drug indications and side effects, mutations, diseases, etc. DES-ncRNA contains approximately 878,000 associations of terms from these dictionaries of which 36,222 (5,373) are with regards to miRNAs (lncRNAs). We provide several ways to explore information regarding ncRNAs to users including controlled generation of association networks as well as hypotheses generation. We show an example how DES-ncRNA can aid research on Alzheimer's disease and suggest potential therapeutic role for Fasudil. DES-ncRNA is a powerful tool that can be used on its own or as a complement to the existing resources, to support research in human ncRNA. To our knowledge, this is the only knowledgebase dedicated to human miRNAs and lncRNAs derived primarily through literature-mining enabling exploration of a broad spectrum of associated biomedical entities, not paralleled by any other resource.

ORF Alignment: NC_004547 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

ORF Alignment: NC_003364 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

ORF Alignment: NC_002607 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

ORF Alignment: NC_005861 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

ORF Alignment: NC_005070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002967 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_002755 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

ORF Alignment: NC_006582 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

ORF Alignment: NC_003921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

ORF Alignment: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

ORF Alignment: NC_002745 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_002758 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

ORF Alignment: NC_003284 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects

ORF Alignment: NC_004557 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

ORF Alignment: NC_006300 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

ORF Alignment: NC_002940 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

ORF Alignment: NC_000907 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

ORF Alignment: NC_006512 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

ORF Alignment: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...

ORF Alignment: NC_000963 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

Population size, breeding biology and on-land threats of Cape Verde petrel (Pterodroma feae) in Fogo Island, Cape Verde.

Science.gov (United States)

Militão, Teresa; Dinis, Herculano Andrade; Zango, Laura; Calabuig, Pascual; Stefan, Laura M; González-Solís, Jacob

2017-01-01

Cape Verde petrel (Pterodroma feae) is currently considered near threatened, but little is known about its population size, breeding biology and on land threats, jeopardizing its management and conservation. To improve this situation, we captured, marked and recaptured (CMR) birds using mist-nets over 10 years; measured and sexed them; monitored up to 14 burrows, deployed GPS devices on breeders and analyzed activity data of geolocators retrieved from breeders in Fogo (Cape Verde). We set cat traps over the colony and investigated their domestic/feral origin by marking domestic cats from a nearby village with transponders, by deploying GPS devices on domestic cats and by performing stable isotope analyses of fur of the trapped and domestic cats. The population of Fogo was estimated to be 293 birds, including immatures (95% CI: 233-254, CMR modelling). Based on geolocator activity data and nest monitoring we determined the breeding phenology of this species and we found biometric differences between sexes. While monitoring breeding performance, we verified a still ongoing cat predation and human harvesting. Overall, data gathered from trapped cats without transponder, cats GPS trips and the distinct isotopic values between domestic and trapped cats suggest cats visiting the colony are of feral origin. GPS tracks from breeders showed birds left and returned to the colony using the sector NE of the islands, where high level of public lights should be avoided specially during the fledging period. Main threats for the Cape Verde petrel in the remaining breeding islands are currently unknown but likely to be similar to Fogo, calling for an urgent assessment of population trends and the control of main threats in all Cape Verde Islands and uplisting its conservation status.

Population size, breeding biology and on-land threats of Cape Verde petrel (Pterodroma feae in Fogo Island, Cape Verde.

Directory of Open Access Journals (Sweden)

Teresa Militão

Full Text Available Cape Verde petrel (Pterodroma feae is currently considered near threatened, but little is known about its population size, breeding biology and on land threats, jeopardizing its management and conservation. To improve this situation, we captured, marked and recaptured (CMR birds using mist-nets over 10 years; measured and sexed them; monitored up to 14 burrows, deployed GPS devices on breeders and analyzed activity data of geolocators retrieved from breeders in Fogo (Cape Verde. We set cat traps over the colony and investigated their domestic/feral origin by marking domestic cats from a nearby village with transponders, by deploying GPS devices on domestic cats and by performing stable isotope analyses of fur of the trapped and domestic cats. The population of Fogo was estimated to be 293 birds, including immatures (95% CI: 233-254, CMR modelling. Based on geolocator activity data and nest monitoring we determined the breeding phenology of this species and we found biometric differences between sexes. While monitoring breeding performance, we verified a still ongoing cat predation and human harvesting. Overall, data gathered from trapped cats without transponder, cats GPS trips and the distinct isotopic values between domestic and trapped cats suggest cats visiting the colony are of feral origin. GPS tracks from breeders showed birds left and returned to the colony using the sector NE of the islands, where high level of public lights should be avoided specially during the fledging period. Main threats for the Cape Verde petrel in the remaining breeding islands are currently unknown but likely to be similar to Fogo, calling for an urgent assessment of population trends and the control of main threats in all Cape Verde Islands and uplisting its conservation status.

April 1992 Cape Mendocino, USA Images

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — On April 25, 1992 at 11:06 am local time (April 25 at 18:06 GMT), a magnitude 7.1 earthquake occurred in the Cape Mendocino area. Two additional earthquakes,...

Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries

International Nuclear Information System (INIS)

Jeon, Bup Ju; Lee, Joong Kee

2014-01-01

Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH 4 /SiH 4 mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH 4 and SiH 4 precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium

Electrochemical characteristics of nc-Si/SiC composite for anode electrode of lithium ion batteries

Energy Technology Data Exchange (ETDEWEB)

Jeon, Bup Ju [Department of Energy Resources, Shinhan University, 233-1, Sangpae-dong, Dongducheon, Gyeonggi-do, 483-777 (Korea, Republic of); Lee, Joong Kee, E-mail: leejk@kist.re.kr [Advanced Energy Materials Processing Laboratory, Center for Energy Convergence Research, Green City Technology Institute, Korea Institute of Science and Technology, Hwarangno 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)

2014-03-25

Graphical abstract: Cycling performances and coulombic efficiencies of the nc-Si/SiC composite anodes at different CH{sub 4}/SiH{sub 4} mole ratios. -- Highlights: • Our work has focused on irreversible discharge capacity and capacity retention of nc-Si/SiC composite particles. • Particles comprised a mixed construction of nc-Si/SiC structure with dual phases. • The SiC phase acted as retarding media, leading to enhanced cycle stability. -- Abstract: nc-Si/SiC composite particles were prepared as an anode material for lithium ion batteries using a plasma jet with DC arc discharge. The composition of the nc-Si/SiC composite particles was controlled by setting the mole ratio of CH{sub 4} and SiH{sub 4} precursor gases. X-ray diffraction, TEM images, and Raman shift analyses revealed that the synthesized nc-Si/SiC composite particles comprised a construction of nano-nocaled structure with crystalline phases of active silicon, highly disordered amorphous carbon of graphite and crystalline phases of β-SiC. In the experimental range examined, the nc-Si/SiC composite particles showed good coulombic efficiency in comparison with particles high Si–Si bonding content due to the interplay of particles with a small proportion of carbon and the buffering effect against volume expansion by structural stabilization, and played a role as retarding media for the rapid electrochemical reactions of the SiC crystal against lithium.

Why does tropical convective available potential energy (CAPE) increase with warming?

Science.gov (United States)

Seeley, Jacob T.; Romps, David M.

2015-12-01

Recent work has produced a theory for tropical convective available potential energy (CAPE) that highlights the Clausius-Clapeyron (CC) scaling of the atmosphere's saturation deficit as a driver of increases in CAPE with warming. Here we test this so-called "zero-buoyancy" theory for CAPE by modulating the saturation deficit of cloud-resolving simulations of radiative-convective equilibrium in two ways: changing the sea surface temperature (SST) and changing the environmental relative humidity (RH). For earthlike and warmer SSTs, undilute parcel buoyancy in the lower troposphere is insensitive to increasing SST because of a countervailing CC scaling that balances the increase in the saturation deficit; however, buoyancy increases dramatically with SST in the upper troposphere. Conversely, in the RH experiment, undilute buoyancy throughout the troposphere increases monotonically with decreasing RH. We show that the zero-buoyancy theory successfully predicts these contrasting behaviors, building confidence that it describes the fundamental physics of CAPE and its response to warming.

Polytocy in the Cape serotine bat Eptesicus capensis (A. Smith 1829 ...

African Journals Online (AJOL)

Polytocy is described in the Cape serotine bat, Eptesicus capensis,and discussed in relation to the occurrence of multiple births in other microchiropteran bat species in the southern African subregion. Although twins appear to be characteristic of the Cape serotine bat, triplets and even the occasional quadruplets occur.

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

ORF Alignment: NC_006142 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

ORF Alignment: NC_003233 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_003229 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

ORF Alignment: NC_003236 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

ORF Alignment: NC_000917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003198 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004631 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

ORF Alignment: NC_003318 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

ORF Alignment: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

ORF Alignment: NC_002679 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

ORF Alignment: NC_005810 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_004088 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

ORF Alignment: NC_003143 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51596443 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

The Security and Development Nexus in Cape Town

DEFF Research Database (Denmark)

Jensen, Steffen Bo

2010-01-01

In this article, I argue that the security and development nexus takes on specific forms depending on the context, and that in Cape Town’s coloured townships it is embodied in policies and practices around what has come to be known as the ‘war on gangs’. Furthermore, the war on gangs in Cape Town...... bears resemblances to counterinsurgency strategies — not least in the sense that both are responses to a similar problem of governance. This comparison allows us explore how citizenship is being reconfigured for residents of the townships in ways that resemble what James Holston (2007) calls...

Urban Ecology in Cape Town: South African Comparisons and Reflections

Directory of Open Access Journals (Sweden)

Sarel S. Cilliers

2012-09-01

Full Text Available Little urban ecological research has been done in South Africa. The papers in the Ecology and Society special feature Urban Ecological and Social-Ecological Research in the City of Cape Town make, therefore, an important contribution to the development of urban ecology locally and globally. Different approaches have been used in the study of urban ecology of different urban areas in South Africa. Cape Town is situated in a biodiversity hotspot and is the only South African city which includes a national park. As a result the urban ecological studies were mainly driven by urban nature conservation concerns. In other cities such as Durban, open space planning and environmental management were the major issues which focused ecological studies on urban areas whereas other studies of urban areas in the Eastern Cape and North-West provinces included private and public open spaces and man-made habitats. We reflect on the Cape Town studies in a South African context and highlight conservation of biodiversity, protection of ecosystem services, management of control measures, and the conflict between humans and nature. A brief synthesis has also been given of South African urban ecological research in general.

External electric field effects on Schottky barrier at Gd3N@C80/Au interface

Science.gov (United States)

Onishi, Koichi; Nakashima, Fumihiro; Jin, Ge; Eto, Daichi; Hattori, Hayami; Miyoshi, Noriko; Kirimoto, Kenta; Sun, Yong

2017-08-01

The effects of the external electric field on the height of the Schottky barrier at the Gd3N@C80/Au interface were studied by measuring current-voltage characteristics at various temperatures from 200 K to 450 K. The Gd3N@C80 sample with the conduction/forbidden/valence energy band structure had a face-centered cubic crystal structure with the average grain size of several nanometers. The height of the Gd3N@C80/Au Schottky barrier was confirmed to be 400 meV at a low electric field at room temperature. Moreover, the height decreases with the increasing external electric field through a change of permittivity in the Gd3N@C80 sample due to a polarization of the [Gd3] 9 +-[N3 -+("separators="|C80 ) 6 -] dipoles in the Gd3N@C80 molecule. The field-dependence of the barrier height can be described using a power math function of the electric field strength. The results of the field-dependent barrier height indicate that the reduction in the Schottky barrier is due to an image force effect of the transport charge carrier at the Gd3N@C80/Au interface.

Measures to Facilitate Necessity Entrepreneurship : Western Cape South Africa

OpenAIRE

Macura, Alexander; Sjölund, John

2005-01-01

Problem- In the townships and rural areas of the Western Cape province of South Africa unemployment can be as high as 60%. For many, starting a business is the only viable option to survive. There are many organizations seeking to help entrepreneurs to successfully start and manage a business, but services are significantly lacking. We therefore wish to determine what business service providers in the Western Cape are doing today to help necessity entrepreneurs succeed, and what can be done b...

Is a changing climate affecting the tropical cyclone behavior of Cape Verde?

Science.gov (United States)

Emmenegger, T. W.; Mann, M. E.; Evans, J. L.

2016-12-01

An existing dataset of synthetic tropical cyclone (TC) tracks derived from climate change simulations were used to explore TC variability within a 250 km radius of the Cape Verde Islands (16.5388N, 23.0418W). The synthetic sets were examined according to genesis point location, track projection, intensity, frequency, and seasonality within the observational era (1851 AD to present). These factors of TC variability have been shown to be strongly related to climate oscillations, thus the historical era was grouped by the increasing and decreasing regimes of sea surface temperature (SST) in the main development region (MDR) of the Atlantic Ocean. Numerous studies have examined Atlantic Basin activity throughout this era; the goal of this study is to investigate possible variations in TC behavior around Cape Verde, ultimately determining whether Cape Verde experiences similar fluctuations in activity as observed basin-wide. We find that several facets of TC variability such as intensity, seasonality, and genesis point location around Cape Verde are not significantly different to that of the entire basin, thus forecasts of the entire basin in these respects may also apply to our site. A long-term trend of increasing TC frequency can be identified basin-wide within the observed set, yet activity around Cape Verde does not display this same behavior observably or in any synthetic set. A relationship between the location of genesis points and the regimes of SST fluctuation is shown to be existent. We find both more observed and synthetic genesis points within the vicinity of Cape Verde during cool periods, and an eastward and equatorward shift in cyclogenesis is evident during warm regimes. This southeastern shift in genesis points attributes to the increased intensities of TCs seen during periods of warmer SST. Years of increased SST are additionally linked to an earlier seasonality in Cape Verde.

Analysis of bathymetric surveys to identify coastal vulnerabilities at Cape Canaveral, Florida

Science.gov (United States)

Thompson, David M.; Plant, Nathaniel G.; Hansen, Mark E.

2015-10-07

Cape Canaveral, Florida, is a prominent feature along the Southeast U.S. coastline. The region includes Merritt Island National Wildlife Refuge, Cape Canaveral Air Force Station, NASA’s Kennedy Space Center, and a large portion of Canaveral National Seashore. The actual promontory of the modern Cape falls within the jurisdictional boundaries of Cape Canaveral Air Force Station. Erosion hazards result from winter and tropical storms, changes in sand resources, sediment budgets, and sea-level rise. Previous work by the USGS has focused on the vulnerability of the dunes to storms, where updated bathymetry and topography have been used for modeling efforts. Existing research indicates that submerged shoals, ridges, and sandbars affect patterns of wave refraction and height, coastal currents, and control sediment transport. These seabed anomalies indicate the availability and movement of sand within the nearshore environment, which may be directly related to the stability of the Cape Canaveral shoreline. Understanding the complex dynamics of the offshore bathymetry and associated sediment pathways can help identify current and future erosion vulnerabilities due to short-term (for example, hurricane and other extreme storms) and long-term (for example, sea-level rise) hazards.

Ultraconserved regions encoding ncRNAs are altered in human leukemias and carcinomas.

Science.gov (United States)

Calin, George A; Liu, Chang-gong; Ferracin, Manuela; Hyslop, Terry; Spizzo, Riccardo; Sevignani, Cinzia; Fabbri, Muller; Cimmino, Amelia; Lee, Eun Joo; Wojcik, Sylwia E; Shimizu, Masayoshi; Tili, Esmerina; Rossi, Simona; Taccioli, Cristian; Pichiorri, Flavia; Liu, Xiuping; Zupo, Simona; Herlea, Vlad; Gramantieri, Laura; Lanza, Giovanni; Alder, Hansjuerg; Rassenti, Laura; Volinia, Stefano; Schmittgen, Thomas D; Kipps, Thomas J; Negrini, Massimo; Croce, Carlo M

2007-09-01

Noncoding RNA (ncRNA) transcripts are thought to be involved in human tumorigenesis. We report that a large fraction of genomic ultraconserved regions (UCRs) encode a particular set of ncRNAs whose expression is altered in human cancers. Genome-wide profiling revealed that UCRs have distinct signatures in human leukemias and carcinomas. UCRs are frequently located at fragile sites and genomic regions involved in cancers. We identified certain UCRs whose expression may be regulated by microRNAs abnormally expressed in human chronic lymphocytic leukemia, and we proved that the inhibition of an overexpressed UCR induces apoptosis in colon cancer cells. Our findings argue that ncRNAs and interaction between noncoding genes are involved in tumorigenesis to a greater extent than previously thought.

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_005787 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_003229 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

Large-Nc quantum chromodynamics and harmonic sums

Indian Academy of Sciences (India)

2012-06-08

Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

ORF Alignment: NC_005791 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

ORF Alignment: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu