The atmospheric release advisory capability (ARAC): A federal emergency response capability
International Nuclear Information System (INIS)
Dickerson, M.H.; Sullivan, T.J.
1988-03-01
The Atmospheric Release Capability (ARAC) is a Department of Energy (DOE)-sponsored emergency-response service set up to provide real-time prediction of the dose levels and the extent of surface contamination resulting from a broad range of possible occurrences (accidents, spills, extortion threats involving nuclear material, reentry of nuclear-powered satellites, and atmospheric nuclear tests) that could involve the release of airborne radioactive material. During the past decade, ARAC has responded to more than 150 real-time situations, including exercises. The most notable responses include the Three Mile Island accident in Pennsylvania, the Titan II missile accident in Arkansas, the reentry of the USSR's COSMOS-954 into the atmosphere over Canada, the accidental release of uranium hexafluoride from the Sequoyah Facility accident in Oklahoma, and, most recently, the Chernobyl reactor accident in the Soviet Union. ARAC currently supports the emergency-preparedness plans at 50 Department of Defense (DOD) and DOE sites within the US and also responds to accidents that happen elsewhere. Our ARAC center serves as the focal point for data acquisition, data analysis and assessments during a response, using a computer-based communication network to acquire real-time weather data from the accident site and the surrounding region, as well as pertinent accident information. Its three-dimensional computer models for atmospheric dispersion, MATHEW and ADPIC, digest all this information and produce the predictions used in accident assessment. 9 refs., 6 figs., 1 tab
Atmospheric Release Advisory Capability (ARAC)
International Nuclear Information System (INIS)
Dickerson, M.H.
1975-01-01
The chief purpose of ARAC data acquisition program is to provide site officials, who are responsible for ensuring maximum health protection for the endangered site personnel and public, with estimates of the effects of atmospheric releases of hazardous material as rapidly and accurately as possible. ARAC is in the initial stages of being implemented and is therefore susceptible to changes before it reaches its final form. However the concept of ARAC is fully developed and was successfully demonstrated during a feasibility study conducted in June 1974, as a joint effort between the Savannah River Laboratory (SRL) and Lawrence Livermore Laboratory (LLL). Additional tests between SRL and LLL are scheduled for December 1975. While the immediate goal is the application of ARAC to assist a limited number of ERDA sites, the system is designed with sufficient flexibility to permit expanding the service to a large number of sites. Success in ARAC application should provide nuclear facilities with a means to handle better the urgent questions concerning the potential accidental hazards from atmospheric releases in addition to providing the sites with a capability to assess the effort of their normal operations
Atmospheric Release Advisory capability (ARAC) response to the Three Mile Island accident
International Nuclear Information System (INIS)
Dickerson, M.H.; Gudiksen, P.H.
1979-10-01
This paper discusses the three general classes of support provided by the Atmospheric Release Advisory Capability (ARAC) and describes the role played by ARAC in support of DOE during the Three Mile Island accident in March and April of 1979
Atmospheric Release Advisory Capability (ARAC) response to the Three Mile Island accident
International Nuclear Information System (INIS)
Dickerson, M.H.; Gudiksen, P.H.
1980-01-01
A discussion is presented of the three general classes of support provided by the Atmospheric Release Advisory Capability (ARAC) and describes the role played by ARAC in support of DOE during the Three Mile Island accident in March and April of 1979. 6 refs
ARAC: A support capability for emergency managers
Energy Technology Data Exchange (ETDEWEB)
Pace, J.C.; Sullivan, T.J.; Baskett, R.L. [and others
1995-08-01
This paper is intended to introduce to the non-radiological emergency management community the 20-year operational history of the Atmospheric Release Advisory Capability (ARAC), its concept of operations, and its applicability for use in support of emergency management decision makers. ARAC is a centralized federal facility for assessing atmospheric releases of hazardous materials in real time, using a robust suite of three-dimensional atmospheric transport and diffusion models, extensive geophysical and source-description databases, automated meteorological data acquisition systems, and experienced staff members. Although originally conceived to respond to nuclear accidents, the ARAC system has proven to be extremely adaptable, and has been used successfully during a wide variety of nonradiological hazardous chemical situations. ARAC represents a proven, validated, operational support capability for atmospheric hazardous releases.
Operators guide: Atmospheric Release Advisory Capability (ARAC) site facility
International Nuclear Information System (INIS)
Lawver, B.S.
1977-01-01
In this report capabilities and services are described for the Atmospheric Release Advisory Capability (ARAC). The ARAC site system and its operating procedures and interactions with the ARAC central facility located at LLL is outlined. ARAC is designed to help officials at designated ERDA sites and other locations in estimating the effects of atmospheric releases of radionuclides or other hazardous materials by issuing real-time advisories to guide them in their planning
Operators guide: Atmospheric Release Advisory Capability (ARAC) site facility
International Nuclear Information System (INIS)
Cassaro, E.; Lomonaco, L.
1979-01-01
The Atmospheric Release Advisory Capability (ARAC) is designed to help officials at designated DOE sites and other locations in estimating the effects of atmospheric releases of radionuclides or other hazardous materials by issuing real-time advisories to guide them in their planning. This report outlines the capabilities and sources of ARAC, and in more detail describes an ARAC Site Facility, its operating procedures and interactions with the ARAC Central Facility (ACF) located at LLL
International Nuclear Information System (INIS)
Kelly, M.F.; Wyman, R.H.
1975-01-01
In spite of the remarkable safety record of the nuclear industry as a whole, recent public concern over the potential impact of the industry's accelerated growth has prompted ERDA to expand its emergency response procedures. The Atmospheric Release Advisory Capability, ARAC, is a computer communications system designed to enhance the existing emergency response capability of ERDA nuclear facilities. ARAC will add at least two new functions to this capability: centralized, real-time data acquisition and storage, and simulation of the long range atmospheric transport of hazardous materials. To perform these functions, ARAC employs four major sub-systems or facilities: the site facility, the central facility, the global weather center and the regional model. The system has been under development for the past two years at the Lawrence Livermore Laboratory of the University of California
Atmospheric Release Advisory Capability (ARAC): development and plans for implementation
International Nuclear Information System (INIS)
Dickerson, M.H.; Orphan, R.C.
1975-01-01
The Atmospheric Release Advisory Capability (ARAC) is an ERDA-sponsored service planned for nuclear facilities which require a means of real-time prediction of the extent of health hazards that may result from a release of radionuclides or other toxic materials. Since 1973 when the ARAC concept was initiated, a joint feasibility study has been conducted by Lawrence Livermore Laboratory and Savannah River Laboratory, and a prototype component of the system has been built and placed in operation. During the next three years plans are to implement the ARAC service for certain ERDA nuclear facilities. A brief description is presented of the ARAC concept, and progress to date is reported. (U.S.)
The ARAC client system: network-based access to ARAC
International Nuclear Information System (INIS)
Leach, M J; Sumikawa, D; Webster, C
1999-01-01
The ARAC Client System allows users (such as emergency managers and first responders) with commonly available desktop and laptop computers to utilize the central ARAC system over the Internet or any other communications link using Internet protocols. Providing cost-effective fast access to the central ARAC system greatly expands the availability of the ARAC capability. The ARAC Client system consists of (1) local client applications running on the remote user's computer, and (2) ''site servers'' that provide secure access to selected central ARAC system capabilities and run on a scalable number of dedicated workstations residing at the central facility. The remote client applications allow users to describe a real or potential them-bio event, electronically sends this information to the central ARAC system which performs model calculations, and quickly receive and visualize the resulting graphical products. The site servers will support simultaneous access to ARAC capabilities by multiple users. The ARAC Client system is based on object-oriented client/server and distributed computing technologies using CORBA and Java, and consists of a large number of interacting components
International Nuclear Information System (INIS)
Knox, J.B.; Dickerson, M.H.; Greenly, G.D.; Gudiksen, P.H.; Sullivan, T.J.
1980-01-01
At 0820 PST on 28 March 1979, the Department of Energy's Emergency Operations Center advised the Atmospheric Release Advisory Capability (ARAC) that the Three Mile Island nuclear power plant in Harrisburg, Pennsylvania, had experienced an accident some four hours earlier, resulting in the atmospheric release of xenon-133 and krypton-88. This report describes ARAC's response to the Three Mile Island accident, including the role ARAC played throughout the 20 days that real-time assessments were made available to the Department of Energy on-scene commander. It also describes the follow-up population-dose calculations performed for the President's Commission on Three Mile Island. At the request of the Nuclear Regulatory Commission, a questionnaire addressing the usefulness of ARAC products during the accident was sent to ARAC-product users. A summary of the findings from this questionnaire, along with recommendations for improving ARAC service, is also presented. The accident at Mississauga, Ontario, Canada, is discussed in the context of a well-planned emergency response by local and Federal officials
Optimization aspects of the ARAC real-time radiological emergency response system
International Nuclear Information System (INIS)
Taylor, S.S.; Sullivan, T.J.
1985-07-01
The Atmospheric Release Advisory Capability (ARAC) project at the Lawrence Livermore National Laboratory responds to radiological emergencies throughout the Continental United States. Using complex three-dimensional dispersion models to account for the effects of complex meteorology and regional terrain, ARAC simulates the release of radioactive materials and provides dispersion, deposition, and dose calculations that are displayed over local geographic features for use by authorities at the accident/release site. ARAC's response is ensured by a software system that (1) makes optimal use of dispersion models, (2) minimizes the time required to provide projections, and (3) maximizes the fault-tolerance of the system. In this paper we describe ARAC's goals and functionality and the costs associated with its development and use. Specifically, we address optimizations in ARAC notifications, meteorological data collection, the determination of site- and problem-specific parameters, the generation of site-specific topography and geography, the running of models, and the distribution of ARAC products. We also discuss the backup features employed to ensure ARAC's ability to respond
Savannah River release: test of the new ARAC capability
International Nuclear Information System (INIS)
Dickerson, M.H.
1977-01-01
Working jointly from opposite sides of the nation Lawrence Livermore Laboratory (LLL) and the Savannah River Laboratory (SRL) quickly assessed the consequences of an early-morning tritium release in May 1974 from the Savannah River Plant, in South Carolina. Measurements confirmed the accuracy of the LLL predictions. Due to the small quantity involved and to the release location (well within the plant confines), the release was not dangerous to the public. The emergency provided a dramatic test of procedures and capabilities of the new Atmospheric Release Advisory Capability (ARAC) center at Livermore, which was not yet operational, demonstrating the capacity for quick response, and the feasibility of real-time data acquisition and transmittal across the continent
International Nuclear Information System (INIS)
Dickerson, M.H.; Knox, J.B.; Orphan, R.C.
1979-01-01
The Atmospheric Release Advisory Capability service (ARAC), has three main functions: to provide support to designated Department of Energy facilities during an accidental atmospheric release of radionuclides; to support the DOE Emergency Response Team in the event of potential or actual releases of radionuclides; and to provide the Federal Aviation Administration with dose assessments whenever aircraft could possibly intercept a nuclear debris cloud from a Chinese atmospheric nuclear test. A computer network linking the central facility at Livermore with the Air Force Global Weather Central and the remote DOE sites allows rapid data transmission and analysis. Facilities are described, and tests and responses of the ARAC system and models from May 1974 to April 24, 1979 are outlined
Evaluation of ARAC`s participation in a long-range transport experiment
Energy Technology Data Exchange (ETDEWEB)
Pace, J.C.; Pobanz, B.M.; Foster, C.S.; Baskett, R.L.; Vogt, P.J.; Schalk, W.W. III
1995-08-01
The 1994 European Tracer Experiment (ETEX) involved two releases of inert tracer gas in western France, allowing subsequent detection at many locations across Europe. Twenty four operational and research facilities from 20 countries made predictions of the motion of the released plume and the resulting concentrations detected at the sampler locations. This paper describes participation by the Lawrence Livermore National Laboratory`s Atmospheric Release Advisory Capability (ARAC) in ETEX. In its role as a real-time emergency response center, ARAC operates a suite of numerical models which simulate the advection and diffusion of airborne releases, and which calculate the estimated downwind concentration of the released material. The models and procedures used by ARAC to participate in ETEX were essentially the same as those which would be used to respond to a release at any previously unspecified location.
ARAC: A unique command and control resource
Energy Technology Data Exchange (ETDEWEB)
Bradley, M.M.; Baskett, R.L.; Ellis, J.S. [and others
1996-04-01
The Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory (LLNL) is a centralized federal facility designed to provide real-time, world-wide support to military and civilian command and control centers by predicting the impacts of inadvertent or intentional releases of nuclear, biological, or chemical materials into the atmosphere. ARAC is a complete response system consisting of highly trained and experienced personnel, continually updated computer models, redundant data collection systems, and centralized and remote computer systems. With over 20 years of experience responding to domestic and international incidents, strong linkages with the Department of Defense, and the ability to conduct classified operations, ARAC is a unique command and control resource.
ARAC: A unique command and control resource
International Nuclear Information System (INIS)
Bradley, M.M.; Baskett, R.L.; Ellis, J.S.
1996-04-01
The Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory (LLNL) is a centralized federal facility designed to provide real-time, world-wide support to military and civilian command and control centers by predicting the impacts of inadvertent or intentional releases of nuclear, biological, or chemical materials into the atmosphere. ARAC is a complete response system consisting of highly trained and experienced personnel, continually updated computer models, redundant data collection systems, and centralized and remote computer systems. With over 20 years of experience responding to domestic and international incidents, strong linkages with the Department of Defense, and the ability to conduct classified operations, ARAC is a unique command and control resource
Expansion of ARAC for chemical releases
International Nuclear Information System (INIS)
Baskett, R.L.; Blair, M.D.; Foster, C.S.; Taylor, A.G.
1997-01-01
In 1996 the Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory (LLNL) completed an effort to expand its national emergency response modeling system for chemical releases. Key components of the new capability include the integration of (1) an extensive chemical property database, (2) source modeling for tanks and evaporating pools, (3) denser-than-air dispersion, (4) public exposure guidelines, and (5) an interactive graphical user interface (GUI). Recent use and the future of the new capability are also discussed
International Nuclear Information System (INIS)
Dickerson, M.H.; Knox, J.B.
1986-10-01
The Atmospheric Release Advisory Capability (ARAC) is an emergency planning, response, and assessment service, developed by the US Departments of Energy and Defense, and focused, thus far, on atmospheric releases of nuclear material. For the past 14 years ARAC has responded to over 150 accidents, potential accidents, and major exercises. The most notable accident responses are the COSMOS 954 reentry, the Three Mile Island (TMI-2) accident and subsequent purge of 85 Kr from the containment vessel, the recent UF 6 accident at the Kerr-McGee Plant, Gore, Oklahoma, and the Chernobyl nuclear reactor accident in the Soviet Union. Based on experience in the area of emergency response, developed during the past 14 years, this paper describes the cost effectiveness and other advantages of a centralized emergency planning, response, and assessment service for atmospheric releases of nuclear material
International Nuclear Information System (INIS)
Dickerson, M.H.; Knox, J.B.
1987-01-01
The Atmospheric Release Advisory Capability (ARAC) is an emergency planning, response, and assessment service, developed by the US Departments of Energy and Defense, and focused, thus far, on atmospheric releases of nuclear material. For the past 14 years ARAC has responded to over 150 accidents, potential accidents, and major exercises. The most notable accident responses are the COSMOS 954 reentry, the Three Mile Island (TMI-2) accident and subsequent purge of 85 Kr from the containment vessel, the recent UF 6 accident at the Kerr-McGee Plant, Gore, Oklahoma, and the Chernobyl nuclear reactor accident in the Soviet Union. Based on experience in the area of emergency response, developed during the past 14 years, this paper describes the cost effectiveness and other advantages of a centralized emergency planning, response, and assessment service for atmospheric releases of nuclear material
ARAC: a computer-based emergency dose-assessment service
International Nuclear Information System (INIS)
Sullivan, T.J.
1990-01-01
Over the past 15 years, the Lawrence Livermore National Laboratory's Atmospheric Release Advisory Capability (ARAC) has developed and evolved a computer-based, real-time, radiological-dose-assessment service for the United States Departments of Energy and Defense. This service is built on the integrated components of real-time computer-acquired meteorological data, extensive computer databases, numerical atmospheric-dispersion models, graphical displays, and operational-assessment-staff expertise. The focus of ARAC is the off-site problem where regional meteorology and topography are dominant influences on transport and dispersion. Through application to numerous radiological accidents/releases on scales from small accidental ventings to the Chernobyl reactor disaster, ARAC has developed methods to provide emergency dose assessments from the local to the hemispheric scale. As the power of computers has evolved inversely with respect to cost and size, ARAC has expanded its service and reduced the response time from hours to minutes for an accident within the United States. Concurrently the quality of the assessments has improved as more advanced models have been developed and incorporated into the ARAC system. Over the past six years, the number of directly connected facilities has increased from 6 to 73. All major U.S. Federal agencies now have access to ARAC via the Department of Energy. This assures a level of consistency as well as experience. ARAC maintains its real-time skills by participation in approximately 150 exercises per year; ARAC also continuously validates its modeling systems by application to all available tracer experiments and data sets
International Nuclear Information System (INIS)
Dickerson, M.H.; Gudiksen, P.H.; Sullivan, T.J.; Greenly, G.D.
1985-05-01
The Atmospheric Release Advisory Capability is a real-time emergency-response service available to federal and state agencies for providing estimates of the environmental consequences of accidental releases of radioactivity into the atmosphere. This includes the estimation of radiation doses to nearby population centers and the levels and extent of surface contamination. The service is currently being expanded to support the emergency response plans at approximately 50 Department of Defense and Department of Energy facilities. This expansion consists of the installation of enhanced computational and data communications and processing systems, development of terrain and geographic data bases, improvements in modeling capabilities, as well as increased staff housing facilities. This report summarizes the current status of ARAC and the requirements to receive the service
Evaluation of ARAC's participation in a long-range transport experiment
International Nuclear Information System (INIS)
Pace, J.C.; Pobanz, B.M.; Foster, C.S.; Baskett, R.L.; Vogt, P.J.; Schalk, W.W. III.
1995-08-01
The 1994 European Tracer Experiment (ETEX) involved two releases of inert tracer gas in western France, allowing subsequent detection at many locations across Europe. Twenty four operational and research facilities from 20 countries made predictions of the motion of the released plume and the resulting concentrations detected at the sampler locations. This paper describes participation by the Lawrence Livermore National Laboratory's Atmospheric Release Advisory Capability (ARAC) in ETEX. In its role as a real-time emergency response center, ARAC operates a suite of numerical models which simulate the advection and diffusion of airborne releases, and which calculate the estimated downwind concentration of the released material. The models and procedures used by ARAC to participate in ETEX were essentially the same as those which would be used to respond to a release at any previously unspecified location
ARAC: A flexible real-time dose consequence assessment system
International Nuclear Information System (INIS)
Ellis, J.S.; Sullivan, T.J.
1993-01-01
Since its beginning, the Atmospheric Release Advisory Capability (ARAC), an emergency radiological dose assessment service of the US Government, has been called on to do consequence assessments for releases into the atmosphere of radionuclides and a variety of other substances. Some of the more noteworthy emergency responses have been for the Three Mile Island and Chernobyl nuclear power reactor accidents, and more recently, for a cloud of gases from a rail-car spill into the Sacramento river of the herbicide metam sodium, smoke from hundreds of burning oil wells in Kuwait, and ash clouds from the eruption of Mt. Pinatubo. The spatial scales of these responses range from local, to regional, to global, and the response periods from hours, to weeks, to months. Because of the variety of requirements of each unique assessment, ARAC has developed and maintains a flexible system of people, computer software and hardware
Analysis of ARAC participation in the Idaho field experiment
International Nuclear Information System (INIS)
Rosen, L.C.; Hill, K.L.
1986-02-01
The 1981 Idaho Field Experiment to coordinate data sets and evaluate model and computer facilities is summarized herein. Participation of the Atmospheric Release Advisory Capability (ARAC) of the Lawrence Livermore National Laboratory in the field experiment is discussed. The computed ARAC results are compared with the observational data sets and analyzed. 12 refs., 44 figs., 3 tabs
Graphics metafile interface to ARAC emergency response models for remote workstation study
International Nuclear Information System (INIS)
Lawver, B.S.
1985-01-01
The Department of Energy's Atmospheric Response Advisory Capability models are executed on computers at a central computer center with the output distributed to accident advisors in the field. The output of these atmospheric diffusion models are generated as contoured isopleths of concentrations. When these isopleths are overlayed with local geography, they become a useful tool to the accident site advisor. ARAC has developed a workstation that is located at potential accident sites. The workstation allows the accident advisor to view color plots of the model results, scale those plots and print black and white hardcopy of the model results. The graphics metafile, also known as Virtual Device Metafile (VDM) allows the models to generate a single device independent output file that is partitioned into geography, isoopleths and labeling information. The metafile is a very compact data storage technique that is output device independent. The metafile frees the model from either generating output for all known graphic devices or requiring the model to be rerun for additional graphic devices. With the partitioned metafile ARAC can transmit to the remote workstation the isopleths and labeling for each model. The geography database may not change and can be transmitted only when needed. This paper describes the important features of the remote workstation and how these features are supported by the device independent graphics metafile
Atmospheric Release Advisory Capability
International Nuclear Information System (INIS)
Dickerson, M.H.; Gudiksen, P.H.; Sullivan, T.J.
1983-02-01
The Atmospheric Release Advisory Capability (ARAC) project is a Department of Energy (DOE) sponsored real-time emergency response service available for use by both federal and state agencies in case of a potential or actual atmospheric release of nuclear material. The project, initiated in 1972, is currently evolving from the research and development phase to full operation. Plans are underway to expand the existing capability to continuous operation by 1984 and to establish a National ARAC Center (NARAC) by 1988. This report describes the ARAC system, its utilization during the past two years, and plans for its expansion during the next five to six years. An integral part of this expansion is due to a very important and crucial effort sponsored by the Defense Nuclear Agency to extend the ARAC service to approximately 45 Department of Defense (DOD) sites throughout the continental US over the next three years
ARAC feasibility study for the NRC Phase I: final report
International Nuclear Information System (INIS)
Rosen, L.C.; Orphan, R.C.
1979-11-01
The feasibility of implementing ARAC (Atmospheric Release Advisory Capability) services in a particular nuclear power plant is examined. The criteria for selecting Rancho Seco are discussed and the physical, meteorological and procedural factors related to the plant are assessed. The potential benefits and limitations of implementing ARAC at Rancho Seco are analyzed. The costs of employing the system at the nuclear power plant are given for alternative plans. A training and familiarization program is outlined
International Nuclear Information System (INIS)
Gudiksen, P.H.; Sullivan, T.J.; Harvey, T.F.
1986-10-01
The Atmospheric Release Advisory Capability (ARAC) project, developed by the Lawrence Livermore National Laboratory (LLNL), provides real-time dose assessments and estimates of the extent of surface contamination that may result from an atmospheric release of radioactivity. It utilizes advanced computer-based data communication and processing systems to acquire the meteorological and source term information needed by the three-dimensional atmospheric dispersion models to derive the consequence assessments. The ARAC responded to the recent Chernobyl reactor accident in the Soviet Union by estimating the source term and the radiation dose distribution due to exposure to the radioactive cloud over Europe and the Northern Hemisphere. This analysis revealed that approximately 50% of the estimated core inventories of I-131 and Cs-137 were released. The estimated committed effective dose equivalent due to inhalation of radioactivty during cloud passage is of the order of 10 mrem within parts of Scandinavia and eastern Europe, while most of the populations within central Europe were exposed to levels ranging from 1 to 10 mrem. The amount of Cs-137 released by the Chernobyl accident far exceeds that released by previous reactor accidents, but is only about 6% of the Cs-137 produced by the atmospheric weapon testing programs. 9 refs., 4 figs., 2 tabs
The Atmospheric Release Advisory Capability Site Workstation System
International Nuclear Information System (INIS)
Foster, K.T.; Sumikawa, D.A.; Foster, C.S.; Baskett, R.L.
1993-01-01
The Atmospheric Release Advisory Capability (ARAC) is a centralized emergency response service that assesses the consequences that may result from an atmospheric release of toxic material. ARAC was developed by the Lawrence Livermore National Laboratory (LLNL) for the Departments of Energy (DOE) and Defense (DOD) and responds principally to radiological accidents. ARAC provides radiological health and safety guidance to decision makers in the form of computer-generated estimates of the effects of an actual, or potential release of radioactive material into the atmosphere. Upon receipt of the release scenario, the ARAC assessment staff extracts meteorological, topographic, and geographic data from resident world-wide databases for use in complex, three-dimensional transport and diffusion models. These dispersion models generate air concentration (or dose) and ground deposition contour plots showing estimates of the contamination patterns produced as the toxic material is carried by the prevailing winds. To facilitate the ARAC response to a release from specific DOE and DOD sites and to provide these sites with a local emergency response tool, a remote Site Workstation System (SWS) is being placed at various ARAC-supported facilities across the country.. This SWS replaces the existing antiquated ARAC Site System now installed at many of these sites. The new system gives users access to complex atmospheric dispersion models that may be run either by the ARAC staff at LLNL, or (in a later phase of the system) by site personnel using the computational resources of the SWS. Supporting this primary function are a variety of SWS-resident supplemental capabilities that include meteorological data acquisition, manipulation of release-specific databases, computer-based communications, and the use of a simpler Gaussian trajectory puff model that is based on Environmental Protection Agency's INPUFF code
NNSA/NV Consequence Management Capabilities for Radiological Emergency Response
International Nuclear Information System (INIS)
Bowman, D. R.
2002-01-01
The U.S. Department of Energy's National Nuclear Security Administration Nevada Operations Office (NNSA/NV) provides an integrated Consequence Management (CM) response capability for the (NNSA) in the event of a radiological emergency. This encompasses planning, technical operations, and home team support. As the lead organization for CM planning and operations, NNSA/NV coordinates the response of the following assets during the planning and operational phases of a radiological accident or incident: (1) Predictive dispersion modeling through the Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory (LLNL) and the High Consequence Assessment Group at Sandia National Laboratories (SNL); (2) Regional radiological emergency assistance through the eight Radiological Assistance Program (RAP) regional response centers; (3) Medical advice and assistance through the Radiation Emergency Assistance Center/Training Site (REAC/TS) in Oak Ridge, Tennessee; (4) Aerial radiological mapping using the fixed-wing and rotor-wing aircraft of the Aerial Measuring System (AMS); (5) Consequence Management Planning Teams (CMPT) and Consequence Management Response Teams (CMRT) to provide CM field operations and command and control. Descriptions of the technical capabilities employed during planning and operations are given below for each of the elements comprising the integrated CM capability
Evacuation emergency response model coupling atmospheric release advisory capability output
International Nuclear Information System (INIS)
Rosen, L.C.; Lawver, B.S.; Buckley, D.W.; Finn, S.P.; Swenson, J.B.
1983-01-01
A Federal Emergency Management Agency (FEMA) sponsored project to develop a coupled set of models between those of the Lawrence Livermore National Laboratory (LLNL) Atmospheric Release Advisory Capability (ARAC) system and candidate evacuation models is discussed herein. This report describes the ARAC system and discusses the rapid computer code developed and the coupling with ARAC output. The computer code is adapted to the use of color graphics as a means to display and convey the dynamics of an emergency evacuation. The model is applied to a specific case of an emergency evacuation of individuals surrounding the Rancho Seco Nuclear Power Plant, located approximately 25 miles southeast of Sacramento, California. The graphics available to the model user for the Rancho Seco example are displayed and noted in detail. Suggestions for future, potential improvements to the emergency evacuation model are presented
International Nuclear Information System (INIS)
Baskett, R.L.; Sullivan, T.J.; Ellis, J.S.; Foster, C.S.
1994-01-01
The Federal Radiological Emergency Response Plan (FRERP) can provide several emergency response resources in response to a nuclear power plant (NPP) accident if requested by a state or local agency. The primary FRERP technical resources come from the US Department of Energy's (DOE) Federal Radiological Monitoring and Assessment Center (FRMAC). Most of the FRMAC assets are located at the DOE Remote Sensing Laboratory (RSL) at Nellis Air Force Base, Las Vegas, Nevada. In addition, the primary atmospheric dispersion modeling and dose assessment asset, the Atmospheric Release Advisory Capability (ARAC) is located at Lawrence Livermore National Laboratory (LLNL) in Livermore, California. In the early stages of a response, ARAC relies on its automatic worldwide meteorological data acquisition via the Air Force Global Weather Center (AFGWC). The regional airport data are supplemented with data from on-site towers and sodars and the National Oceanographic ampersand Atmospheric Administration's (NOAA) field-deployable real-time rawinsonde system. ARAC is prepared with three-dimensional regional-scale diagnostic dispersion model to simulate the complex mixed fission product release from a reactor accident. The program has been operational for 18 years and is presently developing its third generation system. The current modernization includes faster central computers, a new site workstation system. The current modernization includes faster central computers, a new site workstation system, improvements in its diagnostic dispersion models, addition of a new hybrid-particle source term, and implementation of a mesoscale prognostic model. AS these new capabilities evolve, they will be integrated into the FRMAC's field-deployable assets
ARAC response to the Chernobyl reactor accident
International Nuclear Information System (INIS)
Dickerson, M.H.; Sullivan, T.J.
1986-07-01
This report summarizes the assessments provided by ARAC during the first two weeks after the Chernobyl reactor accident began. Results of this work and measurements made by European countries during that same period show that no major short-term acute health effects would be expected in Europe as a result of this accident. Statistical long-term health effects were not addressed in these studies. Both measured and calculated I-131 concentrations in milk in the US were over an order of magnitude below the USDA guideline of 15,000 pCi/l
International Nuclear Information System (INIS)
Aluzzi, F J; Pace, J C; Pobanz, B M; Vogt, P J
1999-01-01
On May 30, 1998 scrap metal containing radioactive Cesium-137 (Cs-137) was accidentally melted in a furnace at the Acerinox steel mill in Algeciras, Spain. Cs-137 was released from the mill's smokestack, and spread across the western Mediterranean Sea to France and Italy and beyond. The first indication of the release was radiation levels up to 1000 times background reported by Swiss, French, and Italian authorities during the following two weeks. Initially no elevated radiation levels were detected over Spain. A release of hazardous material to the atmosphere is the type of situation the Atmospheric Release Advisory Capability (ARAC) emergency response organization was designed to address. The amount and exact time of the release were unknown, though the incident was thought to have taken place during the last week in May. Using air concentration measurements supplied by colleagues of ARAC in Spain, France, Switzerland, Italy, Sweden, Russia and the European Union, ARAC meteorologists estimated the magnitude and timing of the release (Vogt, 1999). Correctly locating the downwind footprint is the most important goal of emergency response modeling. In this study, we compare predicted results for the Algeciras event based on four wind data sources: (1) US Navy Operational Global Atmospheric Prediction System (NOGAPS) data alone, (2) surface and upper air observations alone, (3) NOGAPS data together with surface and upper air observations, and (4) forecasts from ARAC's in-house execution of the U.S. Navy Operational Regional Atmospheric Prediction System (NORAPS) (without surface or upper air observations). We compare the resulting dispersion predictions from ARAC's diagnostic dispersion modeling system to the measurements supplied by our European colleagues to determine which data source produced the best results
Using the /phi/resund experimental data to evaluate the ARAC emergency response models
International Nuclear Information System (INIS)
Gudiksen, P.H.; Gryning, S.E.
1988-07-01
A series of meteorological and tracer experiments, was conducted during May and June 1984 over the 20-km wide /O/resund strait between Denmark and Sweden for the purpose of studying atmospheric dispersion processes over cold water and warm land surfaces and providing the data needed to evaluate meso-scale models in a coastal environment. In concert with these objectives the data from these experiments have been used as part of a continuing effort to evaluate the capability of the three-dimensional MATHEW/ADPIC (M/A) atmospheric dispersion models to simulate pollutant transport and diffusion characteristics of the atmospheric during a wide variety of meteorological conditions. Since previous studies have focused primarily on M/A model evaluations over rolling and complex terrain at inland sites, the /O/resund experiments provide a unique opportunity to evaluate the models in a coastal environment. The M/A models are used by the Atmospheric Release Advisory Capability (ARAC), developed by the Lawrence Livermore National Laboratory, for performing real-time assessments of the environmental consequences of potential or actual releases of radioactivity into the atmosphere. These assessments include estimation of radiation doses to nearby population centers and of the extent of surface contamination. Model evaluations, using field experimental data such as those generated by the /O/resund experiments, serve as a basis for providing emergency response managers with estimated of the uncertainties associated with accident consequence assessments. This report provides a brief description of the /O/resund experiments, the current understanding of the meteorological processes governing pollutant dispersion over the /O/resund strait, and the results of the M/A model simulations of these experiments. 11 refs., 7 figs., 1 tab
Zhuo, Ming; Gorgun, Murat F; Englander, Ella W
2018-06-01
Peripheral Nervous System (PNS) neurotoxicity caused by cancer drugs hinders attainment of chemotherapy goals. Due to leakiness of the blood nerve barrier, circulating chemotherapeutic drugs reach PNS neurons and adversely affect their function. Chemotherapeutic drugs are designed to target dividing cancer cells and mechanisms underlying their toxicity in postmitotic neurons remain to be fully clarified. The objective of this work was to elucidate progression of events triggered by antimitotic drugs in postmitotic neurons. For proof of mechanism study, we chose cytarabine (ara-C), an antimetabolite used in treatment of hematological cancers. Ara-C is a cytosine analog that terminates DNA synthesis. To investigate how ara-C affects postmitotic neurons, which replicate mitochondrial but not genomic DNA, we adapted a model of Dorsal Root Ganglion (DRG) neurons. We showed that DNA polymerase γ, which is responsible for mtDNA synthesis, is inhibited by ara-C and that sublethal ara-C exposure of DRG neurons leads to reduction in mtDNA content, ROS generation, oxidative mtDNA damage formation, compromised mitochondrial respiration and diminution of NADPH and GSH stores, as well as, activation of the DNA damage response. Hence, it is plausible that in ara-C exposed DRG neurons, ROS amplified by the high mitochondrial content shifts from physiologic to pathologic levels signaling stress to the nucleus. Combined, the findings suggest that ara-C neurotoxicity in DRG neurons originates in mitochondria and that continuous mtDNA synthesis and reliance on oxidative phosphorylation for energy needs sensitize the highly metabolic neurons to injury by mtDNA synthesis terminating cancer drugs. Copyright © 2018 Elsevier Inc. All rights reserved.
Circumvention of ara-C resistance by aphidicolin in blast cells from patients with AML.
Sargent, J M; Elgie, A W; Williamson, C J; Lewandowicz, G M; Taylor, C G
2001-03-02
Treatment failure in AML is often attributed to P-glycoprotein-associated multidrug resistance. However, the importance of increased DNA repair in resistant cells is becoming more apparent. In order to investigate the ability of the DNA repair inhibitor aphidicolin to modulate drug resistance, we continually exposed blasts cells, isolated from 22 patients with AML, to a variety of agents +/- 15 microM aphidicolin for 48 hours. Cell survival was measured using the MTT assay. Overall, there was no significant effect of aphidicolin on sensitivity to daunorubicin, doxorubicin, etoposide or fludarabine. However, there was a marked increase in sensitivity to ara-C with a median 4.75-fold increase overall (range 0.8-80-fold;P< 0.005). The effect of aphidicolin was significantly greater in blast cells found resistant in vitro to ara-C (8.9-fold compared to 2.12-fold, P< 0.01). This observation was further validated by the correlation between ara-C LC(50)and extent of modulation effect (P< 0.05). Cells isolated from 10 cord blood samples were also tested in order to establish the haematological toxicity of combining ara-C and aphidicolin. The therapeutic index (LC(50)normal cells/tumour cells) for ara-C + aphidicolin was higher than that for ara-C alone suggesting no increased myelotoxicity for the combination. Increased cytotoxicity without increased haematotoxicity makes the combination of ara-C plus aphidicolin ideal for inclusion in future clinical trials. Copyright 2001 Cancer Research Campaign.
Nagaoka, Shin-ichi; Nagai, Kanae; Fujii, Yuko; Ouchi, Aya; Mukai, Kazuo
2013-10-23
A new free radical absorption capacity assay method is proposed with use of an aroxyl radical (2,6-di-tert-butyl-4-(4'-methoxyphenyl)phenoxyl radical) and stopped-flow spectroscopy and is named the aroxyl radical absorption capacity (ARAC) assay method. The free radical absorption capacity (ARAC value) of each tocopherol was determined through measurement of the radical-scavenging rate constant in ethanol. The ARAC value could also be evaluated through measurement of the half-life of the aroxyl radical during the scavenging reaction. For the estimation of the free radical absorption capacity, the aroxyl radical was more suitable than the DPPH radical, galvinoxyl, and p-nitrophenyl nitronyl nitroxide. The ARAC value in tocopherols showed the same tendency as the free radical absorption capacities reported previously, and the tendency was independent of an oxygen radical participating in the scavenging reaction and of a medium surrounding the tocopherol and oxygen radical. The ARAC value can be directly connected to the free radical-scavenging rate constant, and the ARAC method has the advantage of treating a stable and isolable radical (aroxyl radical) in a user-friendly organic solvent (ethanol). The ARAC method was also successfully applied to a palm oil extract. Accordingly, the ARAC method would be useful in free radical absorption capacity assay of antioxidative reagents and foods.
Translation of ARAC computer codes
International Nuclear Information System (INIS)
Takahashi, Kunio; Chino, Masamichi; Honma, Toshimitsu; Ishikawa, Hirohiko; Kai, Michiaki; Imai, Kazuhiko; Asai, Kiyoshi
1982-05-01
In 1981 we have translated the famous MATHEW, ADPIC and their auxiliary computer codes for CDC 7600 computer version to FACOM M-200's. The codes consist of a part of the Atmospheric Release Advisory Capability (ARAC) system of Lawrence Livermore National Laboratory (LLNL). The MATHEW is a code for three-dimensional wind field analysis. Using observed data, it calculates the mass-consistent wind field of grid cells by a variational method. The ADPIC is a code for three-dimensional concentration prediction of gases and particulates released to the atmosphere. It calculates concentrations in grid cells by the particle-in-cell method. They are written in LLLTRAN, i.e., LLNL Fortran language and are implemented on the CDC 7600 computers of LLNL. In this report, i) the computational methods of the MATHEW/ADPIC and their auxiliary codes, ii) comparisons of the calculated results with our JAERI particle-in-cell, and gaussian plume models, iii) translation procedures from the CDC version to FACOM M-200's, are described. Under the permission of LLNL G-Division, this report is published to keep the track of the translation procedures and to serve our JAERI researchers for comparisons and references of their works. (author)
International Nuclear Information System (INIS)
Rosen, L.C.
1983-01-01
A project to demonstrate the feasibility of utilizing Atmospheric Release Advisory Capability (ARAC) limited service with commercial nuclear power plants and their associated state offices of emergency preparedness is discussed. Preliminary planning, installation and testing of the ARAC site facilities at Indian Point Nucler Power Station, New York State; at New York State Office of Emergency Preparedness, Albany, New York; at Rancho Seco Nuclear Generating Station, California; and at the State of California Office of Emergency Services, Sacramento, California, are summarized. ARAC participation in the Robert E. Ginna nuclear generating plant accident in New York on January 25, 1982, is discussed. The ARAC system is evaluated with emphasis on communications, the suite of models contained within the ARAC system, and the staff. The implications of this project in designing the next-generation ARAC system to service federal and state needs are assessed
Chen, Wei; Zhang, Shan; Jiang, Peixia; Yao, Jun; He, Yongzhi; Chen, Lincai; Gui, Xiwu; Dong, Zhiyang; Tang, Shuang-Yan
2015-07-01
Advanced high-throughput screening methods for small molecules may have important applications in the metabolic engineering of the biosynthetic pathways of these molecules. Ectoine is an excellent osmoprotectant that has been widely used in cosmetics. In this study, the Escherichia coli regulatory protein AraC was engineered to recognize ectoine as its non-natural effector and to activate transcription upon ectoine binding. As an endogenous reporter of ectoine, the mutated AraC protein was successfully incorporated into high-throughput screening of ectoine hyper-producing strains. The ectoine biosynthetic cluster from Halomonas elongata was cloned into E. coli. By engineering the rate-limiting enzyme L-2,4-diaminobutyric acid (DABA) aminotransferase (EctB), ectoine production and the specific activity of the EctB mutant were increased. Thus, these results demonstrated the effectiveness of engineering regulatory proteins into sensitive and rapid screening tools for small molecules and highlighted the importance and efficacy of directed evolution strategies applied to the engineering of genetic components for yield improvement in the biosynthesis of small molecules. Copyright © 2015 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.
Atmospheric release advisory capability
International Nuclear Information System (INIS)
Sullivan, T.J.
1981-01-01
The ARAC system (Atmospheric Release Advisory Capability) is described. The system is a collection of people, computers, computer models, topographic data and meteorological input data that together permits a calculation of, in a quasi-predictive sense, where effluent from an accident will migrate through the atmosphere, where it will be deposited on the ground, and what instantaneous and integrated dose an exposed individual would receive
Directory of Open Access Journals (Sweden)
Wenjun Zhao
Full Text Available The mechanisms underlying acute myeloid leukemia (AML treatment failure are not clear. Here, we established a mouse model of AML by syngeneic transplantation of BXH-2 derived myeloid leukemic cells and developed an efficacious Ara-C-based regimen for treatment of these mice. We proved that leukemic cell load was correlated with survival. We also demonstrated that the susceptibility of leukemia cells to Ara-C could significantly affect the survival. To examine the molecular alterations in cells with different sensitivity, genome-wide expression of the leukemic cells was profiled, revealing that overall 366 and 212 genes became upregulated or downregulated, respectively, in the resistant cells. Many of these genes are involved in the regulation of cell cycle, cellular proliferation, and apoptosis. Some of them were further validated by quantitative PCR. Interestingly, the Ara-C resistant cells retained the sensitivity to ABT-737, an inhibitor of anti-apoptosis proteins, and treatment with ABT-737 prolonged the life span of mice engrafted with resistant cells. These results suggest that leukemic load and intrinsic cellular resistance can affect the outcome of AML treated with Ara-C. Incorporation of apoptosis inhibitors, such as ABT-737, into traditional cytotoxic regimens merits consideration for the treatment of AML in a subset of patients with resistance to Ara-C. This work provided direct in vivo evidence that leukemic load and intrinsic cellular resistance can affect the outcome of AML treated with Ara-C, suggesting that incorporation of apoptosis inhibitors into traditional cytotoxic regimens merits consideration for the treatment of AML in a subset of patients with resistance to Ara-C.
AEROS: a real-time emergency response system for atmospheric releases of toxic material
International Nuclear Information System (INIS)
Nasstrom, J.S.; Greenly, G.D.
1986-01-01
The Atmospheric Release Advisory Capability (ARAC) at the Lawrence Livermore National Laboratory has developed a sophisticated computer-based real-time emergency response system for radiotoxic releases into the atmosphere. The ARAC Emergency Response Operating System (AEROS) has a centralized computer facility linked to remote site computers, meteorological towers, and meteorological data sources. The system supports certain fixed sites, but has the ability to respond to accidents at arbitrary locations. Product quality and response time are optimized by using complex three-dimensional dispersion models; extensive on-line data bases; automated data processing; and an efficient user interface, employing graphical computer displays and computer-displayed forms. Upon notification, the system automatically initiates a response to an emergency and proceeds through preliminary calculations, automatically processing accident information, meteorological data, and model parameters. The model calculations incorporate mass-consistent three-dimensional wind fields, terrain effects, and particle-in-cell diffusion. Model products are color images of dose or deposition contours overlaid on a base map
Directory of Open Access Journals (Sweden)
Sérgio Henrique Borges
2014-08-01
Full Text Available We inventoried the birds from Serra do Aracá region, state of Amazonas. The region encompasses a high diversity of vegetation types, including white sand forests and campinas, terra firme and flooded forests, montane forests and tepuis. We recorded 416 bird taxa in 69 families through captures with mist nets, tape recording of bird voices, and collection of voucher specimens. A large proportion of them (61% were recorded in a single vegetation type. Qualitative estimates suggest that approximately 580 bird species occur in the region. The avifauna of the Aracá region has a mixed biogeographic composition, with species typical of both margins of the Rio Negro occurring sympatrically. Additionally, species whose distributions are restricted to three areas of endemism for Amazonian birds (Imeri, Guiana and Pantepui were recorded in the region. Rare landscapes in the Brazilian Amazon are found in the Serra do Aracá region. Additionally, we recorded endemic and rare birds, highlighting the value of the region for conservation. The Serra do Aracá State Park officially protects montane forests, terra firme forests and tepuis. We suggest that the large extension of white sand campinas and igapó forests at the southern portion of Serra do Aracá should be also preserved in order to improve the representation of the rich natural heritage of the region.
Shami, Paul J; Maciag, Anna E; Eddington, Jordan K; Udupi, Vidya; Kosak, Ken M; Saavedra, Joseph E; Keefer, Larry K
2009-11-01
We have designed prodrugs that release nitric oxide (NO) on metabolism by glutathione S-transferases (GST). This design exploits the upregulation of GST in acute myeloid leukemia (AML) cells. O(2)-(2,4-dinitrophenyl) 1-[(4-ethoxycarbonyl)piperazin-1-yl]diazen-1-ium-1,2-diolate (JS-K, a member of this class) has potent anti-leukemic activity. HL-60 myeloid leukemia cells were used for in vitro studies of the combination of JS-K with daunorubicin (DAUNO), cytarabine (ARA-C) or etoposide (ETOP) using the median effect method to determine synergistic, antagonistic, or additive effects. Combinations of JS-K added simultaneously, 2h before or 2h after the other compounds were used. JS-K and DAUNO were antagonistic in all three drug sequences. JS-K and ETOP were also antagonistic but to a lesser degree. JS-K and ARA-C showed strong synergy. The combination index at the 50% fraction affected was 0.37+/-0.23, 0.24+/-0.27, and 0.15+/-0.11 for simultaneous, JS-K first and ARA-C first additions, respectively. JS-K by itself induced DNA strand breaks at relatively high concentrations. However, at submicromolar concentrations, it significantly augmented ARA-C-induced DNA strand breaks. NMR spectroscopy revealed no evidence of chemical interaction between JS-K and the other chemotherapeutic agents. We conclude that ARA-C and JS-K have synergistic anti-leukemic activity and warrant further exploration in combination.
Spatial data requirements for emergency response
International Nuclear Information System (INIS)
Walker, H.
1985-01-01
The Atmospheric Release Advisory Capability (ARAC) provides real-time assessments of the consequences resulting from an atmospheric radioactive material. In support of this operation, a system has been created which integrates numerical models, data acquisition systems, data analysis techniques, and professional staff. Components of this system rely to large degree on spatial data of various kinds. Of particular importance is the rapid generation of digital terrain models for any area in the continental U.S. The digital terrain models are used as input to atmospheric models and serve to familiarize assessors to new areas by presenting the terrain surface as a graphical image. In addition, base map data (roads, rivers, political boundaries) must also be supplied as an overlay to ARAC graphical products. A terrain data base and an associated acquisition system have been developed that provide the required terrain data within ten minutes. This terrain data base was derived from the Defense Mapping Ageny's planar data. A digital base map data base is currently being developed from the U.S. Geographical Survey's 1:2,000,000 Digital Line Graph data as well as their Geographic Names Information System. This base map data base improves ARAC's response to its mapping needs anywhere in the continental U.S
Study of applying the Atmospheric Release Advisory Capability to nuclear power plants
International Nuclear Information System (INIS)
Orphan, R.C.
1978-06-01
Each utility licensee for a nuclear power reactor is required to minimize the adverse effects from an accidental radionuclide release into the atmosphere. In the past the ability to forecast quantitatively the extent of the hazard from such a release has been limited. Now powerful atmospheric modeling techniques are available to assist nuclear reactor site officials with greatly improved assessments. Lawrence Livermore Laboratory (LLL) has developed a prototype system called the Atmospheric Release Advisory Capability (ARAC) which is designed to integrate the modeling with advanced sensors, data handling techniques, and weather data in order to provide timely, usable advisories to the site officials. The purpose of this project is to examine the ways and means of adapting ARAC for application to many nuclear power reactors widely dispersed across the nation. The project will emphasize the management aspects, including government-industry relationships, technology transfer, organizational structure, staffing, implementing procedures, and costs. Benefits and costs for several alternative systems will be compared. The results will be reviewed and evaluated by the management and staff of the ARAC project at LLL and also by selected staff members of the sponsoring government agency
Use of an operational model evaluation system for model intercomparison
Energy Technology Data Exchange (ETDEWEB)
Foster, K. T., LLNL
1998-03-01
The Atmospheric Release Advisory Capability (ARAC) is a centralized emergency response system used to assess the impact from atmospheric releases of hazardous materials. As part of an on- going development program, new three-dimensional diagnostic windfield and Lagrangian particle dispersion models will soon replace ARAC`s current operational windfield and dispersion codes. A prototype model performance evaluation system has been implemented to facilitate the study of the capabilities and performance of early development versions of these new models relative to ARAC`s current operational codes. This system provides tools for both objective statistical analysis using common performance measures and for more subjective visualization of the temporal and spatial relationships of model results relative to field measurements. Supporting this system is a database of processed field experiment data (source terms and meteorological and tracer measurements) from over 100 individual tracer releases.
2013-06-07
... the relevance, reliability, validity, and effectiveness of the FAA's aeronautical testing and training... Rulemaking Advisory Committee (ARAC) Airman Testing Standards and Training Working Group (ATSTWG) AGENCY... Certification Standards (ACS) documents developed by the Airman Testing Standards and Training WG for the...
Meteorological data assimilation for real-time emergency response
International Nuclear Information System (INIS)
Sugiyama, G.; Chan, S.T.
1996-11-01
The US Department of Energy's Atmospheric Release Advisory Capability (ARAC) provides real-time dose assessments of airborne pollutant releases. Diverse data assimilation techniques are required to meet the needs of a new generation of ARAC models and to take advantage of the rapidly expanding availability of meteorological data. We are developing a hierarchy of algorithms to provide gridded meteorological fields which can be used to drive dispersion codes or to provide initial fields for mesoscale models. Data to be processed include winds, temperature, moisture, and turbulence
Pelicano, H; Carew, J S; McQueen, T J; Andreeff, M; Plunkett, W; Keating, M J; Huang, P
2006-04-01
17-Allylamino-17-demethoxygeldanamycin (17-AAG) is a new anticancer agent currently in clinical trials. The ability of 17-AAG to abrogate the function of heat-shock protein Hsp90 and modulate cellular sensitivity to anticancer agents has prompted recent research to use this compound in drug combination therapy. Here we report that 17-AAG has striking opposite effects on the activity of arsenic trioxide (ATO) and ara-C. Combination of 17-AAG with ATO exhibited a synergistic effect in leukemia cells, whereas coincubation of 17-AAG and ara-C showed antagonistic activity. Mechanistic studies revealed that ATO exerted cytotoxic action by reactive oxygen species generation, and activated Akt survival pathway. 17-AAG abrogated Akt activation and enhanced the activity of ATO. In contrast, treatment of leukemia cells with 17-AAG caused a G1 arrest, a decrease in DNA synthesis and reduced ara-C incorporation into DNA, leading to antagonism. The ability of 17-AAG to enhance the antileukemia activity of ATO was further demonstrated in primary leukemia cells isolated from patients with acute myeloid leukemia and chronic lymphocytic leukemia, including cells from refractory patients. Our data suggest that combination of 17-AAG and ATO may be an effective therapeutic regimen. Caution should be exercised in using 17-AAG together with ara-C, as their combination effects are schedule dependent.
Distributed emergency response system to model dispersion and deposition of atmospheric releases
International Nuclear Information System (INIS)
Taylor, S.S.
1985-04-01
Aging hardware and software and increasing commitments by the Departments of Energy and Defense have led us to develop a new, expanded system to replace the existing Atmospheric Release Advisory Capability (ARAC) system. This distributed, computer-based, emergency response system is used by state and federal agencies to assess the environmental health hazards resulting from an accidental release of radioactive material into the atmosphere. Like its predecessor, the expanded system uses local meteorology (e.g., wind speed and wind direction), as well as terrain information, to simulate the transport and dispersion of the airborne material. The system also calculates deposition and dose and displays them graphically over base maps of the local geography for use by on-site authorities. This paper discusses the limitations of the existing ARAC system. It also discusses the components and functionality of the new system, the technical difficulties encountered and resolved in its design and implementation, and the software methodologies and tools employed in its development
An advanced system for environmental emergency response
Energy Technology Data Exchange (ETDEWEB)
Ellis, James S.; Sullivan, Thomas J. [Lawrence Livermore National Laboratory, Livermore, California (United States)
2000-05-01
The Atmospheric Release Advisory Capability, better known as ARAC, is a hybrid system of models, computers, databases, communications and highly skilled staff dedicated to emergency consequence analysis and prediction of atmospheric hazardous material releases. The ARAC system is located at and operated by Lawrence Livermore National Laboratory (in Livermore, California, USA). It's development and operational support for the U.S. government have been funded by the U.S. Departments of Energy and Defense for the purpose of providing real-time, down-wind consequence assessments for emergency responders and managers for radiological and other hazardous releases. This service is available for both fixed facilities and any location in the world whenever and wherever the U.S. government has interest or concern. Over the past 26 years ARAC has provided consequence assessments for more than 160 potential and actual hazardous releases. This capability has been applied to diverse real-world releases such as the 1978 reentry of the COSMOS 954 nuclear powered satellite over Canada, the Three Mile Island and Chernobyl nuclear powerplant accidents, the Tomsk nuclear facility accident in Russia, two radiological accidents at Tokai (Japan) the Algeciras (Spain) melt of a radiotherapy source, and several non-radiological events such as chemical releases, toxic fires including the Kuwait oil fires, and even volcanic ash emissions. (author)
Modeling the wind-fields of accidental releases with an operational regional forecast model
International Nuclear Information System (INIS)
Albritton, J.R.; Lee, R.L.; Sugiyama, G.
1995-01-01
The Atmospheric Release Advisory Capability (ARAC) is an operational emergency preparedness and response organization supported primarily by the Departments of Energy and Defense. ARAC can provide real-time assessments of atmospheric releases of radioactive materials at any location in the world. ARAC uses robust three-dimensional atmospheric transport and dispersion models, extensive geophysical and dose-factor databases, meteorological data-acquisition systems, and an experienced staff. Although it was originally conceived and developed as an emergency response and assessment service for nuclear accidents, the ARAC system has been adapted to also simulate non-radiological hazardous releases. For example, in 1991 ARAC responded to three major events: the oil fires in Kuwait, the eruption of Mt. Pinatubo in the Philippines, and the herbicide spill into the upper Sacramento River in California. ARAC's operational simulation system, includes two three-dimensional finite-difference models: a diagnostic wind-field scheme, and a Lagrangian particle-in-cell transport and dispersion scheme. The meteorological component of ARAC's real-time response system employs models using real-time data from all available stations near the accident site to generate a wind-field for input to the transport and dispersion model. Here we report on simulation studies of past and potential release sites to show that even in the absence of local meteorological observational data, readily available gridded analysis and forecast data and a prognostic model, the Navy Operational Regional Atmospheric Prediction System, applied at an appropriate grid resolution can successfully simulate complex local flows
International Nuclear Information System (INIS)
Sullivan, T.J.
1992-01-01
When the 1986 Chernobyl disaster in the Soviet Union spewed clouds of radioactive material into the air, the US Department of Energy (DoE) asked the Atmospheric Release Advisory Capability (ARAC) team to calculate the extent, magnitude and spread of the radioactive plume. The ARAC emergency response and assessment service was designed and developed at the Lawrence Livermore National Laboratory (USA) to predict radiation dose levels and the extent of surface contamination from nuclear accidents. It has been used in the context of ventings, spills, extortion threats involving nuclear material, re-entry of nuclear-powered satellites and atmospheric nuclear tests. Since the Chernobyl response, significant improvements have been made to ARAC: a new model can simulate accidents involving transport on scales up to hemispheric; model maintenance requirements have been reduced; the initial response time for modelling foreign events has been reduced from about one week to a few hours and the response time for US events is now down to less than 30 minutes. The service is also being extended to the treatment of non-radioactive toxic accidents as the modelling capabilities and databases become available. (author)
Generating color terrain images in an emergency response system
International Nuclear Information System (INIS)
Belles, R.D.
1985-08-01
The Atmospheric Release Advisory Capability (ARAC) provides real-time assessments of the consequences resulting from an atmospheric release of radioactive material. In support of this operation, a system has been created which integrates numerical models, data acquisition systems, data analysis techniques, and professional staff. Of particular importance is the rapid generation of graphical images of the terrain surface in the vicinity of the accident site. A terrain data base and an associated acquisition system have been developed that provide the required terrain data. This data is then used as input to a collection of graphics programs which create and display realistic color images of the terrain. The graphics system currently has the capability of generating color shaded relief images from both overhead and perspective viewpoints within minutes. These images serve to quickly familiarize ARAC assessors with the terrain near the release location, and thus permit them to make better informed decisions in modeling the behavior of the released material. 7 refs., 8 figs
Energy Technology Data Exchange (ETDEWEB)
Modzelewski, R.; Vera, P. [Universite de Medecine de Rouen, QUANT.I.F-LITIS EA4108, departement de medecine nucleaire, 76 (France); Lepretre, S.; Tilly, H. [Centre Henri-Becquerel, departement d' hematologie, 76 - Rouen (France); Martinaud, O.; Hannequin, D. [CHU de Rouen, departement de neurologie, 76 (France); Habert, M.O. [CHU de la Pitie-Salpetriere, departement de medecine nucleaire, 75 - Paris (France)
2010-07-01
Cytosine arabinoside in high doses is a major treatment in acute myelo-blastic leukemia (A.M.L.). This treatment leads to neurological complications in 3-16% of cases, but the EEG, CT or MRI are normal.This prospective study examines brain perfusion in single photon emission tomography (SPECT) for patients receiving high dose arabinoside cytosine (H.D. A.R.A.C.). The SPECT of perfusion with hexamethyl propylene amine oxime (H.M.P.A.O.) for patients suffering of A.M.L. allowed to show a reduction of perfusion at the cerebellum level, of the occipito-parietal cortex and thalami, after conventional doses of A.R.A.C., while the patients had not any neurological accidents. (N.C.)
Assessment of Mobile Accident Response Capability
International Nuclear Information System (INIS)
1983-03-01
This report presents the results of a DOE-sponsored assessment of nuclear accident response resources. It identifies the mobile resources that could be required to respond to different types of nuclear accidents including major ones like TMI-2, identifies the resources currently available and makes recommendations for the design and construction of additional mobile accident response resources to supplement those already in existence. This project is referred to as the Mobile Accident Response Capability (MARC) program
Tüketici Temelli Marka Değerinin Marka Tercihlerine Etkisinde Ailenin Aracılık Rolü
Directory of Open Access Journals (Sweden)
Erkan YILDIZ
2015-04-01
Full Text Available Bu çalışmanın birinci amacı; tüketici temelli marka değerinin alt boyutları olan; marka farkındalığı, algılanan kalite, marka çağrışımları ve marka sadakatinin marka tercihleri üzerine etkisini incelemek, ikinci amacı ise ailenin bu ilişkilerdeki aracılık rolünü araştırmaktır. Bu amaçla Ankara ilinde 295 kişinin katılımıyla bir çalışma yapılmıştır. Araştırma sonucunda; algılanan kalite ve marka sadakatinin marka tercihlerini pozitif yönde etkilerken, marka farkındalığı ve marka çağrışımlarının, marka tercihleri üzerinde bir etkisinin olmadığı aynı zamanda bu ilişkide ailenin de aracılık rolüne sahip olmadığı belirlenmiştir.
Nigeria status on capabilities for response to nuclear or radiological emergency
International Nuclear Information System (INIS)
Sambo, I.; Elegba, S.B.; Ogharandukun, M.
2007-01-01
The use of nuclear technology has been widely employed and will continue to expand in use in Nigeria particularly in the health, industrial, mining, water resources, agriculture, manufacturing, education and research sectors. Incidents and emergencies cannot therefore be ruled out. Effective national response capabilities are essential to minimize the impacts from nuclear and radiological emergencies, and to build public trust in the safety and security of nuclear technology. The often discussed Nigeria's Nuclear Power Plant (NPP) project cannot occur without enhanced national capabilities to respond to an incidence or emergency. Moreover, increased concern over the use of nuclear or radioactive materials malevolent acts increases the need to broaden response capabilities. This paper examines Nigeria's status on capabilities for response to a nuclear and radiological emergency vis-a-vis international requirements for effective response capabilities
Program report: FY 1976, Atmospheric and Geophysical Sciences Division, Physics Department
International Nuclear Information System (INIS)
Knox, J.B.; Orphan, R.C.
1976-01-01
The Atmospheric Release Advisory Capability (ARAC), with its central facility located at LLL, is meeting the long-term need for rapid and accurate regional dose-to-man estimates of nuclear material released as a result of accidents, operations, or terrorism acts. During the past two years, ARAC has been used in four potential WARMSPOT events and for one accidental release. Continuing research, in terms of new modeling techniques, simulation of regional tracer experiments, and other verification activities, support this capability. Emergency response is currently being upgraded to evaluate the consequences of atmospheric releases at selected nuclear facilities and for potential acts of nuclear terrorism anywhere in the Northern Hemisphere. Regional modeling was also applied in monitoring SO 2 -sulfate concentrations in the northeastern USA
State-level emergency preparedness and response capabilities.
Watkins, Sharon M; Perrotta, Dennis M; Stanbury, Martha; Heumann, Michael; Anderson, Henry; Simms, Erin; Huang, Monica
2011-03-01
Prior assessments of public health readiness had identified gaps in radiation preparedness. In recent years, preparedness planning has involved an "all-hazards" approach. Current assessment of the national status related to radiation public health emergency preparedness capabilities at the state and local health department levels was needed. A survey of state health departments related to radiation readiness was undertaken in 2010 by the Council of State and Territorial Epidemiologists (CSTE). States with nuclear power plants were instructed to consider their responses exclusive of capabilities and resources related to the plants given that the emergency response plans for nuclear power plants are specific and unique. Thirty-eight (76%) state health departments responded to the survey, including 26 of the 31 states with nuclear power plants. Specific strengths noted at the state level included that the majority of states had a written radiation response plan and most plans include a detailed section for communications issues during a radiation emergency. In addition, more than half of the states indicated that their relationship with federal partners is sufficient to provide resources for radiation emergencies, indicating the importance states placed on federal resources and expertise. Specific weaknesses are discussed and include that most states had completed little to no planning for public health surveillance to assess potential human health impacts of a radiation event; less than half had written plans to address exposure assessment, environmental sampling, human specimen collection and analysis, and human health assessment. Few reported having sufficient resources to do public health surveillance, radiation exposure assessment, laboratory functions and other capabilities. Levels of planning, resources and partnerships varied among states, those with nuclear power plants were better prepared. Gaps were evident in all states; however and additional training and
Response capabilities of the National Guard: a focus on domestic disaster medical response.
Bochicchio, Daniel
2010-01-01
The National Guard has a 373-year history of responding to the nation's call to duty for service both at home and abroad (The National Guard Bureau Web site: Available at http://www.ngb.army.mil/default. aspx.). The National Guard (NG) is a constitutionally unique organization (United States Constitution, US Government Printing Office Web site: Available at http://www.gpoaccess.gov/constitution/index.html.). Today's Guard conducts domestic disaster response and civilian assistance missions on a daily basis. Yet, the NG's role, mission, and capabilities are not well-known or understood. The National Response Framework (NRF) places significant responsibility on the local and state disaster planners (Department of Homeland Security: National Response Framework. US Department of Homeland Security, Washington, DC, January 2008). The public health professionals are an integral component of the disaster planning community. It is critical that the public health community be knowledgeable of types and capabilities of all the response assets at their disposal.
United States Department of Energy radiological emergency response programme - a national capability
International Nuclear Information System (INIS)
Gordon-Hagerty, L.E.
1993-01-01
In order to respond to a radiological emergency, the United States Department of Energy (USDOE) maintains seven emergency response assets and capabilities in support of a radiological emergency of any proportion within the continental United States and abroad. The seven emergency response assets and capabilities include: Accident Response Group; Aerial Measuring Systems; Atmospheric Release Advisory Capability; Federal Radiological Monitoring and Assessment Center; Nuclear Emergency Search Team; Radiation Emergency Assistance Center/Training Site; and Radiological Assistance Program. Presently, USDOE maintains the most comprehensive national radiological emergency response assets in the United States, capable of dealing with any type of emergency involving nuclear materials. In all, the Department's assets are available to support any type of accident/incident involving radioactive materials in coordination with other United States Federal agencies, as well as state and local governments, as required. (author)
International Nuclear Information System (INIS)
2017-01-01
The aim of this publication is to provide guidelines to Member States and relevant international organizations on processes and arrangements that may be implemented as part of emergency preparedness and response (EPR) arrangements to assist in harmonizing national EPR capabilities and international assistance, when requested so that the products of their response operations are comparable and compatible. This publication provides details on the types, contents and formats of data and mapping products that may be generated during a response to nuclear or radiological emergencies. The publication applies the safety principles stated in IAEA Safety Standards Series No. SF 1, Fundamental Safety Principles, primarily Principle 9 on EPR, and it will be of assistance to Member States in meeting the requirements established in IAEA Safety Standards Series No. GSR Part 7, Preparedness and Response for a Nuclear or Radiological Emergency. Requirement 17 of this publication establishes that the “government shall ensure that adequate arrangements are in place to benefit from, and to contribute to the provision of, international assistance for preparedness and response for a nuclear or radiological emergency.” As part of these arrangements, it is required that due account is taken of the “compatibility requirements for the capabilities to be obtained from and to be rendered to different States so as to ensure the usefulness of these capabilities.” These guidelines are intended to help Member States to ensure that compatible response and assistance capabilities are in place. This publication is intended to be used by national authorities involved in emergency preparedness and response, and national response teams in all States. The guidelines provided need to be adapted to fit a State’s particular organizational arrangements, language, terminology, concept of operation, and capabilities. However, the products generated need to be compatible with the types and formats
International Nuclear Information System (INIS)
Wotherspoon, P.; Brown, L.; Sawyer, M.
1993-01-01
A key component in the development of an effective onshore oil spill response capability is the type, condition, and geographical placement of oil spill equipment. When spill response equipment is first being purchased for a particular operating area, a brief analysis should be conducted to ensure that the equipment would provide an adequate response capability for that area. This response capability may change over time with variations in oil field production capabilities, pipelines and markets, company ownerships, manpower availability, and other logistical changes. Equipment may also become inoperable or redundant. These problems may be effectively addressed if one operator or spill cooperative actively reviews their spill response capabilities on a regular (annual) basis. However, when multiple operators and cooperatives exist over an extensive geographical area, the responsibility for regularly review of the capabilities of spill equipment may become lost in the organizational structure and in other responsibilities. In addition, the responsibility to conduct a multiarea review of the surrounding area may never be identified
Canadian oil spill response capability - an investigation of the proposed fee regime
International Nuclear Information System (INIS)
Gold, E.; Gratwick, J.; Yee, P.
1996-08-01
Canada's oil spill response capability and its fee structure was examined and assessed. The present regime consists of five industry-owned oil spill response organizations who provide response teams throughout Canadian waters, except the Arctic. These organizations are fully adequate to meet the standards set by the Canadian Coast Guard. However, the Canadian Coast Guard withdrew from active control of the fee regime, leaving it to each response team to determine its own fee structure. The expectation was that the market would be capable of controlling the fees to be charged. This did not happen, and the investigative panel came to the conclusion that the present regime was not workable. In view of the situation the Panel concluded that ensuring oil spill response capability in Canada must always be the sole responsibility of the Canadian Government. Eleven recommendations were detailed in this final report. The most important recommendation was that the Canadian Coast Guard should re-establish its principal role in the oil spill response area. It was also suggested that there should be a single, national fee structure applying to the whole country except the Arctic, and that the fee should be collected by an independent national agency
Science and Technology Review, June 1999
International Nuclear Information System (INIS)
Eimerl, D
1999-01-01
The following two abstracts are for the 2 feature stories in this issue of ''Science and Technology Review''. (1) ''Forewarnings of Coming Hazards''--The Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore is an emergency response organization chartered to aid Department of Energy and Department of Defense sites when radioactive or toxic material is released into the atmosphere. Developed from studies beginning in the 1960s, it became a funded operational program in the late 1970s. Using an emergency response modeling system now in its third generation, ARAC scientists predict how atmospheric releases that could affect public health and safety will disperse. The ARAC system has evolved through experience gained during regular training exercises and in over 160 alerts and emergency responses to date. The work of ARAC scientists described in the article demonstrates the different modeling challenges they encounter in preparing for and responding to a variety of atmospheric emergencies. (2) ''Unraveling the Mystery of Detonation''--Laboratory experts in the detonation of high explosives are putting the computational power of the Accelerated Strategic Computing Initiative (ASCI) to the test. Their research centers on insensitive explosives, whose behavior during detonation is slower and more complex than that of sensitive explosives. The article features three research projects, which are exploring detonation from different angles: the initiation phase, the molecules produced during detonation, and further development of CHEETAH, a thermochemical detonation code. All research teams are using ASCI supercomputers, which have increased their ability to simulate the detonation process by a factor of 100,000
Emergency Response Capability Baseline Needs Assessment - Requirements Document
Energy Technology Data Exchange (ETDEWEB)
Sharry, J A
2016-10-04
This document was prepared by John A. Sharry, LLNL Fire Marshal and LLNL Division Leader for Fire Protection and reviewed by LLNL Emergency Management Department Head James Colson. The document follows and expands upon the format and contents of the DOE Model Fire Protection Baseline Capabilities Assessment document contained on the DOE Fire Protection Web Site, but only addresses emergency response.
Saleem, A; Datta, R; Yuan, Z M; Kharbanda, S; Kufe, D
1995-12-01
The cellular response to 1-beta-D-arabinofuranosylcytosine (ara-C) includes activation of Jun/AP-1, induction of c-jun transcription, and programmed cell death. The stress-activated protein (SAP) kinases stimulate the transactivation function of c-jun by amino terminal phosphorylation. The present work demonstrates that ara-C activates p54 SAP kinase. The finding that SAP kinase is also activated by alkylating agents (mitomycin C and cisplatinum) and the topoisomerase I inhibitor 9-amino-camptothecin supports DNA damage as an initial signal in this cascade. The results demonstrate that ara-C also induces binding of SAP kinase to the SH2/SH3-containing adapter protein Grb2. SAP kinase binds to the SH3 domains of Grb2, while interaction of the p85 alpha-subunit of phosphatidylinositol 3-kinase complex. The results also demonstrate that ara-C treatment is associated with inhibition of lipid and serine kinase activities of PI 3-kinase. The potential significance of the ara-C-induced interaction between SAP kinase and PI 3-kinase is further supported by the demonstration that Wortmannin, an inhibitor of PI 3-kinase, stimulates SAP kinase activity. The finding that Wortmannin treatment is also associated with internucleosomal DNA fragmentation may support a potential link between PI 3-kinase and regulation of both SAP kinase and programmed cell death.
Sellars, Laura E; Bryant, Jack A; Sánchez-Romero, María-Antonia; Sánchez-Morán, Eugenio; Busby, Stephen J W; Lee, David J
2017-08-03
In bacteria, many transcription activator and repressor proteins regulate multiple transcription units that are often distally distributed on the bacterial genome. To investigate the subcellular location of DNA bound proteins in the folded bacterial nucleoid, fluorescent reporters have been developed which can be targeted to specific DNA operator sites. Such Fluorescent Reporter-Operator System (FROS) probes consist of a fluorescent protein fused to a DNA binding protein, which binds to an array of DNA operator sites located within the genome. Here we have developed a new FROS probe using the Escherichia coli MalI transcription factor, fused to mCherry fluorescent protein. We have used this in combination with a LacI repressor::GFP protein based FROS probe to assess the cellular location of commonly regulated transcription units that are distal on the Escherichia coli genome. We developed a new DNA binding fluorescent reporter, consisting of the Escherichia coli MalI protein fused to the mCherry fluorescent protein. This was used in combination with a Lac repressor:green fluorescent protein fusion to examine the spatial positioning and possible co-localisation of target genes, regulated by the Escherichia coli AraC protein. We report that induction of gene expression with arabinose does not result in co-localisation of AraC-regulated transcription units. However, measurable repositioning was observed when gene expression was induced at the AraC-regulated promoter controlling expression of the araFGH genes, located close to the DNA replication terminus on the chromosome. Moreover, in dividing cells, arabinose-induced expression at the araFGH locus enhanced chromosome segregation after replication. Regions of the chromosome regulated by AraC do not colocalise, but transcription events can induce movement of chromosome loci in bacteria and our observations suggest a role for gene expression in chromosome segregation.
Long range transport: Evaluation of a particle-in-cell model using sources in the US and USSR
International Nuclear Information System (INIS)
Rodriguez, D.J.
1988-08-01
After being informed that radioactive material from the Chernobyl nuclear power plant had been discovered on the clothing of workers at a Swedish reactor site, the United States Department of Energy requested that the Atmospheric Release Advisory Capability (ARAC) evaluate both the extent and the magnitude of the accident (Dickerson and Sullivan, 1987). ARAC is a real-time emergency response service that specializes in the regional assessment of radiological accidents using advanced dispersion models. While we possessed a sizable inventory of computer models with which to address this problem, we lacked an operational tool that could be used with confidence in determining the fate of airborne radioactivity beyond about 500 km. As an outgrowth of this experience, we began to explore the spatial limits of applicability of our Advection-Diffusion Particle-In-Cell (ADPIC) model (Lange, 1978). At the same time, we began testing a hybrid version of this model that uses the Air Force Global Weather Central's Northern Hemisphere Whole Mesh Grid of wind velocities as input. In combination, these models can provide, potentially, a response capability that extends from tens of kilometers to the entire Northern Hemisphere. 7 refs., 6 figs
European contract law and the capabilities approach: on distributive responsibility for contract law
Tjon Soei Len, L.; Weidtmann, N.; Hölzchen, Y.M.; Hawa, B.
2012-01-01
This paper argues that the normative requirements of Nussbaum’s capabilities approach extend to contract law (and private law more broadly). Contract law is part of a society’s basic structure, i.e. the responsibility bearing structure that is to secure and enhance individuals’ basic capabilities.
A real-time monitoring/emergency response modeling workstation for a tritium facility
International Nuclear Information System (INIS)
Lawver, B.S.; Sims, J.M.; Baskett, R.L.
1993-07-01
At Lawrence Livermore National Laboratory (LLNL) we developed a real-time system to monitor two stacks on our tritium handling facility. The monitors transmit the stack data to a workstation which computes a 3D numerical model of atmospheric dispersion. The workstation also collects surface and upper air data from meteorological towers and a sodar. The complex meteorological and terrain setting in the Livermore Valley demands more sophisticated resolution of the three-dimensional structure of the atmosphere to reliably calculate plume dispersion than afforded by Gaussian models. We experience both mountain valley and sea breeze flows. To address these complexities, we have implemented the three-dimensional diagnostic MATHEW mass-adjusted wind field and ADPIC particle-in-cell dispersion models on the workstation for use in real-time emergency response modeling. Both MATHEW and ADPIC have shown their utility in a variety of complex settings over the last 15 years within the Department of Energy's Atmospheric Release Advisory Capability (ARAC[1,2]) project
Emergency response capability for pollutant releases to streams and rivers
International Nuclear Information System (INIS)
Buckner, M.R.; Hayes, D.W.; Watts, J.R.
1975-01-01
Stream-river models have been developed which provide an accurate prediction of normal and accidental pollutant releases to streams and rivers. Stream parameters are being developed for the Savannah River Plant streams and the Savannah River to allow quick response in case of an accidental release of radioactive material. These data are stored on permanent disk storage for quick access via the JOSHUA operating system. This system provides an efficient and flexible emergency response capability for pollutant releases to streams and rivers
International Nuclear Information System (INIS)
Walker, H.
1982-11-01
A terrain data base covering the continental United States at 500-meter resolution has been generated. Its function is to provide terrain data for input to mesoscale atmospheric models that are used as part of the Atmospheric Release Advisory Capability at Lawrence Livermore Laboratory (LLNL). The structure of the data base as it exists on the LLNL computer system is described. The data base has been written to tapes for transfer to other systems and the format of these tapes is also described
Survey of state and tribal emergency response capabilities for radiological transportation incidents
Energy Technology Data Exchange (ETDEWEB)
Vilardo, F J; Mitter, E L; Palmer, J A; Briggs, H C; Fesenmaier, J [Indiana Univ., Bloomington, IN (USA). School of Public and Environmental Affairs
1990-05-01
This publication is the final report of a project to survey the fifty states, the District of Columbia, Puerto Rico, and selected Indian Tribal jurisdictions to ascertain their emergency-preparedness planning and capabilities for responding to transportation incidents involving radioactive materials. The survey was conducted to provide the Nuclear Regulatory Commission and other federal agencies with information concerning the current level of emergency-response preparedness of the states and selected tribes and an assessment of the changes that have occurred since 1980. There have been no major changes in the states' emergency-response planning strategies and field tactics. The changes noted included an increased availability of dedicated emergency-response vehicles, wider availability of specialized radiation-detection instruments, and higher proportions of police and fire personnel with training in the handling of suspected radiation threats. Most Indian tribes have no capability to evaluate suspected radiation threats and have no formal relations with emergency-response personnel in adjacent states. For the nation as a whole, the incidence of suspected radiation threats declined substantially from 1980 to 1988. 58 tabs.
A Fast Response Capability within NOAA/NOS/CO-OPS
2007-01-01
A Fast Response Capability within NOAA/NOS/CO-OPS P. B. Burke NOAA/National Ocean Service/CO-OPS 1305 East-West Hwy. Silver Spring, MD 20910...USA pat.burke@noaa.gov T. Graff NOAA/National Ocean Service/CO-OPS 1305 East-West Hwy. Silver Spring, MD 20910 USA tammy.graff@noaa.gov... flotation hull, an instrumentation tower mounted atop the hull and a current meter mount with a mooring attachment. The triangular tower housed two
Improving Research Reactor Accident Response Capability at the Hungarian Nuclear Safety Authority
International Nuclear Information System (INIS)
Vegh, J.; Gajdos, F.; Horvath, Cs.; Matisz, A.; Nyisztor, D.
2013-06-01
The paper describes the design and implementation of an on-line operation monitoring and accident response support system to be used at the CERTA emergency response centre of Hungarian Atomic Energy Authority (HAEA). The monitored facility is the Budapest Research Reactor (BRR), which is a tank-type thermal reactor having 10 MW thermal power. The basic reason for the development of the on-line safety information system is to extend the emergency response capability of the CERTA crisis centre to include emergencies related to BRR, as well. CERTA is operated by HAEA at its Budapest headquarters and the centre already has an on-line system for monitoring the state of the four units of Paks NPP, Hungary. The system is called CERTA VITA and it is able to monitor the four VVER-440/V213 units during their normal operation, and during emergencies (including severe accidents). Ensuring appropriate emergency response capabilities, as well as improving the presently available systems and tools was one of the important recommendations resulting from the analyses following the severe accident at Fukushima. This task is valid not only for the operators of the nuclear facilities but also for the nuclear safety authorities, therefore HAEA decided to launch a project - together with the Centre for Energy Research, the operator of BRR - to establish an on-line information system similar to the CERTA VITA used for monitoring the four units of the Paks NPP. It is believed that by the introduction of this new on-line system the accident response capabilities of HAEA will be further enhanced and the BRR emergencies will be handled at the same professional level as potential emergencies at Paks NPP. (authors)
Directory of Open Access Journals (Sweden)
Febriyanto
2015-08-01
Full Text Available This research is conducted to examine the influence of market attractiveness and dynamic capability on strategic competitive response through overall logistics strategies of logistics service providers LSPs. Involving 266 LSPs SEM-LISREL is applied to test the hypotheses. The findings reveal that the market attractiveness and the dynamic capability positively affect the overall logistics strategy. Additionally the market attractiveness and the dynamic capability positively affect the strategic competitive response. Indirectly the market attractiveness and the dynamic capability positively affect the performance through strategic competitive response of LSPs. Obviously overall logistics strategy strengthen the influence of both market attractiveness and dynamic capability on strategic competitive response. There are five alternatives to optimize the overall logistics strategy of LSPs market intensification integration focus collaboration and strengthening value proposition. The involvement of overall logistics strategy as mediating variable is new paradigm in the strategic management discourses especially in logistics industry. Further research needs to be performed by involving the size of business as control variable and LSPs perception on Governments policies.
Directory of Open Access Journals (Sweden)
Vázquez Santos, Rosa
2008-06-01
Full Text Available This study proposes a combined solution to two problems: the attribution of an altar panel from the Museo Diocesano of Camerino and the hagiography of the mysterious “miracle of the knight covered with shells” in this painting. The documentary sources related to the art, cult and iconography of Saint James the Great in Rome, in particular the descriptive work of Miguel Erce Jiménez, allow us to connect this panel with the lost altarpiece in Santa Maria Araceli by Giovenale of Orvieto, thus becoming the first picture in his catalogue. At the same time, these sources lead us to the Portuguese origin of the iconography of this miracle.
El presente trabajo sugiere una solución conjunta a dos problemas: la atribución de una tabla del Museo Diocesano de Camerino y la hagiografía del misterioso “milagro del caballero cubierto de conchas” en ella representado. Las fuentes documentales relacionadas con la presencia de arte, culto e iconografía de Santiago el Mayor en la ciudad de Roma, principalmente la descriptiva obra de Miguel Erce Jiménez, nos permiten relacionar dicha tabla con el desaparecido retablo de Santa Maria de Araceli del pintor Giovenale de Orvieto, inaugurando el catálogo del artista. Al mismo tiempo las fuentes citadas nos llevan al origen portugués de la iconografía del milagro.
Quantifying human response capabilities towards tsunami threats at community level
Post, J.; Mück, M.; Zosseder, K.; Wegscheider, S.; Taubenböck, H.; Strunz, G.; Muhari, A.; Anwar, H. Z.; Birkmann, J.; Gebert, N.
2009-04-01
Decision makers at the community level need detailed information on tsunami risks in their area. Knowledge on potential hazard impact, exposed elements such as people, critical facilities and lifelines, people's coping capacity and recovery potential are crucial to plan precautionary measures for adaptation and to mitigate potential impacts of tsunamis on society and the environment. A crucial point within a people-centred tsunami risk assessment is to quantify the human response capabilities towards tsunami threats. Based on this quantification and spatial representation in maps tsunami affected and safe areas, difficult-to-evacuate areas, evacuation target points and evacuation routes can be assigned and used as an important contribution to e.g. community level evacuation planning. Major component in the quantification of human response capabilities towards tsunami impacts is the factor time. The human response capabilities depend on the estimated time of arrival (ETA) of a tsunami, the time until technical or natural warning signs (ToNW) can be received, the reaction time (RT) of the population (human understanding of a tsunami warning and the decision to take appropriate action), the evacuation time (ET, time people need to reach a safe area) and the actual available response time (RsT = ETA - ToNW - RT). If RsT is larger than ET, people in the respective areas are able to reach a safe area and rescue themselves. Critical areas possess RsT values equal or even smaller ET and hence people whin these areas will be directly affected by a tsunami. Quantifying the factor time is challenging and an attempt to this is presented here. The ETA can be derived by analyzing pre-computed tsunami scenarios for a respective area. For ToNW we assume that the early warning center is able to fulfil the Indonesian presidential decree to issue a warning within 5 minutes. RT is difficult as here human intrinsic factors as educational level, believe, tsunami knowledge and experience
Hospitals Capability in Response to Disasters Considering Surge Capacity Approach
Directory of Open Access Journals (Sweden)
Gholamreza Khademipour
2016-01-01
Full Text Available Background: The man-made and natural disasters have adverse effects with sound, apparent, and unknown consequences. Among various components of disaster management in health sector, the most important role is performed by health-treatment systems, especially hospitals. Therefore, the present study aimed to evaluate the surge capacity of hospitals of Kerman Province in disaster in 2015. Materials and Methods: This is a quantitative study, conducted on private, military, and medical sciences hospitals of Kerman Province. The sampling method was total count and data collection for the research was done by questionnaire. The first section of the questionnaire included demographic information of the studied hospitals and second part examined the hospital capacity in response to disasters in 4 fields of equipment, physical space, human resources, and applied programs. The extracted data were analyzed by descriptive statistics. Results: The mean capability of implementing the surge capacity programs by hospitals of Kerman Province in disasters and in 4 fields of equipment, physical space, human resources, and applied programs was evaluated as 7.33% (weak. The surge capacity capability of state hospitals in disasters was computed as 8% and compared to private hospitals (6.07% had a more suitable condition. Conclusion: Based on the results of study and significance of preparedness of hospitals in response to disasters, it is proposed that managers of studied hospitals take measures to promote the hospital response capacity to disasters based on 4 components of increasing hospital capacity.
Emergency Response Capability Baseline Needs Assessment Compliance Assessment
Energy Technology Data Exchange (ETDEWEB)
Sharry, John A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2013-09-16
This document is the second of a two-part analysis of Emergency Response Capabilities of Lawrence Livermore National Laboratory. The first part, 2013 Baseline Needs Assessment Requirements Document established the minimum performance criteria necessary to meet mandatory requirements. This second part analyses the performance of Lawrence Livermore Laboratory Emergency Management Department to the contents of the Requirements Document. The document was prepared based on an extensive review of information contained in the 2009 BNA, the 2012 BNA document, a review of Emergency Planning Hazards Assessments, a review of building construction, occupancy, fire protection features, dispatch records, LLNL alarm system records, fire department training records, and fire department policies and procedures.
How Stakeholder Sensing and Anticipations Shape the Firm’s Strategic Response Capability
DEFF Research Database (Denmark)
Hallin, Carina Antonia; Andersen, Torben Juul; Ooi, Can-Seng
We outline a strategic response capability framework drawing on cognitive neuroscience to explain stakeholder sensing and anticipations as essential input to environmental analysis. Stakeholders receive stimuli from ongoing interactions with the firm and thereby sense current environmental changes...
A geographical basis for long-range dose assessment calculations
International Nuclear Information System (INIS)
Walker, H.; Hage, G.
1989-01-01
Releases of radioactive material into the atmosphere have effects that are distributed over the earth's surface. As a result, geographical information can play an important role in understanding the impact of an emergency. The Atmospheric Release Advisory Capability (ARAC) at Lawrence Livermore National Laboratory is an emergency response organization that utilizes complex computer models to provide real-time assessments of the consequences of such releases. These models are one component of a sophisticated system that also includes data-gathering systems, data analysis techniques, and highly trained operational personnel. The products of this service are isopleths of the material concentration plotted over a base map of geographic features. The components mentioned in this paper are being added to the operation ARAC system. This will provide a means of producing fast, high-quality assessments of the consequences of major releases of radioactive material with effects extending to continental and global regions
Clarification of TMI action plan requirements. Requirements for emergency response capability
International Nuclear Information System (INIS)
1983-01-01
This document, Supplement 1 to NUREG-0737, is a letter from D. G. Eisenhut, Director of the Division of Licensing, NRR, to licensees of operating power reactors, applicants for operating licenses, and holders of construction permits forwarding post-TMI requirements for emergency response capability which have been approved for implementation. On October 30, 1980, the NRC staff issued NUREG-0737, which incorporated into one document all TMI-related items approved for implementation by the Commission at that time. In this NRC report, additional clarification is provided regarding Safety Parameter Display Systems, Detailed Control Room Design Reviews, Regulatory Guide 1.97 (Revision 2) - Application to Emergency Response Facilities, Upgrade of Emergency Operating Procedures, Emergency Response Facilities, and Meteorological Data
INSURGENT MOVEMENTS: ROLE, CAPABILITIES AND RESPONSES OF STATES
Directory of Open Access Journals (Sweden)
MIGUEL GARCÍA GUINDO
2017-09-01
Full Text Available This article addresses the problems related to the correct identification of the insurgency as a phenomenon and how the idea of the threat determines the design and responses of the security and defense public policies. To do this, we first outline a list of those factors that act as leverage for a given insurgent, rebel or revolutionary movement, in their emerging stage, to perform a successful transition to a true insurgency, capable of subverting the established political order. Then the role exercised by governments in managing threats and insurgencies consolidation is analyzed, to conclude exposing some key ideas and contemporary debates regarding the implementation of those strategies that seek to counteract them.
International Nuclear Information System (INIS)
Vandevender, S.G.; Reese, R.T.; Schilling, A.H.
1980-01-01
The non-existence of emergency response programs is frequently stated as a reason for restricting the movement of radioactive materials through states or local jurisdictions. Yet, studies discussed here indicate that emergency response capability, while not in the best condition, is getting more money, interest and attention, and in most states response networks exist which could be effective in responding to radiological emergencies. Awareness of such capabilities by the public is an important feature in increasing the public's confidence in the ability of federal, state and local officials in controlling hazards. One aspect of this awareness program could be in broader availability of radioactive emergency techniques for possible first responders to emergencies. This training, public awareness and more emphasis on workable emergency plans will help to assure reliable and workable emergency response plans
Real-time monitoring/emergency response modeling workstation for a tritium facility
International Nuclear Information System (INIS)
Lawver, B.S.; Sims, J.M.; Baskett, R.L.
1993-01-01
At Lawrence Livermore National Laboratory (LLNL) we have developed a real-time system to monitor two stacks on our tritium handling facility. The monitors transmit the stack data to a workstation, which computes a three-dimensional numerical model of atmospheric dispersion. The workstation also collects surface and upper air data from meteorological towers and a sodar. The complex meteorological and terrain setting in the Livermore Valley demands more sophisticated resolution of the three-dimensional structure of the atmosphere to reliably calculate plume dispersion than afforded by Gaussian models. We experience both mountain valley and sea breeze flows. To address these complexities, we have implemented the three-dimensional diagnostic MATHEW mass-adjusted wind field and ADPIC particle-in-cell dispersion models on the workstation for use in real-time emergency response modeling. Both MATHEW and ADPIC have shown their utility in a variety of complex settings over the last 15 yr within the U.S. Department of Energy's Atmospheric Release Advisory Capability (ARAC) project. Faster workstations and real-time instruments allow utilization of more complex three-dimensional models, which provides a foundation for building a real-time monitoring and emergency response workstation for a tritium facility. The stack monitors are two ion chambers per stack
Kimmerly, David P
2009-01-01
This article is a summary based on a December 2007 paper prepared by the author in partial fulfillment of the requirements for a master's degree in business and organizational security management at Webster University. The project described was intended to assess Chicago-area healthcare organization security departments' preparedness and response capabilities for a potential influenza pandemic. While the author says healthcare organizations are learning from the pandemics of the past, little research has been conducted on the requirements necessary within hospital security departments. The article explores staffing, planning, preparation and response capabilities within a healthcare security context to determine existing resources available to the healthcare security community. Eleven completed surveys were received from hospital security managers throughout the geographical Chicago area. They reveal that hospital security managers are conscious of the risks of a pandemic influenza outbreak. Yet, it was found that several gaps existed within hospital security department staffing and response capabilities, as hospital security departments may not have the available resources necessary to adequately maintain their operations during a pandemic incident.
International Nuclear Information System (INIS)
Gunderson, T.C.
1980-05-01
Environmental and emergency response radiological air sampling capabilities of the Environmental Surveillance Group at Los Alamos Scientific Laboratory are described. The air sampling program provides a supplementary check on the adequacy of containment and effluent controls, determines compliance with applicable protection guides and standards, and assesses potential environmental impacts on site environs. It also allows evaluation of potential individual and total population doses from airborne radionuclides that may be inhaled or serve as a source of external radiation. The environmental program is sufficient in scope to detect fluctuations and long-term trends in atmospheric levels of radioactivity originating onsite. The emergency response capabilities are designed to respond to both onsite unplanned releases and atmospheric nuclear tests
International Nuclear Information System (INIS)
1975-09-01
Sandia Laboratories is an engineering laboratory in which research, development, testing, and evaluation capabilities are integrated by program management for the generation of advanced designs. In fulfilling its primary responsibility to ERDA, Sandia Laboratories has acquired extensive research and development capabilities. The purpose of this series of documents is to catalog the many technical capabilities of the Laboratories. After the listing of capabilities, supporting information is provided in the form of highlights, which show applications. This document deals with auxiliary capabilities, in particular, environmental health and information science. (11 figures, 1 table) (RWR)
Emergency Response Capability Baseline Needs Assessment - Compliance Assessment
Energy Technology Data Exchange (ETDEWEB)
Sharry, John A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-09-01
This document was prepared by John A. Sharry, LLNL Fire Marshal and Division Leader for Fire Protection and was reviewed by LLNL Emergency Management Department Head, James Colson. This document is the second of a two-part analysis on Emergency Response Capabilities of Lawrence Livermore National Laboratory. The first part, 2016 Baseline Needs Assessment Requirements Document established the minimum performance criteria necessary to meet mandatory requirements. This second part analyses the performance of Lawrence Livermore Laboratory Emergency Management Department to the contents of the Requirements Document. The document was prepared based on an extensive review of information contained in the 2016 BNA, a review of Emergency Planning Hazards Assessments, a review of building construction, occupancy, fire protection features, dispatch records, LLNL alarm system records, fire department training records, and fire department policies and procedures. The 2013 BNA was approved by NNSA’s Livermore Field Office on January 22, 2014.
A Comprehensive Evaluation System for Military Hospitals' Response Capability to Bio-terrorism.
Wang, Hui; Jiang, Nan; Shao, Sicong; Zheng, Tao; Sun, Jianzhong
2015-05-01
The objective of this study is to establish a comprehensive evaluation system for military hospitals' response capacity to bio-terrorism. Literature research and Delphi method were utilized to establish the comprehensive evaluation system for military hospitals' response capacity to bio-terrorism. Questionnaires were designed and used to survey the status quo of 134 military hospitals' response capability to bio-terrorism. Survey indicated that factor analysis method was suitable to for analyzing the comprehensive evaluation system for military hospitals' response capacity to bio-terrorism. The constructed evaluation system was consisted of five first-class and 16 second-class indexes. Among them, medical response factor was considered as the most important factor with weight coefficient of 0.660, followed in turn by the emergency management factor with weight coefficient of 0.109, emergency management consciousness factor with weight coefficient of 0.093, hardware support factor with weight coefficient of 0.078, and improvement factor with weight coefficient of 0.059. The constructed comprehensive assessment model and system are scientific and practical.
International Nuclear Information System (INIS)
Zhongyu Wu; Zhichao Lin; Mackill, P.; Cong Wei; Noonan, J.; Cherniack, J.; Gillis-Landrum, D.
2009-01-01
Measurement capability and data comparability are essential for emergency response when analytical data from cooperative laboratories are used for risk assessment and post incident decision making. In this study, the current capability of food emergency response laboratories for the analysis of 210 Po in water was evaluated using a proficiency test scheme in compliance with ISO-43 and ILAC G13 guidelines, which comprises a test sample preparation and verification protocol and an insightful statistical data evaluation. The results of performance evaluations on relative bias, value trueness, precision, false positive detection, minimum detection limit, and limit of quantification, are presented. (author)
National Research Council Canada - National Science Library
Manto, Samuel
1999-01-01
... actions to improve preparedness. This paper examines what a minimum basic response capability for all military, police and security forces should be to ensure at least some chance for their own survival and possible early warning...
Adams, Alexandra C; Kyle, Michele; Beaman-Hall, Carol M; Monaco, Edward A; Cullen, Matthew; Vallano, Mary Lou
2015-10-01
A simple method to co-culture granule neurons and glia from a single brain region is described, and microglia activation profiles are assessed in response to naturally occurring neuronal apoptosis, excitotoxin-induced neuronal death, and lipopolysaccharide (LPS) addition. Using neonatal rat cerebellar cortex as a tissue source, glial proliferation is regulated by omission or addition of the mitotic inhibitor cytosine arabinoside (AraC). After 7-8 days in vitro, microglia in AraC(-) cultures are abundant and activated based on their amoeboid morphology, expressions of ED1 and Iba1, and ability to phagocytose polystyrene beads and the majority of neurons undergoing spontaneous apoptosis. Microglia and phagocytic activities are sparse in AraC(+) cultures. Following exposure to excitotoxic kainate concentrations, microglia in AraC(-) cultures phagocytose most dead neurons within 24 h without exacerbating neuronal loss or mounting a strong or sustained inflammatory response. LPS addition induces a robust inflammatory response, based on microglial expressions of TNF-α, COX-2 and iNOS proteins, and mRNAs, whereas these markers are essentially undetectable in control cultures. Thus, the functional effector state of microglia is primed for phagocytosis but not inflammation or cytotoxicity even after kainate exposure that triggers death in the majority of neurons. This model should prove useful in studying the progressive activation states of microglia and factors that promote their conversion to inflammatory and cytotoxic phenotypes.
Modeling the consequences of hypothetical accidents for the Titan II system
International Nuclear Information System (INIS)
Greenly, G.D.; Sullivan, T.J.
1981-11-01
Calculations have been made with the Atmospheric Release Advisory Capability (ARAC) suite of three-dimensional transport and diffusion codes MATHEW/ADPIC to assess the consequences of severe, hypothetical accident scenarios. One set of calculations develops the integrated dose and surface deposition patterns for a non-nuclear, high explosive detonation and dispersal of material. A second set of calculations depicts the time integrated dose and instantaneous concentration patterns for a substantial, continuous leak of the missile fuel oxidizer converted to nitrogen dioxide (NO 2 ). The areas affected and some of the implications for emergency response management are discussed
Arctic plants are capable of sustained responses to long-term warming
Directory of Open Access Journals (Sweden)
Robert T. Barrett
2016-05-01
Full Text Available Previous studies have shown that Arctic plants typically respond to warming with increased growth and reproductive effort and accelerated phenology, and that the magnitude of these responses is likely to change over time. We investigated the effects of long-term experimental warming on plant growth (leaf length and reproduction (inflorescence height, reproductive phenology and reproductive effort using 17–19 years of measurements collected as part of the International Tundra Experiment (ITEX at sites near Barrow and Atqasuk, Alaska. During the study period, linear regressions indicated non-significant tendencies towards warming air temperatures at our study sites. Results of our meta-analyses on the effect size of experimental warming (calculated as Hedges’ d indicated species generally responded to warming by increasing inflorescence height, increasing leaf length and flowering earlier, while reproductive effort did not respond consistently. Using weighted least-squares regressions on effect sizes, we found a significant trend towards dampened response to experimental warming over time for reproductive phenology. This tendency was consistent, though non-significant, across all traits. A separate analysis revealed significant trends towards reduced responses to experimental warming during warmer summers for all traits. We therefore propose that tendencies towards dampened plant responses to experimental warming over time are the result of regional warming. These results show that Arctic plants are capable of sustained responses to warming over long periods of time but also suggest that, as the region continues to warm, factors such as nutrient availability, competition and herbivory will become more limiting to plant growth and reproduction than temperature.
Cruickshank, M N; Ford, J; Cheung, L C; Heng, J; Singh, S; Wells, J; Failes, T W; Arndt, G M; Smithers, N; Prinjha, R K; Anderson, D; Carter, K W; Gout, A M; Lassmann, T; O'Reilly, J; Cole, C H; Kotecha, R S; Kees, U R
2017-01-01
To address the poor prognosis of mixed lineage leukemia (MLL)-rearranged infant acute lymphoblastic leukemia (iALL), we generated a panel of cell lines from primary patient samples and investigated cytotoxic responses to contemporary and novel Food and Drug Administration-approved chemotherapeutics. To characterize representation of primary disease within cell lines, molecular features were compared using RNA-sequencing and cytogenetics. High-throughput screening revealed variable efficacy of currently used drugs, however identified consistent efficacy of three novel drug classes: proteasome inhibitors, histone deacetylase inhibitors and cyclin-dependent kinase inhibitors. Gene expression of drug targets was highly reproducible comparing iALL cell lines to matched primary specimens. Histone deacetylase inhibitors, including romidepsin (ROM), enhanced the activity of a key component of iALL therapy, cytarabine (ARAC) in vitro and combined administration of ROM and ARAC to xenografted mice further reduced leukemia burden. Molecular studies showed that ROM reduces expression of cytidine deaminase, an enzyme involved in ARAC deactivation, and enhances the DNA damage–response to ARAC. In conclusion, we present a valuable resource for drug discovery, including the first systematic analysis of transcriptome reproducibility in vitro, and have identified ROM as a promising therapeutic for MLL-rearranged iALL. PMID:27443263
Energy Technology Data Exchange (ETDEWEB)
Sharry, J A
2009-12-30
This revision of the LLNL Fire Protection Baseline Needs Assessment (BNA) was prepared by John A. Sharry, LLNL Fire Marshal and LLNL Division Leader for Fire Protection and reviewed by Martin Gresho, Sandia/CA Fire Marshal. The document follows and expands upon the format and contents of the DOE Model Fire Protection Baseline Capabilities Assessment document contained on the DOE Fire Protection Web Site, but only address emergency response. The original LLNL BNA was created on April 23, 1997 as a means of collecting all requirements concerning emergency response capabilities at LLNL (including response to emergencies at Sandia/CA) into one BNA document. The original BNA documented the basis for emergency response, emergency personnel staffing, and emergency response equipment over the years. The BNA has been updated and reissued five times since in 1998, 1999, 2000, 2002, and 2004. A significant format change was performed in the 2004 update of the BNA in that it was 'zero based.' Starting with the requirement documents, the 2004 BNA evaluated the requirements, and determined minimum needs without regard to previous evaluations. This 2010 update maintains the same basic format and requirements as the 2004 BNA. In this 2010 BNA, as in the previous BNA, the document has been intentionally divided into two separate documents - the needs assessment (1) and the compliance assessment (2). The needs assessment will be referred to as the BNA and the compliance assessment will be referred to as the BNA Compliance Assessment. The primary driver for separation is that the needs assessment identifies the detailed applicable regulations (primarily NFPA Standards) for emergency response capabilities based on the hazards present at LLNL and Sandia/CA and the geographical location of the facilities. The needs assessment also identifies areas where the modification of the requirements in the applicable NFPA standards is appropriate, due to the improved fire protection
Energy Technology Data Exchange (ETDEWEB)
Adams, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Arsenlis, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bergman, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Brase, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Brenner, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Camara, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Carlton, H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cheng, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chrzanowski, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Colson, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); East, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Farrell, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ferranti, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gursahani, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hansen, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Helms, L. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hernandez, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jeffries, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Larson, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lu, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McNabb, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mercer, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Skeate, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sueksdorf, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zucca, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Le, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ancria, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Scott, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Leininger, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gagliardi, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gash, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bronson, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chung, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hobson, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Meeker, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sanchez, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zagar, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Quivey, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sommer, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Atherton, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-06-06
Lawrence Livermore National Laboratory Campus Capability Plan for 2018-2028. Lawrence Livermore National Laboratory (LLNL) is one of three national laboratories that are part of the National Nuclear Security Administration. LLNL provides critical expertise to strengthen U.S. security through development and application of world-class science and technology that: Ensures the safety, reliability, and performance of the U.S. nuclear weapons stockpile; Promotes international nuclear safety and nonproliferation; Reduces global danger from weapons of mass destruction; Supports U.S. leadership in science and technology. Essential to the execution and continued advancement of these mission areas are responsive infrastructure capabilities. This report showcases each LLNL capability area and describes the mission, science, and technology efforts enabled by LLNL infrastructure, as well as future infrastructure plans.
Directory of Open Access Journals (Sweden)
Thomas Leppelt
2013-11-01
Full Text Available This study assesses how top-tier suppliers market their capabilities to ensure a responsible upstream supply chain to their downstream buyers, and how the marketing of corporate social responsibility (CSR-related supply management practices affects the reputation of top-tier suppliers in business-to-business (B2B markets. In a cross-functional multiple-case study involving marketing, purchasing, and sustainability executives of five supplier organizations in Central Europe, we explored four distinct approaches for marketing superior CSR management abilities in B2B markets that potentially foster long-term comparative advantages: (1 Fact-based communication of measurable CSR capabilities, (2 targeting of indirect customers and influencers, (3 marketing through education, and (4 marketing of CSR as a service. Moreover, our inductive results provide evidence that the effective marketing of CSR capabilities enhances a supplier’s reputation only if it sends consistent signals to the market. Therefore, a close integration of marketing and purchasing is crucial for achieving signaling consistency. Building on an established framework of purchasing-marketing integration in the particular context of CSR we developed a crossfunctional theory on the link between marketing, supply chain alignment and reputation, which is expressed in four sets of testable research propositions.
Current limiting capability of diffused resistors
International Nuclear Information System (INIS)
Shedd, W.; Cappelli, J.
1979-01-01
An experimental evaluation of the current limiting capability of dielectrically isolated diffused resistors at transient ionizing dose rates up to 6*10 12 rads(Si)/sec is presented. Existing theoretical predictions of the transient response of diffused resistors are summarized and compared to the experimentally measured values. The test resistors used allow the effects of sheet resistance and geometry on the transient response to be determined. The experimental results show that typical dielectrically isolated diffused resistors maintain adequate current limiting capability for use in radiation hardened integrated circuits
Capabilities of the Los Alamos National Laboratory's environmental emergency-response vehicle
International Nuclear Information System (INIS)
Van Etten, D.; Talley, D.; Buhl, T.; Hansen, W.
1982-01-01
A 4-wheel drive van has been outfitted for rapid and varied monitoring response to radiological emergencies. The vehicle's capabilities include 4-wheel drive plus auxiliary winch for access to rugged off-road terrain. On-board equipment is powered by a 6.5 kilowatt ac generator or by external ac power where available. Monitoring systems include two multichannel analyzers; one, a 2 K portable analyzer with intrinsic germanium detector, the second, a microprocessor based 4 K analyzer with a swivel head intrinsic germanium detector. Rapid gamma searches are performed with a delta rate meter system using a chart recorder and two 4'' x 4'' x 16'' NaI detectors. Other equipment includes portable high volume air samplers and a portable phoswich, as well as the usual portable radiation survey instruments. The construction is modular so that equipment racks, detectors, AC generator and other major structures can be removed or replaced in a matter of minutes
Yamamoto, Shuji; Yamauchi, Takahiro; Kawai, Yasukazu; Takemura, Haruyuki; Kishi, Shinji; Yoshida, Akira; Urasaki, Yoshimasa; Iwasaki, Hiromichi; Ueda, Takanori
2007-02-01
The combination of cytarabine (ara-C) with fludarabine is a common approach to treating resistant acute myeloid leukemia. Success depends on a fludarabine triphosphate (F-ara-ATP)-mediated increase in the active intracellular metabolite of ara-C, ara-C 5'-triphosphate (ara-CTP). Therapy-resistant leukemia may exhibit ara-C resistance, the mechanisms of which might induce cross-resistance to fludarabine with reduced F-ara-ATP formation. The present study evaluated the effect of combining ara-C and fludarabine on ara-C-resistant leukemic cells in vitro. Two variant cell lines (R1 and R2) were 8-fold and 10-fold more ara-C resistant, respectively, than the parental HL-60 cells. Reduced deoxycytidine kinase activity was demonstrated in R1 and R2 cells, and R2 cells also showed an increase in cytosolic 5'-nucleotidase II activity. Compared with HL-60 cells, R1 and R2 cells produced smaller amounts of ara-CTP. Both variants accumulated less F-ara-ATP than HL-60 cells and showed cross-resistance to fludarabine nucleoside (F-ara-A). R2 cells, however, accumulated much smaller amounts of F-ara-ATP and were more F-ara-A resistant than R1 cells. In HL-60 and R1 cells, F-ara-A pretreatment followed by ara-C incubation produced F-ara-ATP concentrations sufficient for augmenting ara-CTP production, thereby enhancing ara-C cytotoxicity. No potentiation was observed in R2 cells. Nucleotidase might preferentially degrade F-ara-A monophosphate over ara-C monophosphate, leading to reduced F-ara-ATP production and thereby compromising the F-ara-A-mediated potentiation of ara-C cytotoxicity in R2 cells. Thus, F-ara-A-mediated enhancement of ara-C cytotoxicity depended on F-ara-ATP accumulation in ara-C-resistant leukemic cells but ultimately was associated with the mechanism of ara-C resistance.
Smart responsive microcapsules capable of recognizing heavy metal ions.
Pi, Shuo-Wei; Ju, Xiao-Jie; Wu, Han-Guang; Xie, Rui; Chu, Liang-Yin
2010-09-15
Smart responsive microcapsules capable of recognizing heavy metal ions are successfully prepared with oil-in-water-in-oil double emulsions as templates for polymerization in this study. The microcapsules are featured with thin poly(N-isopropylacrylamide-co-benzo-18-crown-6-acrylamide) (P(NIPAM-co-BCAm)) membranes, and they can selectively recognize special heavy metal ions such as barium(II) or lead(II) ions very well due to the "host-guest" complexation between the BCAm receptors and barium(II) or lead(II) ions. The stable BCAm/Ba(2+) or BCAm/Pb(2+) complexes in the P(NIPAM-co-BCAm) membrane cause a positive shift of the volume phase transition temperature of the crosslinked P(NIPAM-co-BCAm) hydrogel to a higher temperature, and the repulsion among the charged BCAm/Ba(2+) or BCAm/Pb(2+) complexes and the osmotic pressure within the P(NIPAM-co-BCAm) membranes result in the swelling of microcapsules. Induced by recognizing barium(II) or lead(II) ions, the prepared microcapsules with P(NIPAM-co-BCAm) membranes exhibit isothermal and significant swelling not only in outer and inner diameters but also in the membrane thickness. The proposed microcapsules in this study are highly attractive for developing smart sensors and/or carriers for detection and/or elimination of heavy metal ions. Copyright 2010 Elsevier Inc. All rights reserved.
Leak detection capability in CANDU reactors
Energy Technology Data Exchange (ETDEWEB)
Azer, N.; Barber, D.H.; Boucher, P.J. [and others
1997-04-01
This paper addresses the moisture leak detection capability of Ontario Hydro CANDU reactors which has been demonstrated by performing tests on the reactor. The tests confirmed the response of the annulus gas system (AGS) to the presence of moisture injected to simulate a pressure tube leak and also confirmed the dew point response assumed in leak before break assessments. The tests were performed on Bruce A Unit 4 by injecting known and controlled rates of heavy water vapor. To avoid condensation during test conditions, the amount of moisture which could be injected was small (2-3.5 g/hr). The test response demonstrated that the AGS is capable of detecting and annunciating small leaks. Thus confidence is provided that it would alarm for a growing pressure tube leak where the leak rate is expected to increase to kg/hr rapidly. The measured dew point response was close to that predicted by analysis.
Leak detection capability in CANDU reactors
International Nuclear Information System (INIS)
Azer, N.; Barber, D.H.; Boucher, P.J.
1997-01-01
This paper addresses the moisture leak detection capability of Ontario Hydro CANDU reactors which has been demonstrated by performing tests on the reactor. The tests confirmed the response of the annulus gas system (AGS) to the presence of moisture injected to simulate a pressure tube leak and also confirmed the dew point response assumed in leak before break assessments. The tests were performed on Bruce A Unit 4 by injecting known and controlled rates of heavy water vapor. To avoid condensation during test conditions, the amount of moisture which could be injected was small (2-3.5 g/hr). The test response demonstrated that the AGS is capable of detecting and annunciating small leaks. Thus confidence is provided that it would alarm for a growing pressure tube leak where the leak rate is expected to increase to kg/hr rapidly. The measured dew point response was close to that predicted by analysis
Zou, Zhen; He, Dinggeng; Cai, Linli; He, Xiaoxiao; Wang, Kemin; Yang, Xue; Li, Liling; Li, Siqi; Su, Xiaoya
2016-04-06
The outstanding progress of nanoparticles-based delivery systems capable of releasing hypoglycemic drugs in response to glucose has dramatically changed the outlook of diabetes management. However, the developed glucose-responsive systems have not offered real-time monitoring capabilities for accurate quantifying hypoglycemic drugs released. In this study, we present a multifunctional delivery system that integrates both delivery and monitoring issues using glucose-triggered competitive binding scheme on alizarin complexone (ALC) functionalized mesoporous silica nanoparticles (MSN). In this system, ALC is modified on the surface of MSN as the signal reporter. Gluconated insulin (G-Ins) is then introduced onto MSN-ALC via benzene-1,4-diboronic acid (BA) mediated esterification reaction, where G-Ins not only blocks drugs inside the mesopores but also works as a hypoglycemic drug. In the absence of glucose, the sandwich-type boronate ester structure formed by BA binding to the diols of ALC and G-Ins remains intact, resulting in an fluorescence emission peak at 570 nm and blockage of pores. Following a competitive binding, the presence of glucose cause the dissociation of boronate ester between ALC and BA, which lead to the pores opening and disappearance of fluorescence. As proof of concept, rosiglitazone maleate (RSM), an insulin-sensitizing agent, was doped into the MSN to form a multifunctional MSN (RSM@MSN-ALC-BA-Ins), integrating with double-drugs loading, glucose-responsive performance, and real-time monitoring capability. It has been demonstrated that the glucose-responsive release behaviors of insulin and RSM in buffer or in human serum can be quantified in real-time through evaluating the changes of fluorescence signal. We believe that this developed multifunctional system can shed light on the invention of a new generation of smart nanoformulations for optical diagnosis, individualized treatment, and noninvasive monitoring of diabetes management.
Nock, Adam M; Wargo, Matthew J
2016-09-15
Burkholderia thailandensis is a soil-dwelling bacterium that shares many metabolic pathways with the ecologically similar, but evolutionarily distant, Pseudomonas aeruginosa Among the diverse nutrients it can utilize is choline, metabolizable to the osmoprotectant glycine betaine and subsequently catabolized as a source of carbon and nitrogen, similar to P. aeruginosa Orthologs of genes in the choline catabolic pathway in these two bacteria showed distinct differences in gene arrangement as well as an additional orthologous transcriptional regulator in B. thailandensis In this study, we showed that multiple glutamine amidotransferase 1 (GATase 1)-containing AraC family transcription regulators (GATRs) are involved in regulation of the B. thailandensis choline catabolic pathway (gbdR1, gbdR2, and souR). Using genetic analyses and sequencing the transcriptome in the presence and absence of choline, we identified the likely regulons of gbdR1 (BTH_II1869) and gbdR2 (BTH_II0968). We also identified a functional ortholog for P. aeruginosa souR, a GATR that regulates the metabolism of sarcosine to glycine. GbdR1 is absolutely required for expression of the choline catabolic locus, similar to P. aeruginosa GbdR, while GbdR2 is important to increase expression of the catabolic locus. Additionally, the B. thailandensis SouR ortholog (BTH_II0994) is required for catabolism of choline and its metabolites as carbon sources, whereas in P. aeruginosa, SouR function can by bypassed by GbdR. The strategy employed by B. thailandensis represents a distinct regulatory solution to control choline catabolism and thus provides both an evolutionary counterpoint and an experimental system to analyze the acquisition and regulation of this pathway during environmental growth and infection. Many proteobacteria that occupy similar environmental niches have horizontally acquired orthologous genes for metabolism of compounds useful in their shared environment. The arrangement and differential
Energy Technology Data Exchange (ETDEWEB)
Starke, Michael R [ORNL; Kirby, Brendan J [ORNL; Kueck, John D [ORNL; Todd, Duane [Alcoa; Caulfield, Michael [Alcoa; Helms, Brian [Alcoa
2009-02-01
Demand response is the largest underutilized reliability resource in North America. Historic demand response programs have focused on reducing overall electricity consumption (increasing efficiency) and shaving peaks but have not typically been used for immediate reliability response. Many of these programs have been successful but demand response remains a limited resource. The Federal Energy Regulatory Commission (FERC) report, 'Assessment of Demand Response and Advanced Metering' (FERC 2006) found that only five percent of customers are on some form of demand response program. Collectively they represent an estimated 37,000 MW of response potential. These programs reduce overall energy consumption, lower green house gas emissions by allowing fossil fuel generators to operate at increased efficiency and reduce stress on the power system during periods of peak loading. As the country continues to restructure energy markets with sophisticated marginal cost models that attempt to minimize total energy costs, the ability of demand response to create meaningful shifts in the supply and demand equations is critical to creating a sustainable and balanced economic response to energy issues. Restructured energy market prices are set by the cost of the next incremental unit of energy, so that as additional generation is brought into the market, the cost for the entire market increases. The benefit of demand response is that it reduces overall demand and shifts the entire market to a lower pricing level. This can be very effective in mitigating price volatility or scarcity pricing as the power system responds to changing demand schedules, loss of large generators, or loss of transmission. As a global producer of alumina, primary aluminum, and fabricated aluminum products, Alcoa Inc., has the capability to provide demand response services through its manufacturing facilities and uniquely through its aluminum smelting facilities. For a typical aluminum smelter
Molthan, A.; Seepersad, J.; Shute, J.; Carriere, L.; Duffy, D.; Tisdale, B.; Kirschbaum, D.; Green, D. S.; Schwizer, L.
2017-12-01
NASA's Earth Science Disasters Program promotes the use of Earth observations to improve the prediction of, preparation for, response to, and recovery from natural and technological disasters. NASA Earth observations and those of domestic and international partners are combined with in situ observations and models by NASA scientists and partners to develop products supporting disaster mitigation, response, and recovery activities among several end-user partners. These products are accompanied by training to ensure proper integration and use of these materials in their organizations. Many products are integrated along with other observations available from other sources in GIS-capable formats to improve situational awareness and response efforts before, during and after a disaster. Large volumes of NASA observations support the generation of disaster response products by NASA field center scientists, partners in academia, and other institutions. For example, a prediction of high streamflows and inundation from a NASA-supported model may provide spatial detail of flood extent that can be combined with GIS information on population density, infrastructure, and land value to facilitate a prediction of who will be affected, and the economic impact. To facilitate the sharing of these outputs in a common framework that can be easily ingested by downstream partners, the NASA Earth Science Disasters Program partnered with Esri and the NASA Center for Climate Simulation (NCCS) to establish a suite of Esri/ArcGIS services to support the dissemination of routine and event-specific products to end users. This capability has been demonstrated to key partners including the Federal Emergency Management Agency using a case-study example of Hurricane Matthew, and will also help to support future domestic and international disaster events. The Earth Science Disasters Program has also established a longer-term vision to leverage scientists' expertise in the development and delivery of
Responsible chain management: a capability assessment framework
de Bakker, F.G.A.; Nijhof, A.
2002-01-01
In recent years, increased attention has been paid to issues of responsibility across the entire product lifecyle. Responsible behaviour of organizations in the product chain is dependent on the actions of other parties such as suppliers and customers. Only through co-operation and close interaction
Responsible chain management: A capability assessment framework
de Bakker, F.G.A.; Nijhof, A.H.J.
2002-01-01
In recent years, increased attention has been paid to issues of responsibility across the entire product lifecycle. Responsible behaviour of organizations in the product chain is dependent on the actions of other parties such as suppliers and customers. Only through co-operation and close
Energy Technology Data Exchange (ETDEWEB)
Chiang, H.; Wu, R.Y.; Shao, B.J.; Fu, Y.D.; Yao, G.D.; Lu, D.J. [Zhejiang Medical Univ. (China)
1995-05-01
Eighty-nine Swiss Webster mice were randomly divided into four groups: a control group, a pulsed magnetic field (PMF) group, a cytosine arabinoside (ara-C, a teratogen) group, and a combined PMF + ara-C group. Mice in the PMF and PMF + ara-C groups were irradiated with a PMF (a sawtooth waveform with 52 {mu}s rise time, 12{mu}s decay time, and 15.6 kHz frequency) at a peak magnetic flux density of 40 {mu}T for 4 hours daily on days 6-17 of gestation. The mice in the ara-C and the PMF + ara-C groups were injected intraperitoneally on day 9 of gestation with 10 mg/kg of ara-C. The incidence of resorption and dead fetuses was not affected by PMF but was increased by ara-C injection. The malformation incidence of cleft palate (CP) and/or cleft lip (CL) was significantly higher in all three of the treated groups than in the control group (P < 0.05). If, however, statistical analyses had been done on litters rather than on individual fetuses, they would show that the incidence of CP and/or CL in the PMF group is not significantly greater than that in the control group. A significantly higher incidence of CP and/or CL was found in the PMF + ara-C group (49%) than the ara-C alone group (26.1%). These data suggest that PMF might enhance the development of ara-C-induced CP and/or CL. The incidence of minor variations in skeletal development, including reduction of skeletal calcification and loss of skeleton, was not statistically significant in the PMF group. However, it was higher in the two ara-C-treated groups, and there was no significant difference between the ara-C alone group and the ara-C + PMF group. From these results it is concluded that the very weak embryotoxic effects of PMF exposure may be revealed and enhanced in combination with a teratogenic agent.
International Nuclear Information System (INIS)
Lindbom, Hanna; Tehler, Henrik; Eriksson, Kerstin; Aven, Terje
2015-01-01
Capabilities-based planning and capability assessment are high on the agendas of several countries and organisations as part of their risk management and emergency preparedness. Despite this, few definitions of capability exist, and they are not easily related to concepts such as risk, vulnerability and resilience. The aim of the present study was thus to broaden the scientific basis of the risk field to also include the concept of capability. The proposed definition is based on a recently developed risk framework, and we define capability as the uncertainty about and the severity of the consequences of an activity given the occurrence of the initiating event and the performed task. We provide examples of how the response capability for a fictive scenario can be described using this definition, and illustrate how our definition can be used to analyse capability assessments prepared according to the Swedish crisis management system. We have analysed the content of 25 capability assessments produced in 2011 by stakeholders on local, regional and national level. It was concluded that none addressed uncertainty to any appreciable extent, and only a third described capability in terms of consequences and task, making it difficult to relate these capability assessments to risk assessments. - Highlights: • Few definitions of capability relate to definitions of risk, vulnerability and resilience. • We relate capability to risk, vulnerability and resilience. • We define capability using the components uncertainty, consequences, event and task
Canadian national nuclear forensics capability project
International Nuclear Information System (INIS)
Ball, J.; Dimayuga, I.; Summerell, I.; Totland, M.; Jonkmans, G.; Whitlock, J.; El-jaby, A.; Inrig, E.
2015-01-01
Following the 2010 Nuclear Security Summit, Canada expanded its existing capability for nuclear forensics by establishing a national nuclear forensics laboratory network, which would include a capability to perform forensic analysis on nuclear and other radioactive material, as well as on traditional evidence contaminated with radioactive material. At the same time, the need for a national nuclear forensics library of signatures of nuclear and radioactive materials under Canadian regulatory control was recognized. The Canadian Safety and Security Program, administered by Defence Research and Development Canada's Centre for Security Science (DRDC CSS), funds science and technology initiatives to enhance Canada's preparedness for prevention of and response to potential threats. DRDC CSS, with assistance from Canadian Nuclear Laboratories, formerly Atomic Energy of Canada Limited, is leading the Canadian National Nuclear Forensics Capability Project to develop a coordinated, comprehensive, and timely national nuclear forensics capability. (author)
Radiation metagenesis and inhibition of DNA synthesis
International Nuclear Information System (INIS)
Dubinina, L.G.; Sergievskaya, S.P.; Kurashova, Z.I.; Dubinin, N.P.
1983-01-01
The study of modification of radiation mutagenesis and inhibition of the DNA synthesis by means of 1-β-D arabinofuranosylcytosine (ara-C) is carried out. It is shown that ara-C-acting on chromosomes in the G 1 phase and G 2 phase does not cause mutations in the C capillaris cells. The modification by means of ara-C radiation effect in the G 1 phase and G 2 phase correlates with duration and time of administering ara-C before and after irradiation. A new form of ara-C DNA synthesis inhibitor interaction with mutation processes has been found out. Protective effect of the DNA synthesis inhibitor (ara-C) from mutageneous radiation effect is stressed. Sensibilization of the radiation mutagenesis during cell treafment by the DNA synthesis inhibitor (ara-C) is shown. It is pointed out that emergence of sensibilization or protective effect, i. e. antimutagenesis phenomenon depends on conditions under which the synthesis inhibitor acted in G 1 and G 2 phases
Applying systems engineering principles towards developing defence capabilities
CSIR Research Space (South Africa)
Smith, CJ
2011-09-01
Full Text Available responsibility is creating and executing an interdisciplinary process to ensure that the customer and stakeholders? needs are satisfied in a high quality, trustworthy, cost efficient and schedule compliant manner throughout a system?s entire life cycle... in the As-Is J Ops capability arising from factors such as changes in the operational environment (threat, theatres of operation, etc.), new technology insertion and obsolescence can be identified. These capability gaps are analysed in the Capability...
Real-time modeling of complex atmospheric releases in urban areas
International Nuclear Information System (INIS)
Baskett, R.L.; Ellis, J.S.; Sullivan, T.J.
1994-08-01
If a nuclear installation in or near an urban area has a venting, fire, or explosion, airborne radioactivity becomes the major concern. Dispersion models are the immediate tool for estimating the dose and contamination. Responses in urban areas depend on knowledge of the amount of the release, representative meteorological data, and the ability of the dispersion model to simulate the complex flows as modified by terrain or local wind conditions. A centralized dispersion modeling system can produce realistic assessments of radiological accidents anywhere in a country within several minutes if it is computer-automated. The system requires source-term, terrain, mapping and dose-factor databases, real-time meteorological data acquisition, three-dimensional atmospheric transport and dispersion models, and experienced staff. Experience with past responses in urban areas by the Atmospheric Release Advisory Capability (ARAC) program at Lawrence Livermore National Laboratory illustrate the challenges for three-dimensional dispersion models
Real-time modelling of complex atmospheric releases in urban areas
International Nuclear Information System (INIS)
Baskett, R.L.; Ellis, J.S.; Sullivan, T.J.
2000-01-01
If a nuclear installation in or near an urban area has a venting, fire, or explosion, airborne radioactivity becomes the major concern. Dispersion models are the immediate tool for estimating the dose and contamination. Responses in urban areas depend on knowledge of the amount of the release, representative meteorological data, and the ability of the dispersion model to simulate the complex flows as modified by terrain or local wind conditions. A centralised dispersion modelling system can produce realistic assessments of radiological accidents anywhere in a country within several minutes if it is computer-automated. The system requires source-term, terrain, mapping and dose-factor databases, real-time meteorological data acquisition, three-dimensional atmospheric transport and dispersion models, and experienced staff. Experience with past responses in urban areas by the Atmospheric Release Advisory Capability (ARAC) program at Lawrence Livermore National Laboratory illustrate the challenges for three-dimensional dispersion models. (author)
Xu, Chun-Yan; Geng, Shan; Liu, Jun; Zhu, Jia-Hong; Zhang, Xian-Ping; Jiang, Rong; Wang, Ya-Ping
2014-04-01
The latest findings of our laboratory showed that Angelica sinensis polysaccharide (ASP) showed a definite effect in regulating the aging of hematopoietic stem cells. Leukemia is a type of malignant hematopoietic tumor in hematopoietic stem cells. There have been no relevant reports about ASP's effect in regulating the aging of leukemia cells. In this study, human acute myeloid leukemia (AML) KG1alpha cell lines in logarithmic growth phase were taken as the study object, and were divided into the ASP group, the cytarabine (Ara-C) group, the ASP + Ara-C group and the control group. The groups were respectively treated with different concentration of ASP, Ara-C and ASP + Ara-C for different periods, with the aim to study the effect of ASP combined with Ara-C in regulating the aging of human acute myeloid leukemia KG1alpha cell lines and its relevant mechanism. The results showed that ASP, Ara-C and ASP + Ara-C could obviously inhibit KG1alpha cell proliferation in vitro, block the cells in G0/G1 phase. The cells showed the aging morphological feature. The percentage of positive stained aging cells was dramatically increased, and could significantly up-regulate the expression of aging-related proteins P16 and RB, which were more obvious in the ASP + Ara-C group. In conclusion, the aging mechanism of KG1alpha cell induced by ASP and Ara-C may be related to the regulation of the expression of aging-related proteins, suggesting that the combined administration of ASP and anticancer drugs plays a better role in the treatment of leukemia .
Canadian national nuclear forensics capability project
Energy Technology Data Exchange (ETDEWEB)
Ball, J.; Dimayuga, I., E-mail: joanne.ball@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Summerell, I. [Royal Canadian Mounted Police, Ottawa, Ontario (Canada); Totland, M. [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Jonkmans, G. [Defence Research and Development Canada, Ottawa, Ontario (Canada); Whitlock, J. [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); El-jaby, A. [Canadian Nuclear Safety Commission, Ottawa, Ontario (Canada); Inrig, E. [Defence Research and Development Canada, Ottawa, Ontario (Canada)
2015-06-15
Following the 2010 Nuclear Security Summit, Canada expanded its existing capability for nuclear forensics by establishing a national nuclear forensics laboratory network, which would include a capability to perform forensic analysis on nuclear and other radioactive material, as well as on traditional evidence contaminated with radioactive material. At the same time, the need for a national nuclear forensics library of signatures of nuclear and radioactive materials under Canadian regulatory control was recognized. The Canadian Safety and Security Program, administered by Defence Research and Development Canada's Centre for Security Science (DRDC CSS), funds science and technology initiatives to enhance Canada's preparedness for prevention of and response to potential threats. DRDC CSS, with assistance from Canadian Nuclear Laboratories, formerly Atomic Energy of Canada Limited, is leading the Canadian National Nuclear Forensics Capability Project to develop a coordinated, comprehensive, and timely national nuclear forensics capability. (author)
Structural reliability assessment capability in NESSUS
Millwater, H.; Wu, Y.-T.
1992-07-01
The principal capabilities of NESSUS (Numerical Evaluation of Stochastic Structures Under Stress), an advanced computer code developed for probabilistic structural response analysis, are reviewed, and its structural reliability assessed. The code combines flexible structural modeling tools with advanced probabilistic algorithms in order to compute probabilistic structural response and resistance, component reliability and risk, and system reliability and risk. An illustrative numerical example is presented.
Graphical Visualization of Human Exploration Capabilities
Rodgers, Erica M.; Williams-Byrd, Julie; Arney, Dale C.; Simon, Matthew A.; Williams, Phillip A.; Barsoum, Christopher; Cowan, Tyler; Larman, Kevin T.; Hay, Jason; Burg, Alex
2016-01-01
NASA's pioneering space strategy will require advanced capabilities to expand the boundaries of human exploration on the Journey to Mars (J2M). The Evolvable Mars Campaign (EMC) architecture serves as a framework to identify critical capabilities that need to be developed and tested in order to enable a range of human exploration destinations and missions. Agency-wide System Maturation Teams (SMT) are responsible for the maturation of these critical exploration capabilities and help formulate, guide and resolve performance gaps associated with the EMC-identified capabilities. Systems Capability Organization Reporting Engine boards (SCOREboards) were developed to integrate the SMT data sets into cohesive human exploration capability stories that can be used to promote dialog and communicate NASA's exploration investments. Each SCOREboard provides a graphical visualization of SMT capability development needs that enable exploration missions, and presents a comprehensive overview of data that outlines a roadmap of system maturation needs critical for the J2M. SCOREboards are generated by a computer program that extracts data from a main repository, sorts the data based on a tiered data reduction structure, and then plots the data according to specified user inputs. The ability to sort and plot varying data categories provides the flexibility to present specific SCOREboard capability roadmaps based on customer requests. This paper presents the development of the SCOREboard computer program and shows multiple complementary, yet different datasets through a unified format designed to facilitate comparison between datasets. Example SCOREboard capability roadmaps are presented followed by a discussion of how the roadmaps are used to: 1) communicate capability developments and readiness of systems for future missions, and 2) influence the definition of NASA's human exploration investment portfolio through capability-driven processes. The paper concludes with a description
International Nuclear Information System (INIS)
Almeida, Jose Carlos S. de; Schirru, Roberto; Pereira, Claudio M.N.A.; Universidade Federal, Rio de Janeiro, RJ
2002-01-01
This work describes a possibilistic approach for transient identification based on the minimum centroids set method, proposed in previous work, optimized by genetic algorithm. The idea behind this method is to split the complex classification problem into small and simple ones, so that the performance in the classification can be increased. In order to accomplish that, a genetic algorithm is used to learn, from realistic simulated data, the optimized time partitions, which the robustness and correctness in the classification are maximized. The use of a possibilistic classification approach propitiates natural and consistent classification rules, leading naturally to a good heuristic to handle the 'don't know 'response, in case of unrecognized transient, which is fairly desirable in transient classification systems where safety is critical. Application of the proposed approach to a nuclear transient indentification problem reveals good capability of the genetic algorithm in learning optimized possibilistic classification rules for efficient diagnosis including 'don't know' response. Obtained results are shown and commented. (author)
Structural Capability of an Organization toward Innovation Capability
DEFF Research Database (Denmark)
Nielsen, Susanne Balslev; Momeni, Mostafa
2016-01-01
The scholars in the field of strategic management have developed two major approaches for attainment of competitive advantage: an approach based on environmental opportunities, and another one based on internal capabilities of an organization. Some investigations in the last two decades have...... indicated that the advantages relying on the internal capabilities of organizations may determine the competitive position of organizations better than environmental opportunities do. Characteristics of firms shows that one of the most internal capabilities that lead the organizations to the strongest...... competitive advantage in the organizations is the innovation capability. The innovation capability is associated with other organizational capabilities, and many organizations have focused on the need to identify innovation capabilities.This research focuses on recognition of the structural aspect...
International Nuclear Information System (INIS)
2006-12-01
The publication is issued as an attachment to EPR-RANET (2006) and has the same status. It provides administrative and technical guidelines for National Assistance Capabilities and enters into effect on 1 January 2007. Additional technical guidelines are under development by assistance work group under international Action Plan for Strengthening the International Preparedness and Response System for Nuclear and Radiological Emergencies. As these are finalised they will be included in this document
Phase II trial of cytarabine, cisplatin and vindesine for advanced non-small cell lung cancer.
Bianco, A; Perez, J E; Machiavelli, M; Leone, B A; Romero, A; Rabinovich, M G; Vallejo, C T; Rodriguez, R; Cuevas, M A; Alvarez, L A
1990-02-28
Thirty-two patients with advanced non-small cell lung cancer (NSCLC) were entered in this study to evaluate the efficacy and toxicity of a chemotherapy schedule including cisplatin (C) 40 mg/m2 intravenously (i.v.) on days 1-3; vindesine (V) 3 mg/m2 i.v. on day 1, and cytarabine (ara-C) 15 mg/m2 subcutaneously every 12 hours on days 1-3 (total dose: 90 mg/m2). Cisplatin was administered simultaneously with one dose of ara-C. Cycles were repeated every 28 days. Five patients out of 28 (18%) fully evaluable for response presented partial remissions. No complete response was observed. Median survival was 8 months and median duration of response was 4 months. Hematologic toxicity was severe in 3 patients. There were no toxicity-related deaths. Other adverse reactions included nausea and vomiting, alopecia and peripheral neuropathy. We conclude that this chemotherapy combination is marginally effective against NSCLC showing in this group of patients a low number of responses of short duration without a significant impact on survival.
Cytosine arabinoside influx and nucleoside transport sites in acute leukemia.
Wiley, J S; Jones, S P; Sawyer, W H; Paterson, A R
1982-02-01
Although cytosine arabinoside (araC) can induce a remission in a majority of patients presenting with acute myeloblastic leukemia (AML), a minority fail to respond and moreover the drug has less effect in acute lymphoblastic leukemia (ALL). The carrier-mediated influx of araC into purified blasts from patients with AML, ALL, and acute undifferentiated leukemia (AUL) has been compared to that of normal lymphocytes and polymorphs. Blasts showed a larger mediated influx of araC than mature cells, since mean influxes for myeloblasts and lymphoblasts were 6- and 2.3-fold greater than polymorphs and lymphocytes, respectively. Also, the mean influx for myeloblasts was fourfold greater than the mean for lymphoblasts. The number of nucleoside transport sites was estimated for each cell type by measuring the equilibrium binding of [(3)H]nitrobenzylthioinosine (NBMPR), which inhibits nucleoside fluxes by binding with high affinity to specific sites on the transport mechanism. The mean binding site numbers for myeloblasts and lymphoblasts were 5- and 2.8-fold greater, respectively, than for the mature cells of the same maturation series. The mean number of NBMPR binding sites for myeloblasts was fourfold greater than for lymphoblasts. Patients with AUL were heterogeneous since blasts from some gave values within the myeloblastic range and others within the lymphoblastic range. The araC influx correlated closely with the number of NBMPR binding sites measured in the same cells on the same day. Transport parameters were measured on blasts from 15 patients with AML or AUL who were then treated with standard induction therapy containing araC. Eight patients entered complete remission, while seven failed therapy, among whom were the three patients with the lowest araC influx (myeloblasts have both higher araC transport rates and more nucleoside transport sites than lymphoblasts and this factor may contribute to the greater sensitivity of AML to this drug. AraC transport varied >10
Energy Technology Data Exchange (ETDEWEB)
Yamauchi, Takahiro; Kawai, Yasukazu; Ueda, Takanori [Fukui Medical Univ., Matsuoka (Japan)
2002-12-01
We have sought to clarify the potential activity of the S-phase-specific antileukemic agent 1-{beta}-D-arabinofuranosylcytosine (ara-C), an inhibitor of DNA synthesis, in quiescent cells that are substantially non-sensitive to nucleoside analogues. It was hypothesized that the combination of ara-C with DNA damaging agents that initiate DNA repair will expand ara-C cytotoxicity to non-cycling cells. The repair kinetics, which included incision of damaged DNA, gap-filling by DNA synthesis and rejoining by ligation, were evaluated using the single cell gel electrophoresis (Comet) assay and the thymidine incorporation assay. When normal lymphocytes were treated with ultraviolet C or with 1,3-bis(2-chloroethyl)-1-nitrosourea (BCNU), the processes of DNA excision repair were promptly initiated and rapidly completed. When the cells were incubated with ara-C prior to irradiation or BCNU treatment, the steps of DNA synthesis and rejoining in the repair processes were both inhibited. The ara-C-mediated inhibition of the repair processes was concentration-dependent, with the effect peaking at 10{mu}M. The combination of ara-C with these DNA repair initiators exerted subsequent cytotoxicity, which was proportional to the extent of the repair inhibition in the presence of ara-C. In conclusion, ara-C was cytotoxic in quiescent cells undergoing DNA repair. This might be attributed to unrepaired DNA damage that remained in the cells, thereby inducing lethal cytotoxicity. Alternatively, ara-C might exert its own cytotoxicity by inhibiting DNA synthesis in the repair processes. Such a strategy may be effective against a dormant subpopulation in acute leukemia that survives chemotherapy. (author)
International Nuclear Information System (INIS)
Yamauchi, Takahiro; Kawai, Yasukazu; Ueda, Takanori
2002-01-01
We have sought to clarify the potential activity of the S-phase-specific antileukemic agent 1-β-D-arabinofuranosylcytosine (ara-C), an inhibitor of DNA synthesis, in quiescent cells that are substantially non-sensitive to nucleoside analogues. It was hypothesized that the combination of ara-C with DNA damaging agents that initiate DNA repair will expand ara-C cytotoxicity to non-cycling cells. The repair kinetics, which included incision of damaged DNA, gap-filling by DNA synthesis and rejoining by ligation, were evaluated using the single cell gel electrophoresis (Comet) assay and the thymidine incorporation assay. When normal lymphocytes were treated with ultraviolet C or with 1,3-bis(2-chloroethyl)-1-nitrosourea (BCNU), the processes of DNA excision repair were promptly initiated and rapidly completed. When the cells were incubated with ara-C prior to irradiation or BCNU treatment, the steps of DNA synthesis and rejoining in the repair processes were both inhibited. The ara-C-mediated inhibition of the repair processes was concentration-dependent, with the effect peaking at 10μM. The combination of ara-C with these DNA repair initiators exerted subsequent cytotoxicity, which was proportional to the extent of the repair inhibition in the presence of ara-C. In conclusion, ara-C was cytotoxic in quiescent cells undergoing DNA repair. This might be attributed to unrepaired DNA damage that remained in the cells, thereby inducing lethal cytotoxicity. Alternatively, ara-C might exert its own cytotoxicity by inhibiting DNA synthesis in the repair processes. Such a strategy may be effective against a dormant subpopulation in acute leukemia that survives chemotherapy. (author)
Dynamic capabilities from an institutionalist viewpoint
Directory of Open Access Journals (Sweden)
José Bonfim Albuquerque Filho
Full Text Available Abstract The purpose of this paper is to elucidate the effects of strategic, technical and institutional response, in the perspective of dynamic capability facing environmental changes, considering that the literature has few references on how institutional factors contribute to a firm’s dynamic capabilities. A case study was conducted on the oldest journalistic enterprise in Brazil. It was found that the organizational practices with dynamic capabilities were conditioned by mechanisms and factors that have extrapolated intentions, expectations, and planning skills of the firm’s own Board of Directors. The new social structure found in the organization is based on the interpretations of the journalists themselves, regarding the social reality of the field of journalism, was supported by the coherent interpretative schemata of some managers in order to reduce the uncertainty caused by institutional demands of the rapidly changing reading habits of people. The study revealed that strategic practices such as making the newspaper known at schools, development of a digital newspaper, showed the influence of institutions as a new normative order, social responsibility, greater legitimacy, and at the same time, a higher capacity of the organization to adapt to its business environment. These aspects, reflect a cultural structure that is reproduced at the company in its practices for the continuous use of new technologies and new social demands.
Design Management Capability and Product Innovation in SMEs
Fernández-Mesa, Ana Isabel; ALEGRE VIDAL, JOAQUIN; CHIVA GOMEZ, RICARDO; Gutiérrez Gracia, Antonio
2013-01-01
[EN] Purpose The aim of this paper is to present design management as a dynamic capability and to analyze its mediating role between organizational learning capability and product innovation performance in small and medium enterprises (SMEs). Design/methodology/approach Structural equation modeling is used to test the research hypotheses based on data from the Italian and Spanish ceramic tile industries. The data are derived from the responses of 182 companies (50 percent of the targ...
77 FR 23161 - Onsite Emergency Response Capabilities
2012-04-18
... Operating Procedures B. Severe Accident Management Guidelines C. Extensive Damage Mitigation Guidelines D... the EOPs. B. Severe Accident Management Guidelines During the 1990s, the nuclear industry developed Severe Accident Management Guidelines (SAMGs) as a voluntary industry initiative in response to Generic...
Establishment of a national capability to respond to nuclear or radiological emergency
International Nuclear Information System (INIS)
Dahunsi, S. A.
2013-04-01
Establishment of a national capability to respond to nuclear accidents and radiological emergency involves the planning, preparedness, readiness, assurance and response application of the necessary human and material resources to mitigate consequences of an emergency and protect workers, the public, the environment, and national security in the event of such accident. This obligation helps to prepare for the security of lives and properties during such accidents and it is binding and the responsibility of the operator to provide answers to fundamental questions about the nature of radiation, guidance on protecting against the harmful effects, detailed policies, procedures and training. The response to such emergency will involve highly specialized agencies and technical experts. For the Nigerian response capability to be well co-ordinated, the arrangements must be appropriately integrated with those for a conventional emergency. This project will discuss the hazard analysis based on the available inventory of radiation practices, facilities, installations, radiation sources and radioactive materials used in Nigeria. Based upon this analysis, a commensurate nuclear accident and radiological emergency planning and response capabilities has been proposed.(au)
Impact of Personnel Capabilities on Organizational Innovation Capability
DEFF Research Database (Denmark)
Nielsen, Susanne Balslev; Momeni, Mostafa
2016-01-01
in this rapidly changing world. This research focuses on definition of the personnel aspect of innovation capability, and proposes a conceptual model based on the scientific articles of academic literature on organisations innovation capability. This paper includes an expert based validation in three rounds...... of the Delphi method. And for the purpose of a better appreciation of the relationship dominating the factors of the model, it has distributed the questionnaire to Iranian companies in the Food industry. This research proposed a direct relationship between Innovation Capability and the Personnel Capability...
Dynamic capabilities, creative action, and poetics
Directory of Open Access Journals (Sweden)
Donald MacLean
2017-05-01
Full Text Available Research on dynamic capabilities explores how businesses change enables enterprises to remain competitive. However, theory on dynamic capabilities still struggles to capture novelty, the essence of change. This study argues that a full understanding of strategic change requires us to sharpen our focus on real people and experiences; in turn, we must incorporate other faculties, which almost always operate alongside our logical ones, into our theory. We must pay more attention to the “non-rational” sides of ourselves—including, but not limited to, our imaginations, intuitions, attractions, biographies, preferences, and aesthetic faculties and capabilities. We argue that all such faculties, on the one hand, are central to our abilities to comprehend and cope with complexity and, on the other hand, foster novel understandings, potential responses, and social creativity. This study introduces the possibility of an alternative form of inquiry that highlights the role of poetic faculties in strategic behavior and change.
Study on the capability of four-level partial response equalization in RSOA-based WDM-PON
Guo, Qi; Tran, An Vu
2010-12-01
The expected development of advanced video services with HDTV quality demands the delivery of more than Gb/s link to end users across the last mile connection. Future access networks are also required to have long reach for reduction in the number of central offices (CO). Fueled by those requirements, we propose a novel equalization scheme that increases the capacity and reach of the wavelength division multiplexing passive optical network (WDM-PON) based on a low bandwidth reflective semiconductor optical amplifier (RSOA). We investigate the characteristics of 10 Gb/s upstream transmission in WDM-PON using RSOA with only 1.2 GHz electrical bandwidth and various lengths of fiber. It is proven that the proposed four-level partial response equalizer (PRE) is capable of mitigating the impact of ISI in the received signals from optical network units (ONU) located 0 km to 75 km away from the optical line terminal (OLT).
Claassen, R.J.G.|info:eu-repo/dai/nl/269266224
A capability approach prescribes paternalist government actions to the extent that it requires the promotion of specific functionings, instead of the corresponding capabilities. Capability theorists have argued that their theories do not have much of these paternalist implications, since promoting
Physician capability to electronically exchange clinical information, 2011.
Patel, Vaishali; Swain, Matthew J; King, Jennifer; Furukawa, Michael F
2013-10-01
To provide national estimates of physician capability to electronically share clinical information with other providers and to describe variation in exchange capability across states and electronic health record (EHR) vendors using the 2011 National Ambulatory Medical Care Survey Electronic Medical Record Supplement. Survey of a nationally representative sample of nonfederal office-based physicians who provide direct patient care. The survey was administered by mail with telephone follow-up and had a 61% weighted response rate. The overall sample consisted of 4326 respondents. We calculated estimates of electronic exchange capability at the national and state levels, and applied multivariate analyses to examine the association between the capability to exchange different types of clinical information and physician and practice characteristics. In 2011, 55% of physicians had computerized capability to send prescriptions electronically; 67% had the capability to view lab results electronically; 42% were able to incorporate lab results into their EHR; 35% were able to send lab orders electronically; and, 31% exchanged patient clinical summaries with other providers. The strongest predictor of exchange capability is adoption of an EHR. However, substantial variation exists across geography and EHR vendors in exchange capability, especially electronic exchange of clinical summaries. In 2011, a majority of office-based physicians could exchange lab and medication data, and approximately one-third could exchange clinical summaries with patients or other providers. EHRs serve as a key mechanism by which physicians can exchange clinical data, though physicians' capability to exchange varies by vendor and by state.
Zhang, Chun-Nuan; Li, Xiang-Fei; Jiang, Guang-Zhen; Zhang, Ding-Dong; Tian, Hong-Yan; Li, Jun-Yi; Liu, Wen-Bin
2014-12-01
This study aimed to determine the effects of fructooligosaccharide (FOS) levels and its feeding modes on growth, immune response, antioxidant capability and disease resistance of blunt snout bream (Megalobrama amblycephala). Fish (12.5 ± 0.5 g) were subjected to three FOS levels (0, 0.4% and 0.8%) and two feeding modes (supplementing FOS continuously and supplementing FOS two days interval 5 days) according to a 3 × 2 factorial design. At the end of 8-week feeding trial, fish were challenged by Aeromonas hydrophila with concentration of 1 × 10(5) CFU mL(-1) and mortality was recorded for the next 96 h. Fish fed 0.4% FOS continuously (D2) and fish fed the basal diet for 5 days followed by 0.8% FOS for 2 days (D5) showed admirable growth performance. The highest plasma lysozyme, acid phosphatase and myeloperoxidase activities as well as complement component 3, total protein and immunoglobulin M (IgM) levels were all observed in fish fed D5. They were significantly higher (P 0.05) with that of fish fed D2. A similar trend was also observed in antioxidant capability as well as the expression of Leap-I and Leap-Ⅱ. Mortality showed an opposite trend with the immune response with the lowest rate observed in fish fed D5. The results indicated that diet supplementing FOS in appropriate levels and feeding modes could improve the growth, immune response and antioxidant capability of fish, as might consequently lead to enhanced disease resistance. It can be speculated that the basal diet for 5 days followed by 0.8% FOS for 2 days was most suitable for blunt snout bream. Copyright © 2014 Elsevier Ltd. All rights reserved.
Facility Interface Capability Assessment (FICA) project report
International Nuclear Information System (INIS)
Pope, R.B.; MacDonald, R.R.; Viebrock, J.M.; Mote, N.
1995-09-01
The US Department of Energy's (DOE) Office of Civilian Radioactive Waste Management (OCRWM) is responsible for developing the Civilian Radioactive Waste Management System (CRWMS) to accept spent nuclear fuel from commercial facilities. The objective of the Facility Interface Capability Assessment (FICA) project was to assess the capability of each commercial spent nuclear fuel (SNF) storage facility, at which SNF is stored, to handle various SNF shipping casks. The purpose of this report is to present and analyze the results of the facility assessments completed within the FICA project. During Phase 1, the data items required to complete the facility assessments were identified and the database for the project was created. During Phase 2, visits were made to 122 facilities on 76 sites to collect data and information, the database was updated, and assessments of the cask-handling capabilities at each facility were performed. Each assessment of cask-handling capability contains three parts: the current capability of the facility (planning base); the potential enhanced capability if revisions were made to the facility licensing and/or administrative controls; and the potential enhanced capability if limited physical modifications were made to the facility. The main conclusion derived from the planning base assessments is that the current facility capabilities will not allow handling of any of the FICA Casks at 49 of the 122 facilities evaluated. However, consideration of potential revisions and/or modifications showed that all but one of the 49 facilities could be adapted to handle at least one of the FICA Casks. For this to be possible, facility licensing, administrative controls, and/or physical aspects of the facility would need to be modified
Facility Interface Capability Assessment (FICA) project report
Energy Technology Data Exchange (ETDEWEB)
Pope, R.B. [ed.] [Oak Ridge National Lab., TN (United States); MacDonald, R.R. [ed.] [Civilian Radioactive Waste Management System, Vienna, VA (United States); Viebrock, J.M.; Mote, N. [Nuclear Assurance Corp., Norcross, GA (United States)
1995-09-01
The US Department of Energy`s (DOE) Office of Civilian Radioactive Waste Management (OCRWM) is responsible for developing the Civilian Radioactive Waste Management System (CRWMS) to accept spent nuclear fuel from commercial facilities. The objective of the Facility Interface Capability Assessment (FICA) project was to assess the capability of each commercial spent nuclear fuel (SNF) storage facility, at which SNF is stored, to handle various SNF shipping casks. The purpose of this report is to present and analyze the results of the facility assessments completed within the FICA project. During Phase 1, the data items required to complete the facility assessments were identified and the database for the project was created. During Phase 2, visits were made to 122 facilities on 76 sites to collect data and information, the database was updated, and assessments of the cask-handling capabilities at each facility were performed. Each assessment of cask-handling capability contains three parts: the current capability of the facility (planning base); the potential enhanced capability if revisions were made to the facility licensing and/or administrative controls; and the potential enhanced capability if limited physical modifications were made to the facility. The main conclusion derived from the planning base assessments is that the current facility capabilities will not allow handling of any of the FICA Casks at 49 of the 122 facilities evaluated. However, consideration of potential revisions and/or modifications showed that all but one of the 49 facilities could be adapted to handle at least one of the FICA Casks. For this to be possible, facility licensing, administrative controls, and/or physical aspects of the facility would need to be modified.
Cytosine Arabinoside Influx and Nucleoside Transport Sites in Acute Leukemia
Wiley, J. S.; Jones, S. P.; Sawyer, W. H.; Paterson, A. R. P.
1982-01-01
Although cytosine arabinoside (araC) can induce a remission in a majority of patients presenting with acute myeloblastic leukemia (AML), a minority fail to respond and moreover the drug has less effect in acute lymphoblastic leukemia (ALL). The carrier-mediated influx of araC into purified blasts from patients with AML, ALL, and acute undifferentiated leukemia (AUL) has been compared to that of normal lymphocytes and polymorphs. Blasts showed a larger mediated influx of araC than mature cells...
Schwieger, Jana; Esser, Karl-Heinz; Lenarz, Thomas; Scheper, Verena
2016-08-01
Sensorineural deafness is mainly caused by damage to hair cells and degeneration of the spiral ganglion neurons (SGN). Cochlear implants can functionally replace lost hair cells and stimulate the SGN electrically. The benefit from cochlear implantation depends on the number and excitability of these neurons. To identify potential therapies for SGN protection, in vitro tests are carried out on spiral ganglion cells (SGC). A glial cell-reduced and neuron-enhanced culture of neonatal rat SGC under mitotic inhibition (cytarabine (AraC)) for up to seven days is presented. Serum containing and neurotrophin-enriched cultures with and without AraC-addition were analyzed after 4 and 7 days. The total number of cells was significantly reduced, while the proportion of neurons was greatly increased by AraC-treatment. Cell type-specific labeling demonstrated that nearly all fibroblasts and most of the glial cells were removed. Neither the neuronal survival, nor the neurite outgrowth or soma diameter were negatively affected. Additionally neurites remain partly free of surrounding non-neuronal cells. Recent culture conditions allow only for short-term cultivation of neonatal SGC and lack information on the influence of non-neuronal cells on SGN and of direct contact of neurites with test-materials. AraC-addition reduces the number of non-neuronal cells and increases the ratio of SGN in culture, without negative impact on neuronal viability. This treatment allows longer-term cultivation of SGC and provides deeper insight into SGN-glial cell interaction and the attachment of neurites on test-material surfaces. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
Dynamic capabilities, Marketing Capability and Organizational Performance
Directory of Open Access Journals (Sweden)
Adriana Roseli Wünsch Takahashi
2017-01-01
Full Text Available The goal of the study is to investigate the influence of dynamic capabilities on organizational performance and the role of marketing capabilities as a mediator in this relationship in the context of private HEIs in Brazil. As a research method we carried out a survey with 316 IES and data analysis was operationalized with the technique of structural equation modeling. The results indicate that the dynamic capabilities have influence on organizational performance only when mediated by marketing ability. The marketing capability has an important role in the survival, growth and renewal on educational services offerings for HEIs in private sector, and consequently in organizational performance. It is also demonstrated that mediated relationship is more intense for HEI with up to 3,000 students and other organizational profile variables such as amount of courses, the constitution, the type of institution and type of education do not significantly alter the results.
Simulation of atmospheric dispersion of radioactivity from the Chernobyl accident
International Nuclear Information System (INIS)
Lange, R.; Sullivan, T.J.; Gudiksen, P.H.
1989-07-01
Measurements of airborne radioactivity over Europe, Japan, and the United States indicated that the release from the Chernobyl reactor accident in the Soviet Union on April 26, 1986 contained a wide spectrum of fission up to heights of 7 km or more within a few days after the initial explosion. This high-altitude presence of radioactivity would in part be attributable to atmospheric dynamics factors other than the thermal energy released in the initial explosion. Indications were that two types of releases had taken place -- an initial powerful explosion followed by days of a less energetic reactor fire. The Atmospheric Release Advisory Capability (ARAC) at the Lawrence Livermore National Laboratory (LLNL) utilized three-dimensional atmospheric dispersion models to determine the characteristics of the source term (release) and the evolution of the spatial distributions of the airborne radioactivity as it was transported over Europe and subsequently over the northern hemisphere. This paper describes the ARAC involvement and the results of the hemispheric model calculations which graphically depict the extensive dispersal of radioactivity. 1 fig
Responsibilities and capabilities of a nuclear energy programme implementing organization
International Nuclear Information System (INIS)
2009-01-01
An appropriate infrastructure is essential for the efficient, safe, reliable and peaceful use of nuclear power. The IAEA was encouraged by its Member States to provide assistance to those considering the introduction of nuclear power. These countries face the challenge of building a national nuclear infrastructure to support a first nuclear power plant. The IAEA is responding to their needs through increased technical assistance, missions and workshops, and with new and updated technical publications in the IAEA Nuclear Energy Series. Milestones in the Development of a National Infrastructure for Nuclear Power, an IAEA Nuclear Energy Series publication (NG-G-3.1), provides detailed guidance on a holistic approach to national nuclear infrastructure development, over three phases. Nineteen issues are identified in this guide, ranging from development of a government's national position on nuclear power to planning for procurement related to the first NPP. An important element of the holistic approach is an entity that can help prepare the decision makers in a country to make a knowledgeable commitment to nuclear power, and then to coordinate infrastructure development efforts among various implementing organizations so that they arrive at the point of readiness to issue a bid tender at the same time. In the Milestones guide, this entity is called a nuclear energy programme implementing organization (NEPIO). As a growing number of Member States started to consider the nuclear power option, they asked for guidance from the IAEA on how to launch a nuclear power programme. In particular, Member States requested additional information on how to establish a NEPIO, especially in the earliest phases of a programme. This report has been prepared to provide information on the responsibilities and capabilities of a NEPIO, as well as to give an indication on how it relates to other key national organizations in the implementation of a nuclear power programme, such as the owner
International Nuclear Information System (INIS)
Knox, J.B.; MacCracken, M.C.; Dickerson, M.H.; Gresho, P.M.; Luther, F.M.
1986-08-01
This annual report for the Atmospheric and Geophysical Sciences Division (G-Division) summarizes the activities and highlights of the past three years, with emphasis on significant research findings in two major program areas: the Atmospheric Release Advisory Capability (ARAC), with its recent involvement in assessing the effects of the Chernobyl reactor accident, and new findings on the environmental consequences of nuclear war. The technical highlights of the many other research projects are also briefly reported, along with the Division's organization, budget, and publications
Datta, G; Hosur, R V; Verma, N C; Khetrapal, C L; Gurnani, S
1989-01-01
Interaction of the antileukemic drugs, cytosine-arabinoside (Ara-C) and adenosine-arabinoside (Ara-A) and a structural analogue, cytidine, with aromatic dipeptides has been studied by fluorescence and NMR spectroscopy. Ara-C and cytidine bind tryptophanyl and histidyl dipeptides but not tyrosyl dipeptides, while Ara-A does not bind to any of them. Both studies indicate association involving stacking of aromatic moieties. NMR spectra also indicate a protonation of the histidine moiety by Ara-C. In case of cytidine, the chemical shifts observed on binding to His-Phe imply that the backbone protons of the dipeptide participate in the binding. The conformation of the sugar and the base seem to play a very important role in the binding phenomenon as three similar molecules, Ara-C, Ara-A and cytidine bind in totally different ways.
Legitimacy, capability, effectiveness and the future of the NPT
International Nuclear Information System (INIS)
Keeley, J.F.
1987-01-01
This chapter looks at the relationship between legitimacy and capability in conceptually and politically contestable regions. This issue was highlighted by India's nuclear test of May 1974 and the Osiraq raid of 1981. These illustrated the general problem of the threat to the coherence and legitimacy of the non-proliferation regime. This threat arose from the spread of nuclear technological capabilities. Two developments in the non-proliferation regime that have helped produce the more specific problems of that regime are discussed. These are the spread of nuclear technological capabilities and the development of complex co-operation networks. The prospects for the modification of the NPT in response to these challenges are considered finally. (U.K.)
Improving emergency preparedness and crisis management capabilities in transportation.
2009-11-30
Despite the heightened attention disaster preparedness and emergency management have received over the past decade, serious weaknesses in the United States emergency response capabilities remain at all levels of government and across a wide range ...
Customer’s Advisory, Organizational Openness and Capability: the Locus of Value Creation
Directory of Open Access Journals (Sweden)
M. Özgür GÜNGÖR
2011-05-01
Full Text Available Organizations of today are aware of the necessity to communicate with customers beyond learning about their satisfaction, loyalty or complaints. The closest way is focusing on customer involvement, a general term used for capturing the responses, advises and ideas of customers in order to better proceed with innovation ideas for product and service development in a competitive market environment. This flow, which is named as “customer’s advisory” by the authors, necessitates openness and capability. Openness requires technological focus along with responsiveness and empathy in organizational culture, creating a positive communication environment. The two variables of the capability construct are frequent and bilateral information sharing. This study was conducted to detect the level of use of these two constructs by various organizations operating in Turkey. The aim was to understand the interest in customer involvement to remain competitive, how “customer’s advisory” was used to collect customer views and responses in order to nurture creativity in innovation processes. Results reflect that organizations proved to be open; responsive to meet expectations, willing to understand the customers, and reflected empathy to encourage creative ideas. Also both variables of the capability construct proved to be strong where well-educated and trained employees help most for understanding the comments of customers. Turkish organizations’ following the customer’s advisory with openness and capability brings a new focus into Customer Relationship Management via feeding a creative process leadership focus to remain competitive.
Metagenomic screening for aromatic compound-responsive transcriptional regulators.
Directory of Open Access Journals (Sweden)
Taku Uchiyama
Full Text Available We applied a metagenomics approach to screen for transcriptional regulators that sense aromatic compounds. The library was constructed by cloning environmental DNA fragments into a promoter-less vector containing green fluorescence protein. Fluorescence-based screening was then performed in the presence of various aromatic compounds. A total of 12 clones were isolated that fluoresced in response to salicylate, 3-methyl catechol, 4-chlorocatechol and chlorohydroquinone. Sequence analysis revealed at least 1 putative transcriptional regulator, excluding 1 clone (CHLO8F. Deletion analysis identified compound-specific transcriptional regulators; namely, 8 LysR-types, 2 two-component-types and 1 AraC-type. Of these, 9 representative clones were selected and their reaction specificities to 18 aromatic compounds were investigated. Overall, our transcriptional regulators were functionally diverse in terms of both specificity and induction rates. LysR- and AraC- type regulators had relatively narrow specificities with high induction rates (5-50 fold, whereas two-component-types had wide specificities with low induction rates (3 fold. Numerous transcriptional regulators have been deposited in sequence databases, but their functions remain largely unknown. Thus, our results add valuable information regarding the sequence-function relationship of transcriptional regulators.
Financial Capability:New Evidence for Ireland
Keeney, Mary J.; O’Donnell, Nuala
2009-01-01
Recent increases in financial innovation, particularly in the Anglo-Saxon banking culture, have seen a considerable growth in the amount of financial products available to the general public. Simultaneously, many workers are increasingly assuming responsibility for planning for their future pensions. This allied to increased life expectancy necessitates a greater degree of financial capability amongst the general public. This study has empirically examined this issue for the first time in an ...
Social policies related to parenthood and capabilities of Slovenian parents.
Mrčela, Aleksandra Kanjuo; Sadar, Nevenka Černigoj
2011-01-01
We apply Sen's capability approach to evaluate the capabilities of Slovenian parents to reconcile paid work and family in the context of the transition to a market economy. We examine how different levels of capabilities together affect the work–life balance (WLB) of employed parents. We combine both quantitative and qualitative methodological approaches. The results of our quantitative and qualitative research show that increased precariousness of employment and intensification of work create gaps between the legal and normative possibilities for successful reconciliation strategies and actual use of such arrangements in Slovenia. The existing social policies and the acceptance of gender equality in the sphere of paid work enhance capabilities for reconciliation of paid work and parenthood, whereas the intensification of working lives, the dominance of paid work over other parts of life, and the acceptance of gender inequalities in parental and household responsibilities limit parents’ capabilities to achieve WLB.
Dynamic capabilities and innovation capabilities: The case of the ‘Innovation Clinic’
Directory of Open Access Journals (Sweden)
Fred Strønen
2017-01-01
Full Text Available In this explorative study, we investigate the relationship between dynamic capabilities and innovation capabilities. Dynamic capabilities are at the core of strategic management in terms of how firms can ensure adaptation to changing environments over time. Our paper follows two paths of argumentation. First, we review and discuss some major contributions to the theories on ordinary capabilities, dynamic capabilities, and innovation capabilities. We seek to identify different understandings of the concepts in question, in order to clarify the distinctions and relationships between dynamic capabilities and innovation capabilities. Second, we present a case study of the ’Innovation Clinic’ at a major university hospital, including four innovation projects. We use this case study to explore and discuss how dynamic capabilities can be extended, as well as to what extent innovation capabilities can be said to be dynamic. In our conclusion, we discuss the conditions for nurturing ‘dynamic innovation capabilities’ in organizations.
Robeyns, Ingrid
2012-01-01
textabstractThe capability approach is one of the most recent additions to the landscape of normative theories in ethics and political philosophy. Yet in its present stage of development, the capability approach is not a full-blown normative theory, in contrast to utilitarianism, deontological theories, virtue ethics, or pragmatism. As I will argue in this chapter, at present the core of the capability approach is an account of value, which together with some other (more minor) normative comm...
Dubowy, Ronald; Graham, Michael; Hakami, Nasrollah; Kletzel, Morris; Mahoney, Donald; Newman, Edward; Ravindranath, Yaddanapudi; Camitta, Bruce
2008-01-01
At concentrations >0.1 mM, Hydroxyurea (HU) enhances the accumulation of cytosine arabinoside (ara-C) in leukemia cells in vitro. This study of children with refractory acute leukemia was designed to take advantage of this biochemical modulation. A fixed dose of HU and an escalating dose of ara-C were used. Oral HU, 1200 mg/m2 was followed 2 hours later by ara-C, 250-3100 mg/m2 intravenously in 15 minutes. The combination was given on days 1,2,3 and 8,9,10. Thirty-three children (26 ALL, 7 AN...
RETRAN's role in the development of Northeast Utilities' analytical capabilities
International Nuclear Information System (INIS)
Bonaca, M.V.; Gharakhani, A.; Sterner, R.W.
1983-01-01
The RETRAN code plays an important role in Northeast Utilities' (NUSCO's) safety analysis capabilities. Its ability to predict plant response to operational transients has been shown by several benchmarking efforts. Additionally, it has been utilized in performing both design-basis and bestestimate analyses for NUSCO's operating plants. The decision to use RETRAN as a major contributor to reload analysis efforts at NUSCO was justified by the results of numerous analyses proving RETRAN's capabilities and credibility
DEFF Research Database (Denmark)
Mogensen, Martin; Frey, Davide; Guerraoui, Rachid
Gossip-based protocols are now acknowledged as a sound basis to implement collaborative high-bandwidth content dissemination: content location is disseminated through gossip, the actual contents being subsequently pulled. In this paper, we present HEAP, HEterogeneity Aware gossip Protocol, where...... nodes dynamically adjust their contribution to gossip dissemination according to their capabilities. Using a continuous, itself gossip-based, approximation of relative capabilities, HEAP dynamically leverages the most capable nodes by (a) increasing their fanouts (while decreasing by the same proportion...... declare a high capability in order to augment their perceived quality without contributing accordingly. We evaluate HEAP in the context of a video streaming application on a 236 PlanetLab nodes testbed. Our results shows that HEAP improves the quality of the streaming by 25% over a standard gossip...
Energy Technology Data Exchange (ETDEWEB)
Knox, J.B.; MacCracken, M.C.; Dickerson, M.H.; Gresho, P.M.; Luther, F.M.
1986-08-01
This annual report for the Atmospheric and Geophysical Sciences Division (G-Division) summarizes the activities and highlights of the past three years, with emphasis on significant research findings in two major program areas: the Atmospheric Release Advisory Capability (ARAC), with its recent involvement in assessing the effects of the Chernobyl reactor accident, and new findings on the environmental consequences of nuclear war. The technical highlights of the many other research projects are also briefly reported, along with the Division's organization, budget, and publications.
77 FR 27538 - Aviation Rulemaking Advisory Committee-Continuing a Task
2012-05-10
... Committee--Continuing a Task AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of continuing a task assignment for the Aviation Rulemaking Advisory Committee (ARAC). SUMMARY: The FAA assigned the Aviation Rulemaking Advisory Committee (ARAC) a continuing task to provide advice and...
Exploring leadership capability and emotional intelligence as moderators of workplace bullying.
Hutchinson, Marie; Hurley, John
2013-04-01
This study aimed to explore the potential for emotionally intelligent leadership as a way to mitigate bullying behaviour within nursing workplace environments. As the body of evidence about bullying continues to grow there is an increasing need for researchers to direct their attention to developing theoretical frameworks that explain how bullying and victimization occur, and the types of strategies that may address the problem. The narrative synthesis of the literature presented in this paper is forwarded as supporting the need for strengthening leadership capability, especially those capabilities associated with emotional intelligence, as a means of diminishing experienced bullying within nursing. Stemming from our expanding understandings about bullying is an appreciation of the range of factors within organizations that influence the occurrence of bullying, and an awareness of the need to understand the expression, experience and management of emotions in the workplace. While both leadership and emotional intelligence capabilities offer real potential to mitigate bullying behaviour, disparity exits between clinical and managerial nurses toward preferred leadership styles and emotional intelligence is open to challenges towards its content validity. Nursing management is challenged to build upon procedural responses to bullying to include a ground up approach to leadership enhancement capability, better responses to emotions in the workplace and supporting the interpersonal and intrapersonal capabilities of the nursing workforce. © 2012 Blackwell Publishing Ltd.
Meteorological considerations in emergency response capability at nuclear power plant
International Nuclear Information System (INIS)
Fairobent, J.E.
1985-01-01
Meteorological considerations in emergency response at nuclear power plants are discussed through examination of current regulations and guidance documents, including discussion of the rationale for current regulatory requirements related to meteorological information for emergency response. Areas discussed include: major meteorological features important to emergency response; onsite meteorological measurements programs, including redundant and backup measurements; access to offsite sources of meteorological information; consideration of real-time and forecast conditions and atmospheric dispersion modeling
Directory of Open Access Journals (Sweden)
Emily C Moorefield
Full Text Available Amniotic fluid stem (AFS cells are broadly multipotent, can be expanded extensively in culture, are not tumorigenic and can be readily cryopreserved for cell banking. Mesenchymal stem cells (MSC show immunomodulatory activity and secrete a wide spectrum of cytokines and chemokines that suppress inflammatory responses, block mixed lymphocyte reactions (MLR and other immune reactions, and have proven therapeutic against conditions such as graft-versus-host disease. AFS cells resemble MSCs in many respects including surface marker expression and differentiation potential. We therefore hypothesized that AFS cells may exhibit similar immunomodulatory capabilities. We present data to demonstrate that direct contact with AFS cells inhibits lymphocyte activation. In addition, we show that cell-free supernatants derived from AFS cells primed with total blood monocytes or IL-1β, a cytokine released by monocytes and essential in mediation of the inflammatory response, also inhibited lymphocyte activation. Further investigation of AFS cell-free supernatants by protein array revealed secretion of multiple factors in common with MSCs that are known to be involved in immune regulation including growth related oncogene (GRO and monocyte chemotactic protein (MCP family members as well as interleukin-6 (IL-6. AFS cells activated by PBMCs released several additional cytokines as compared to BM-MSCs, including macrophage inflammatory protein-3α (MIP-3α, MIP-1α and Activin. AFS cells also released higher levels of MCP-1 and lower levels of MCP-2 compared to BM-MSCs in response to IL-1β activation. This suggests that there may be some AFS-specific mechanisms of inhibition of lymphocyte activation. Our results indicate that AFS cells are able to suppress inflammatory responses in vitro and that soluble factors are an essential component in the communication between lymphocytes and AFS cells. Their extensive self-renewal capacity, possibility for banking and
Assessing Organizational Capability of a Voluntary Organization that ...
African Journals Online (AJOL)
These organizations attached their involvement in CCB as part of their corporate social responsibility-CSR contributions to the society. These NGOs serve as capacity building providers. The major concern is that these NGOs do not have a framework in place to assess their own organizational capability in relations to the ...
Rights, goals, and capabilities
van Hees, M.V.B.P.M
This article analyses the relationship between rights and capabilities in order to get a better grasp of the kind of consequentialism that the capability theory represents. Capability rights have been defined as rights that have a capability as their object (rights to capabilities). Such a
Early blindness and coma during intrathecal chemotherapy for meningeal carcinomatosis.
Boogerd, W; Moffie, D; Smets, L A
1990-02-01
A 35-year-old woman was treated with intraventricular methotrexate (MTX) with a total dose of 70 mg followed by cytosine arabinoside (Ara-C) with a total dose of 80 mg for meningeal metastasis of breast carcinoma. Radiation therapy was not given. Despite a response of the meningeal tumor the patient developed in the third week of MTX treatment a progressive visual loss and loss of consciousness which worsened during subsequent Ara-C treatment and led to death within 3 weeks. Postmortem examination revealed only minimal neoplastic infiltration of the meninges. Multiple foci of axonal degeneration and demyelination were found in the optic nerves and chiasm, the superficial layers of the brainstem, and spinal cord and to some extent in other cranial nerves and spinal nerve roots. The possible causes of this previously unreported early complication are discussed.
2013-11-12
... feature. These proposed special conditions contain the additional safety standards that the Administrator... these conditions would be considered as ultimate loads, with an additional safety factor applied to the... ARAC Loads and Dynamics Harmonization Working Group. The proposed special condition reflects the ARAC...
Directory of Open Access Journals (Sweden)
Nham Phong Tuan
2010-01-01
Full Text Available This paper focuses on applying the resource-based view (RBV of firms to explain performance in supporting industries in Vietnam. Specifically, we based our research on the comprehensive framework of RBV and reviewed previous empirical researches before deciding on adopting a dynamic capabilities approach to test relationships among organisational capabilities, competitive advantage and performance. A multivariate analysis of survey responses of 102 firms belonging to supporting industries in Vietnam indicates that the organisational capabilities are related to the competitive advantage, that the competitive advantage is related to performance, and that the competitive advantage mediates the relationship between organizational capabilities and performance. These findings have considerable implications for academics as well as practitioners. Finally, this study also provides directions for future research.
I.A.M. Robeyns (Ingrid)
2012-01-01
textabstractThe capability approach is one of the most recent additions to the landscape of normative theories in ethics and political philosophy. Yet in its present stage of development, the capability approach is not a full-blown normative theory, in contrast to utilitarianism, deontological
Detection capabilities. Some historical footnotes
International Nuclear Information System (INIS)
Currie, L.A.
2017-01-01
Part I Summary of relevant topics from 1923 to present-including: Currie (Anal Chem 40:586-593, 1968) detection concepts and capabilities; International detection and uncertainty standards; Failure of classical "1"4C dating and birth of new scientific disciplines; Exploratory nuclear data analysis of "8"5Kr monitors found coincident with the collapse of the Iron Curtain (1989); Faulty statistics proved responsible for mistaken assertions that Currie's LC yields excessive false positives; Low-level counting and AMS for atmospheric "3"7Ar and µmolar fossil/biomass carbon in the environment; Erroneous assumption that our low-level background is a Poisson Process, linked to ∼8 % spurious anticoincidence events. Part II. Exact treatment of bivariate Poisson data-solved in 1930s by Przyborowski and Wilenski, Krakow University, for detecting extreme trace amounts of a malicious contaminant (dodder) in high purity seed standards. We adapted their treatment to detection capabilities in ultra-low-level nuclear counting. The timing of their work had great historical significance, marking the start of World War II, with the invasion of Poland (1939). (author)
DEFF Research Database (Denmark)
Grünbaum, Niels Nolsøe; Stenger, Marianne
2013-01-01
The findings reveal a positive relationship between dynamic capabilities and innovation performance in the case enterprises, as we would expect. It was, however, not possible to establish a positive relationship between innovation performance and profitability. Nor was there any positive...... relationship between dynamic capabilities and profitability....
76 FR 81009 - Aviation Rulemaking Advisory Committee-New Task
2011-12-27
... Committee--New Task AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of new task... Rulemaking Advisory Committee (ARAC) a new task to develop a comprehensive program of voluntary accreditation... maintenance program (CAMP). This task addresses, in part, the ARAC recommendation developed by the Commercial...
DEFF Research Database (Denmark)
Krogh-Madsen, Mikkel; Hansen, Steen Honore'; Jensen, Morten Krogh
2013-01-01
Objective To investigate the uracil arabinoside/cytarabine (Ara-U/Ara-C) ratios with the lower dose in adult acute myeloid leukaemia (AML) induction therapy (100 mg/m2 Ara-C) where no enzyme saturation is expected. Methods A precise and robust high-performance liquid chromatography (HPLC) method...... for simultaneous determination of Ara-C and its main inactive metabolite Ara-U in human plasma was developed and validated. Nineteen patients with acute myeloid leukaemia were treated with Ara-C in a dose of 100 mg/m2 together with daunorubicin and etoposide. Plasma concentrations were used to construct...
Capabilities and Incapabilities of the Capabilities Approach to Health Justice.
Selgelid, Michael J
2016-01-01
This first part of this article critiques Sridhar Venkatapuram's conception of health as a capability. It argues that Venkatapuram relies on the problematic concept of dignity, implies that those who are unhealthy lack lives worthy of dignity (which seems politically incorrect), sets a low bar for health, appeals to metaphysically problematic thresholds, fails to draw clear connections between appealed-to capabilities and health, and downplays the importance/relevance of health functioning. It concludes by questioning whether justice entitlements should pertain to the capability for health versus health achievements, challenging Venkatapuram's claims about the strength of health entitlements, and demonstrating that the capabilities approach is unnecessary to address social determinants of health. © 2016 John Wiley & Sons Ltd.
Vulnerability, Health Agency and Capability to Health.
Straehle, Christine
2016-01-01
One of the defining features of the capability approach (CA) to health, as developed in Venkatapuram's book Health Justice, is its aim to enable individual health agency. Furthermore, the CA to health hopes to provide a strong guideline for assessing the health-enabling content of social and political conditions. In this article, I employ the recent literature on the liberal concept of vulnerability to assess the CA. I distinguish two kinds of vulnerability. Considering circumstantial vulnerability, I argue that liberal accounts of vulnerability concerned with individual autonomy, align with the CA to health. Individuals should, as far as possible, be able to make health-enabling decisions about their lives, and their capability to do so should certainly not be hindered by public policy. The CA to health and a vulnerability-based analysis then work alongside to define moral responsibilities and designate those who hold them. Both approaches demand social policy to address circumstances that hinder individuals from taking health-enabling decisions. A background condition of vulnerability, on the other hand, even though it hampers the capability for health, does not warrant the strong moral claim proposed by the CA to health to define health as a meta-capability that should guide social policy. Nothing in our designing social policy could change the challenge to health agency when we deal with background conditions of vulnerability. © 2016 John Wiley & Sons Ltd.
Capabilities for Strategic Adaptation
DEFF Research Database (Denmark)
Distel, Andreas Philipp
This dissertation explores capabilities that enable firms to strategically adapt to environmental changes and preserve competitiveness over time – often referred to as dynamic capabilities. While dynamic capabilities being a popular research domain, too little is known about what these capabiliti...
Kinsella, A. R.; Smith, D.; Pickard, M.
1997-01-01
The inherent or acquired (induced) resistance of certain tumours to cytotoxic drug therapy is a major clinical problem. There are many categories of cytotoxic agent: the antimetabolites, e.g. methotrexate (MTX), N-phosphonacetyl-L-aspartate (PALA), 5-fluorouracil (5-FU), 6-mercaptopurine (6-TG), hydroxyurea (HU) and 1-beta-D-arabinofuranosylcytosine (AraC); the alkylating agents, e.g. the nitrogen mustards and nitrosoureas; the antibiotics, e.g. doxorubicin and mitomycin C; the plant alkaloid...
New capabilities of the lattice code WIMS-AECL
International Nuclear Information System (INIS)
Altiparmakov, Dimitar
2008-01-01
The lattice code WIMS-AECL has been restructured and rewritten in Fortran 95 in order to increase the accuracy of its responses and extend its capabilities. Significant changes of computing algorithms have been made in the following two areas: geometric calculations and resonance self-shielding. Among various geometry enhancements, the code is no longer restricted to deal with single lattice cell problems. The multi-cell capability allows modelling of various lattice structures such as checkerboard lattices, a de-fuelled channel, and core-reflector interface problems. The new resonance method performs distributed resonance self-shielding including the skin effect. This paper describes the main code changes and presents selected code verification results. (authors)
IntelliTable: Inclusively-Designed Furniture with Robotic Capabilities.
Prescott, Tony J; Conran, Sebastian; Mitchinson, Ben; Cudd, Peter
2017-01-01
IntelliTable is a new proof-of-principle assistive technology system with robotic capabilities in the form of an elegant universal cantilever table able to move around by itself, or under user control. We describe the design and current capabilities of the table and the human-centered design methodology used in its development and initial evaluation. The IntelliTable study has delivered robotic platform programmed by a smartphone that can navigate around a typical home or care environment, avoiding obstacles, and positioning itself at the user's command. It can also be configured to navigate itself to pre-ordained places positions within an environment using ceiling tracking, responsive optical guidance and object-based sonar navigation.
NCBI nr-aa BLAST: CBRC-CREM-01-1091 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1091 ref|YP_796667.1| Transcriptional regulator, AraC family [Leptospira borgpeter...senii serovar Hardjo-bovis L550] gb|ABJ77734.1| Transcriptional regulator, AraC family [Leptospira borgpetersenii serovar Hardjo-bovis L550] YP_796667.1 0.024 18% ...
78 FR 15110 - Aviation Rulemaking Advisory Committee; Engine Bird Ingestion Requirements-New Task
2013-03-08
... Committee; Engine Bird Ingestion Requirements--New Task AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of new task assignment for the Aviation Rulemaking Advisory Committee (ARAC). SUMMARY: The FAA assigned ARAC a new task to review and assess the adequacy of certain portions of the existing...
78 FR 34139 - Aviation Rulemaking Advisory Committee; Meeting
2013-06-06
... Advisory Committee (ARAC) meeting. SUMMARY: The FAA is issuing this notice to advise the public of a... Standard Time. Arrange oral presentations by June 13, 2013. ADDRESSES: The meeting will take place at the... Group (ARAC) b. Flight Controls Harmonization Working Group (Transport Airplane and Engine Subcommittee...
Huang, Shar-yin N.; Murai, Junko; Dalla Rosa, Ilaria; Dexheimer, Thomas S.; Naumova, Alena; Gmeiner, William H.; Pommier, Yves
2013-01-01
Chain-terminating nucleoside analogs (CTNAs) that cause stalling or premature termination of DNA replication forks are widely used as anticancer and antiviral drugs. However, it is not well understood how cells repair the DNA damage induced by these drugs. Here, we reveal the importance of tyrosyl–DNA phosphodiesterase 1 (TDP1) in the repair of nuclear and mitochondrial DNA damage induced by CTNAs. On investigating the effects of four CTNAs—acyclovir (ACV), cytarabine (Ara-C), zidovudine (AZT) and zalcitabine (ddC)—we show that TDP1 is capable of removing the covalently linked corresponding CTNAs from DNA 3′-ends. We also show that Tdp1−/− cells are hypersensitive and accumulate more DNA damage when treated with ACV and Ara-C, implicating TDP1 in repairing CTNA-induced DNA damage. As AZT and ddC are known to cause mitochondrial dysfunction, we examined whether TDP1 repairs the mitochondrial DNA damage they induced. We find that AZT and ddC treatment leads to greater depletion of mitochondrial DNA in Tdp1−/− cells. Thus, TDP1 seems to be critical for repairing nuclear and mitochondrial DNA damage caused by CTNAs. PMID:23775789
National Atmospheric Release Advisory Center (NARAC) Capabilities for Homeland Security
Energy Technology Data Exchange (ETDEWEB)
Sugiyama, G; Nasstrom, J; Baskett, R; Simpson, M
2010-03-08
The Department of Energy's National Atmospheric Release Advisory Center (NARAC) provides critical information during hazardous airborne releases as part of an integrated national preparedness and response strategy. Located at Lawrence Livermore National Laboratory, NARAC provides 24/7 tools and expert services to map the spread of hazardous material accidentally or intentionally released into the atmosphere. NARAC graphical products show affected areas and populations, potential casualties, and health effect or protective action guideline levels. LLNL experts produce quality-assured analyses based on field data to assist decision makers and responders. NARAC staff and collaborators conduct research and development into new science, tools, capabilities, and technologies in strategically important areas related to airborne transport and fate modeling and emergency response. This paper provides a brief overview of some of NARAC's activities, capabilities, and research and development.
Cooper, Barry; Holmes, Houston; Vance, Estil; Berryman, Robert Brian; Maisel, Christopher; Li, Sandy; Saracino, Giovanna; Tadic-Ovcina, Mirjana; Fay, Joseph
2011-01-01
Purpose. To determine the efficacy and safety of clofarabine and cytarabine (Ara-C) in adult patients with relapsed or refractory acute myeloid leukemia (AML) and in elderly patients with untreated AML and heart disease. Patients and Methods. Patients with relapsed/refractory AML and older patients for whom there was a concern over toxicity from additional anthracyclines received 5 days of clofarabine, 40 mg/m2 per day i.v. over 1 hour, followed 4 hours later by Ara-C, 1,000 mg/m2 per day i.v. over 2 hours. Results. Thirty patients were enrolled. The median age was 67 years (range, 38–82 years) and 18 (60%) had received at least one prior therapy. Eleven (37%) patients had a history of cardiovascular disease and were considered to be at high risk for anthracycline toxicity. High-risk cytogenetic abnormalities were present in 14 (47%) patients. The overall response rate (complete remission [CR] plus partial remission) was 53%, including a CR in 14 patients (47%). Responses were observed in all cytogenetic risk groups and in patients who had received up to five prior therapies. The median disease-free survival interval was 9.5 months. The 30-day mortality rate was 20% (de novo AML, 8%; relapsed/refractory AML, 28%). Of the 14 patients achieving a CR, half were able to proceed to curative hematopoietic stem cell transplantation. Conclusions. Clofarabine in combination with Ara-C is effective in both untreated and previously treated patients with AML. In addition, it represents a useful remission induction strategy to serve as a bridge to transplantation in older patients with AML. PMID:21273514
Directory of Open Access Journals (Sweden)
Angela MUSCHITIELLO
2016-06-01
Full Text Available The present essay, moving from a definition of the concept of capabilities in terms of attitudes to ‘make possible’—i.e., inner abilities of every person which, if adequately exploited, permit to operate in a free and responsible way within the society or the institution where he or she lives—aims at highlighting its strong pedagogical value. The definition of capabilities, though developed in economic contexts, exhibits pedagogical foundations inasmuch it emphasizes the centrality of the person as an actor free in his or her choices and thus responsible for his or her destiny. The topics dealt with in the paper are the produce of several studies and researches; they are relevant for a large audience: experts of education, managers, teachers, but also students willing to consciously pass through their educational, formative and professional assignments.
UK regulatory expectations for the development of licensee organisational capability
International Nuclear Information System (INIS)
Gibson, S.; Reiersen, Craig
2011-01-01
The Nuclear Installations Inspectorate (NII) is responsible for the licensing and regulatory oversight of new nuclear power reactors in the UK. NII recognises that effective licensee leadership and management for safety are instrumental in the safety of new and existing nuclear installations. NII is consequently placing considerable emphasis on seeking assurance that prospective licensees develop an adequate organisational capability to manage and deliver nuclear safety in addition to constructing a design that has passed through a rigorous assessment process. In order to make NII's expectations clear, and support a consistent approach to interactions with prospective licensees, NII has produced a suite of related guidance to help its Inspectors assess and influence the development of licensee organisational capability. This includes: 1. The safety management prospectus; 2. The 'nuclear baseline'; 3. Intelligent Customer capability and use of contractors; 4. Design Authority; 5. Licence Condition Compliance Arrangements; 6. Development of Organisational Capability
KORFAL, Ahu
2016-01-01
Araştırmanın temel amacı, algılanan ekonomik güçlük ve eşler arasındaki çatışma ile ergen problem davranışları arasındaki bağlantıda ebeveyn-ergen ilişkilerinin aracı rolünü incelemektir. Bu amaç çerçevesinde, anılan ilişkiler kız ve erkek ergenlerde Aile Stres Modeli çerçevesinde sınanmıştır. Araştırmanın örneklemini Ankara kent merkezinde bulunan ilköğretim 6. ve 7. Sınıflar ile ortaöğretim 9. ve 10. Sınıflara devam eden ergenler oluşturmaktadır. Çalışmamıza, 518 (%48.5...
Capability-based computer systems
Levy, Henry M
2014-01-01
Capability-Based Computer Systems focuses on computer programs and their capabilities. The text first elaborates capability- and object-based system concepts, including capability-based systems, object-based approach, and summary. The book then describes early descriptor architectures and explains the Burroughs B5000, Rice University Computer, and Basic Language Machine. The text also focuses on early capability architectures. Dennis and Van Horn's Supervisor; CAL-TSS System; MIT PDP-1 Timesharing System; and Chicago Magic Number Machine are discussed. The book then describes Plessey System 25
Federal Laboratory Consortium — The Electrical Power Mobile Test capabilities are utilized to conduct electrical power quality testing on aircraft and helicopters. This capability allows that the...
The Renovation and Future Capabilities of the Thacher Observatory
O'Neill, Katie; Osuna, Natalie; Edwards, Nick; Klink, Douglas; Swift, Jonathan; Vyhnal, Chris; Meyer, Kurt
2016-01-01
The Thacher School is in the process of renovating the campus observatory with a new meter class telescope and full automation capabilities for the purpose of scientific research and education. New equipment on site has provided a preliminary site characterization including seeing and V-band sky brightness measurements. These data, along with commissioning data from the MINERVA project (which uses comparable hardware) are used to estimate the capabilities of the observatory once renovation is complete. Our V-band limiting magnitude is expected to be better than 21.3 for a one minute integration time, and we estimate that milli-magnitude precision photometry will be possible for a V=14.5 point source over approximately 5 min timescales. The quick response, autonomous operation, and multi-band photometric capabilities of the renovated observatory will make it a powerful follow-up science facility for exoplanets, eclipsing binaries, near-Earth objects, stellar variability, and supernovae.
Business Systems Branch Abilities, Capabilities, and Services Web Page
Cortes-Pena, Aida Yoguely
2009-01-01
During the INSPIRE summer internship I acted as the Business Systems Branch Capability Owner for the Kennedy Web-based Initiative for Communicating Capabilities System (KWICC), with the responsibility of creating a portal that describes the services provided by this Branch. This project will help others achieve a clear view ofthe services that the Business System Branch provides to NASA and the Kennedy Space Center. After collecting the data through the interviews with subject matter experts and the literature in Business World and other web sites I identified discrepancies, made the necessary corrections to the sites and placed the information from the report into the KWICC web page.
Building Service Provider Capabilities
DEFF Research Database (Denmark)
Brandl, Kristin; Jaura, Manya; Ørberg Jensen, Peter D.
2015-01-01
In this paper we study whether and how the interaction between clients and the service providers contributes to the development of capabilities in service provider firms. In situations where such a contribution occurs, we analyze how different types of activities in the production process...... process. We find that clients influence the development of human capital capabilities and management capabilities in reciprocally produced services. While in sequential produced services clients influence the development of organizational capital capabilities and management capital capabilities....... of the services, such as sequential or reciprocal task activities, influence the development of different types of capabilities. We study five cases of offshore-outsourced knowledge-intensive business services that are distinguished according to their reciprocal or sequential task activities in their production...
Researching pharmacist managerial capability: philosophical perspectives and paradigms of inquiry.
Woods, Phillip; Gapp, Rod; King, Michelle A
2015-01-01
In successful community pharmacy business enterprises suitably responsive actions to meet ever-increasing change require capable pharmacy managers who readily learn and adapt. Capability as a concept is generally understood to be the ability of a manager to identify and act to solve unfamiliar problems in unfamiliar situations. Capability is characterized by adaptability and flexibility. However, different understandings of the concept 'capability' and what it means to be 'capable' are indirect and incomplete. This paper aims to clarify current theories regarding the concept of 'capability' at the level of the individual, and through this to make more explicit what is known about the phenomenon, but more particularly, how we know what we know. The analysis includes the concept of 'competence' because explanations of capability include competence, and the two concepts are not clearly separated in the literature. By probing the epistemological origins of current theory concerning both concepts, the limiting taken for granted assumptions are revealed. Assumptions about context and time, and the psychological theory through which individuals are assumed to perceive, know and learn, are illuminated. The analysis, in connection with the literature, shows how the interpretive philosophic research approach may reveal a different and useful theoretical perspective for explaining capability as a dynamic performance. It is suggested that such a perspective may narrow the gap between the theory of capability and its practice. The interpretive perspective holds potential to reveal how capability, as performed by successful community pharmacy managers, might be further researched and strengthened. This paper supports the challenging suggestion that pharmacy social research needs to rebalance the dominance of purely empirical research by exploring interpretive methodologies to better understand human actions and relations in the context of pharmacy. Crown Copyright © 2015
SRNL EMERGENCY RESPONSE CAPABILITY FOR ATMOSPHERIC CONTAMINANT RELEASES
International Nuclear Information System (INIS)
Koffman, L; Chuck Hunter, C; Robert Buckley, R; Robert Addis, R
2006-01-01
Emergency response to an atmospheric release of chemical or radiological contamination is enhanced when plume predictions, field measurements, and real-time weather information are integrated into a geospatial framework. The Weather Information and Display (WIND) System at Savannah River National Laboratory (SRNL) utilizes such an integrated framework. The rapid availability of predictions from a suite of atmospheric transport models within this geospatial framework has proven to be of great value to decision makers during an emergency involving an atmospheric contaminant release
FMEF/experimental capabilities
International Nuclear Information System (INIS)
Burgess, C.A.; Dronen, V.R.
1981-01-01
The Fuels and Materials Examination Facility (FMEF), under construction at the Hanford site north of Richland, Washington, will be one of the most modern facilities offering irradiated fuels and materials examination capabilities and fuel fabrication development technologies. Scheduled for completion in 1984, the FMEF will provide examination capability for fuel assemblies, fuel pins and test pins irradiated in the FFTF. Various functions of the FMEF are described, with emphasis on experimental data-gathering capabilities in the facility's Nondestructive and Destructive examination cell complex
Improving emergency preparedness and crisis management capabilities in transportation : year 2.
2013-03-01
While disaster preparedness and emergency management have had a high public : profile over the past decade, Hurricane Katrina revealed serious weaknesses in the : United States emergency response capabilities. There is thus much left to do : befor...
Cassini data assessment report
International Nuclear Information System (INIS)
1998-08-01
On October 15, 1997, the Cassini spacecraft was launched from Cape Canaveral Air Station (CCAS) and is now on its way to the planet Saturn. The functional support provided to NASA by DOE included the Advance Launch Support Group (ALSG). If there had been a launch anomaly, the ALSG would have provided a level of radiological emergency response support adequate to transition into a Federal Radiological Monitoring and Assessment Center (FRMAC). Additional functional radiological emergency response support, as part of the ALSG, included the: (1) Aerial Measurement System (AMS); (2) Atmospheric Release Advisory Capability (ARAC); (3) Geographic Information System (GIS); (4) Emergency Response Data System (ERDS); (5) Radiation Emergency Assistance Center and Training Site (REAC/TS); (6) Field monitoring and sampling; (7) Radioanalysis via RASCAL; (8) Source recovery; and (9) Neutron dosimetry and communications support. This functional support provided the capability to rapidly measure and assess radiological impacts from a launch anomaly. The Radiological Control Officer (RCO) on KSC established a Radiological Control Center (RADCC) as the focal point for all on-site and off-site radiological data and information flow. Scientists and radiological response personnel located at the RADCC managed the field monitoring team on the KSC/CCAS federal properties. Off-site radiological emergency response activities for all public lands surrounding the KSC/CCAS complex were coordinated through the Off-site ALSG located at the National Guard Armory in Cocoa, Florida. All of the in situ measurement data of good quality gathered during the dry run, the first launch attempt and the launch day are listed in this document. The RASCAL analysis results of the air filters and impactor planchets are listed
Wang, D F; Zhou, L L; Zhou, H L; Hou, G Y; Zhou, X; Li, W
2017-02-01
The biological properties of Piper sarmentosum render it a potential substitute for antibiotics in livestock feed. This study evaluated the effects of P. sarmentosum extract (PSE) on the growth performance, antioxidant capability and immune response of weaned piglets. Eighty 21-d-old weaned piglets were selected and randomly allocated to one of four dietary treatments with five replicates of four pigs each. The dietary treatments consisted of a basal diet supplemented with 0 (T0), 50 (T50), 100 (T100) or 200 (T200) mg/kg PSE. The feeding trial lasted 4 weeks. The results revealed that the T50 group had the highest average daily gain (ADG) and average daily feed intake (ADFI) throughout the feeding trial (p < 0.05). Additionally, the T50 group had higher (p < 0.05) serum glutathione peroxidase activity (GSH-Px) and lower (p < 0.05) serum malondialdehyde (MDA) levels than the T0 group at 4 weeks post-weaning (p < 0.05). Serum levels of interleukin-1β (IL-1β) and tumour necrosis factor-α (TNF-α) decreased, while serum levels of interleukin-4 (IL-4), interleukin-10 (IL-10) and transforming growth factor-β (TGF-β) increased by PSE supplementation at 4 weeks post-weaning (p < 0.05). PSE supplementation upregulated the mRNA expression of IL-4, IL-10 and TGF-β and downregulated the mRNA expression of TNF-α, IL-1β and interleukin-6 (IL-6) in the ileal mucosal layer of piglets (p < 0.05). In summary, our study findings revealed that PSE supplementation improved the antioxidant capability, and reduced inflammation, which may be beneficial to weaned piglet health. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.
OKULÖNCESİ EĞİTİMİNDE HIGH/SCOPE PROGRAM KALİTE BELİRLEMESİ (PKB)
FETİHİ, Leyla
2013-01-01
Bu çalışmanın amacı,High/Scope Program Kalite Belirlemesi (PKB)- okulöncesi versivonu adlı aracı Türkçeye kazandırmak ve PKB aracını kullanarak çeşitli okulöncesi eğitim kurumlarında uygulamalar yapmaktır.
Developing Alliance Capabilities
DEFF Research Database (Denmark)
Heimeriks, Koen H.; Duysters, Geert; Vanhaverbeke, Wim
This paper assesses the differential performance effects of learning mechanisms on the development of alliance capabilities. Prior research has suggested that different capability levels could be identified in which specific intra-firm learning mechanisms are used to enhance a firm's alliance...
Energy Technology Data Exchange (ETDEWEB)
Sullivan, T.J.; Ellis, J.S. [Lawrence Livermore National Lab., CA (United States); Schalk, W.W.; Nasstrom, J.S. [EG and G, Inc., Pleasanton, CA (United States)
1992-06-25
During the recent (12--22 June 1991) Mount Pinatubo volcano eruptions, the US Air Force Global Weather Central (AFGWC) requested assistance of the US Department of Energy`s Atmospheric Release Advisory Capability (ARAC) in creating volcanic ash cloud aviation advisories for the region of the Philippine Islands. Through application of its three-dimensional material transport and diffusion models using AFGWC meteorological analysis and forecast wind fields ARAC developed extensive analysis and 12-hourly forecast ash cloud position advisories extending to 48 hours for a period of five days. The advisories consisted of ``relative`` ash cloud concentrations in ten layers (surface-5,000 feet, 5,000--10,000 feet and every 10,000 feet to 90,000 feet). The ash was represented as a log-normal size distribution of 10--200 {mu}m diameter solid particles. Size-dependent ``ashfall`` was simulated over time as the eruption clouds dispersed. Except for an internal experimental attempt to model one of the Mount Redoubt, Alaska, eruptions (12/89), ARAC had no prior experience in modeling volcanic eruption ash hazards. For the cataclysmic eruption of 15--16 June, the complex three-dimensional atmospheric structure of the region produced dramatically divergent ash cloud patterns. The large eruptions (> 7--10 km) produced ash plume clouds with strong westward transport over the South China Sea, Southeast Asia, India and beyond. The low-level eruptions (< 7 km) and quasi-steady-state venting produced a plume which generally dispersed to the north and east throughout the support period. Modeling the sequence of eruptions presented a unique challenge. Although the initial approach proved viable, further refinement is necessary and possible. A distinct need exists to quantify eruptions consistently such that ``relative`` ash concentrations relate to specific aviation hazard categories.
Organizational Context and Capabilities for Integrating Care: A Framework for Improvement
Directory of Open Access Journals (Sweden)
Jenna M. Evans
2016-08-01
Full Text Available Background: Interventions aimed at integrating care have become widespread in healthcare; however, there is significant variability in their success. Differences in organizational contexts and associated capabilities may be responsible for some of this variability. Purpose: This study develops and validates a conceptual framework of organizational capabilities for integrating care, identifies which of these capabilities may be most important, and explores the mechanisms by which they influence integrated care efforts. Methods: The Context and Capabilities for Integrating Care (CCIC Framework was developed through a literature review, and revised and validated through interviews with leaders and care providers engaged in integrated care networks in Ontario, Canada. Interviews involved open-ended questions and graphic elicitation. Quantitative content analysis was used to summarize the data. Results: The CCIC Framework consists of eighteen organizational factors in three categories: Basic Structures, People and Values, and Key Processes. The three most important capabilities shaping the capacity of organizations to implement integrated care interventions include Leadership Approach, Clinician Engagement and Leadership, and Readiness for Change. The majority of hypothesized relationships among organizational capabilities involved Readiness for Change and Partnering, emphasizing the complexity, interrelatedness and importance of these two factors to integrated care efforts. Conclusions: Organizational leaders can use the framework to determine readiness to integrate care, develop targeted change management strategies, and select appropriate partners with overlapping or complementary profiles on key capabilities. Researchers may use the results to test and refine the proposed framework, with a focus on the hypothesized relationships among organizational capabilities and between organizational capabilities and performance outcomes.
Organizational Context and Capabilities for Integrating Care: A Framework for Improvement
Grudniewicz, Agnes; Baker, G. Ross; Wodchis, Walter P.
2016-01-01
Background: Interventions aimed at integrating care have become widespread in healthcare; however, there is significant variability in their success. Differences in organizational contexts and associated capabilities may be responsible for some of this variability. Purpose: This study develops and validates a conceptual framework of organizational capabilities for integrating care, identifies which of these capabilities may be most important, and explores the mechanisms by which they influence integrated care efforts. Methods: The Context and Capabilities for Integrating Care (CCIC) Framework was developed through a literature review, and revised and validated through interviews with leaders and care providers engaged in integrated care networks in Ontario, Canada. Interviews involved open-ended questions and graphic elicitation. Quantitative content analysis was used to summarize the data. Results: The CCIC Framework consists of eighteen organizational factors in three categories: Basic Structures, People and Values, and Key Processes. The three most important capabilities shaping the capacity of organizations to implement integrated care interventions include Leadership Approach, Clinician Engagement and Leadership, and Readiness for Change. The majority of hypothesized relationships among organizational capabilities involved Readiness for Change and Partnering, emphasizing the complexity, interrelatedness and importance of these two factors to integrated care efforts. Conclusions: Organizational leaders can use the framework to determine readiness to integrate care, develop targeted change management strategies, and select appropriate partners with overlapping or complementary profiles on key capabilities. Researchers may use the results to test and refine the proposed framework, with a focus on the hypothesized relationships among organizational capabilities and between organizational capabilities and performance outcomes. PMID:28413366
Sensitivity of numerical dispersion modeling to explosive source parameters
International Nuclear Information System (INIS)
Baskett, R.L.; Cederwall, R.T.
1991-01-01
The calculation of downwind concentrations from non-traditional sources, such as explosions, provides unique challenges to dispersion models. The US Department of Energy has assigned the Atmospheric Release Advisory Capability (ARAC) at the Lawrence Livermore National Laboratory (LLNL) the task of estimating the impact of accidental radiological releases to the atmosphere anywhere in the world. Our experience includes responses to over 25 incidents in the past 16 years, and about 150 exercises a year. Examples of responses to explosive accidents include the 1980 Titan 2 missile fuel explosion near Damascus, Arkansas and the hydrogen gas explosion in the 1986 Chernobyl nuclear power plant accident. Based on judgment and experience, we frequently estimate the source geometry and the amount of toxic material aerosolized as well as its particle size distribution. To expedite our real-time response, we developed some automated algorithms and default assumptions about several potential sources. It is useful to know how well these algorithms perform against real-world measurements and how sensitive our dispersion model is to the potential range of input values. In this paper we present the algorithms we use to simulate explosive events, compare these methods with limited field data measurements, and analyze their sensitivity to input parameters. 14 refs., 7 figs., 2 tabs
Bisen-Hersh, Emily B.; Hineline, Philip N.; Walker, Ellen A.
2013-01-01
Purpose Among children diagnosed with acute lymphoblastic leukemia (ALL) and given chemotherapy-only treatment, 40-70% of survivors experience neurocognitive impairment. The present study used a preclinical mouse model to investigate the effects of early exposure to common ALL chemotherapeutics methotrexate (MTX) and cytarabine (Ara-C) on learning and memory. Experimental Design Pre-weanling mouse pups were treated on postnatal day (PND) 14, 15, and 16 with saline, MTX, Ara-C, or a combination of MTX and Ara-C. Nineteen days following treatment (PND 35), behavioral tasks measuring different aspects of learning and memory were administered. Results Significant impairment in acquisition and retention over both short (1h) and long (24h) intervals, as measured by autoshaping and novel object recognition tasks, were found following treatment with MTX and Ara-C. Similarly, a novel conditional discrimination task revealed impairment in acquisition for chemotherapy-treated mice. No significant group differences were found following the extensive training component of this task, with impairment following the rapid training component occurring only for the highest MTX and Ara-C combination group. Conclusions Findings are consistent with clinical studies suggesting that childhood cancer survivors are slower at learning new information and primarily exhibit deficits in memory years after successful completion of chemotherapy treatment. The occurrence of mild deficits on a novel conditional discrimination task suggests that chemotherapy-induced cognitive impairment may be ameliorated through extensive training or practice. PMID:23596103
Bisen-Hersh, Emily B; Hineline, Philip N; Walker, Ellen A
2013-06-01
Among children diagnosed with acute lymphoblastic leukemia (ALL) and given chemotherapy-only treatment, 40% to 70% of survivors experience neurocognitive impairment. The present study used a preclinical mouse model to investigate the effects of early exposure to common ALL chemotherapeutics methotrexate (MTX) and cytarabine (Ara-C) on learning and memory. Preweanling mouse pups were treated on postnatal day (PND) 14, 15, and 16 with saline, MTX, Ara-C, or a combination of MTX and Ara-C. Nineteen days after treatment (PND 35), behavioral tasks measuring different aspects of learning and memory were administered. Significant impairment in acquisition and retention over both short (1 hour) and long (24 hours) intervals, as measured by autoshaping and novel object recognition tasks, was found following treatment with MTX and Ara-C. Similarly, a novel conditional discrimination task revealed impairment in acquisition for chemotherapy-treated mice. No significant group differences were found following the extensive training component of this task, with impairment following the rapid training component occurring only for the highest MTX and Ara-C combination group. Findings are consistent with those from clinical studies suggesting that childhood cancer survivors are slower at learning new information and primarily exhibit deficits in memory years after successful completion of chemotherapy. The occurrence of mild deficits on a novel conditional discrimination task suggests that chemotherapy-induced cognitive impairment may be ameliorated through extensive training or practice. ©2013 AACR
National Research Council Canada - National Science Library
Poulin, Steven D
2005-01-01
.... The Coast Guard faces major challenges in executing its responsibilities and must leverage the capabilities of its specially trained boarding teams, small boat security forces, and hazardous materials response teams...
Competing on capabilities: the new rules of corporate strategy.
Stalk, G; Evans, P; Shulman, L E
1992-01-01
In the 1980s, companies discovered time as a new source of competitive advantage. In the 1990s, they will discover that time is only one piece of a more far-reaching transformation in the logic of competition. Using examples from Wal-Mart and other highly successful companies, Stalk, Evans, and Shulman of the Boston Consulting Group provide managers with a guide to the new world of "capabilities-based competition." In today's dynamic business environment, strategy too must become dynamic. Competition is a "war of movement" in which success depends on anticipation of market trends and quick response to changing customer needs. In such an environment, the essence of strategy is not the structure of a company's products and markets but the dynamics of its behavior. To succeed, a company must weave its key business processes into hard-to-imitate strategic capabilities that distinguish it from its competitors in the eyes of customers. A capability is a set of business processes strategically understood--for example, Wal-Mart's expertise in inventory replenishment, Honda's skill at dealer management, or Banc One's ability to "out-local the national banks and out-national the local banks." Such capabilities are collective and cross-functional--a small part of many people's jobs, not a large part of a few. Finally, competing on capabilities requires strategic investments in support systems that span traditional SBUs and functions and go far beyond what traditional cost-benefit metrics can justify. A CEO's success in building and managing a company's capabilities will be the chief test of management skill in the 1990s. The prize: companies that combine scale and flexibility to outperform the competition.
Transforming organizational capabilities in strategizing
DEFF Research Database (Denmark)
Jørgensen, Claus; Friis, Ole Uhrskov; Koch, Christian
2014-01-01
Offshored and networked enterprises are becoming an important if not leading organizational form and this development seriously challenges their organizational capabilities. More specifically, over the last years, SMEs have commenced entering these kinds of arrangements. As the organizational...... capabilities of SMEs are limited at the outset, even more emphasis is needed regarding the issues of developing relevant organizational capabilities. This paper aims at investigating how capabilities evolve during an offshoring process of more than 5 years in two Danish SMEs, i.e. not only short- but long......-term evolvements within the companies. We develop our framework of understanding organizational capabilities drawing on dynamic capability, relational capability and strategy as practice concepts, appreciating the performative aspects of developing new routines. Our two cases are taken from one author’s Ph...
Sierra/SolidMechanics 4.48 User's Guide: Addendum for Shock Capabilities.
Energy Technology Data Exchange (ETDEWEB)
Plews, Julia A.; Crane, Nathan K; de Frias, Gabriel Jose; Le, San; Littlewood, David John; Merewether, Mark Thomas; Mosby, Matthew David; Pierson, Kendall H.; Porter, Vicki L.; Shelton, Timothy; Thomas, Jesse David; Tupek, Michael R.; Veilleux, Michael; Xavier, Patrick G.
2018-03-01
This is an addendum to the Sierra/SolidMechanics 4.48 User's Guide that documents additional capabilities available only in alternate versions of the Sierra/SolidMechanics (Sierra/SM) code. These alternate versions are enhanced to provide capabilities that are regulated under the U.S. Department of State's International Traffic in Arms Regulations (ITAR) export-control rules. The ITAR regulated codes are only distributed to entities that comply with the ITAR export-control requirements. The ITAR enhancements to Sierra/SM in- clude material models with an energy-dependent pressure response (appropriate for very large deformations and strain rates) and capabilities for blast modeling. Since this is an addendum to the standard Sierra/SM user's guide, please refer to that document first for general descriptions of code capability and use.
Energy Technology Data Exchange (ETDEWEB)
Antoccia, A. (Univ. ' La Sapienza' , Rome (Italy). Dipt. di Genetica e Biologia Molecolare); Palitti, F.; Raggi, T. (Univ. del Tuscia, Viterbo (Italy). Dipt. di Agrobiologia ed Agrochimica); Catena, C. (ENEA, Casaccia (Italy). Centro Ricerche Energia); Tanzarella, C. (Rome Univ. 3 (Italy). Dipt. di Biologia)
1994-09-01
The relationship between the repair processes occurring at the G[sub 2] phase of the cell cycle and cytogenetic damage in ataxia telangiectasia (AT) cells was studied. Lymphoblastoid cells derived from normal, heterozygote AT (HzAT) and three AT patients were exposed to X-rays or fission neutrons and post-treated with inhibitors of DNA synthesis/repair, such as inhibitors of DNA polymerases [alpha], [sigma] and [epsilon] (cytosine arabinoside, ara-C; aphidicolin, APC; buthylphenyl-guanine, BuPdG) or ribonucleotide reductase (hydroxyurea HU). A strong increase of radiation-induced chromosomal aberrations was observed in normal and HzAT cells post-treated with ara-C, APC and HU, but not in the presence of BuPdG. No enhancing effect was observed in cells derived from AT patients, except for HU post-irradiation treatment. These results suggest that the enzymes that can be inhibited by these agents are not directly involved in the repair of radiation damage induced in G[sub 2] cells from AT patients, indicating that probably the AT cells that we used lack the capability to transform the primary DNA lesions into reparable products, or that AT cells might contain a mutated form of DNA polymerase resistant to the inhibitors. (author).
A business analytics capability framework
Directory of Open Access Journals (Sweden)
Ranko Cosic
2015-09-01
Full Text Available Business analytics (BA capabilities can potentially provide value and lead to better organisational performance. This paper develops a holistic, theoretically-grounded and practically relevant business analytics capability framework (BACF that specifies, defines and ranks the capabilities that constitute an organisational BA initiative. The BACF was developed in two phases. First, an a priori conceptual framework was developed based on the Resource-Based View theory of the firm and a thematic content analysis of the BA literature. Second, the conceptual framework was further developed and refined using a three round Delphi study involving 16 BA experts. Changes from the Delphi study resulted in a refined and confirmed framework including detailed capability definitions, together with a ranking of the capabilities based on importance. The BACF will help academic researchers and industry practitioners to better understand the capabilities that constitute an organisational BA initiative and their relative importance. In future work, the capabilities in the BACF will be operationalised to measure their as-is status, thus enabling organisations to identify key areas of strength and weakness and prioritise future capability improvement efforts.
Design Mechanism as Territorial Strategic Capability
Directory of Open Access Journals (Sweden)
Gianita BLEOJU
2009-01-01
Full Text Available The current exigencies that a territory must faced in order to its’ optimalpositioning in future regional competition requires the ability to design theappropriate mechanism which better valorize the territory capability. Such aconstruct is vital for territorial sustainable development and supposes thecreation of a specific body of knowledge from distinctive local resourceexploitation and unique value creation and allocation. Territorial mechanismdesign is a typical management decision about identification, ownership andcontrol of specific strategic capabilities and their combination in a distinctiveterritorial portfolio. The most difficult responsibility is to allocate the territorialvalue added which is a source of conflict among territorial components. Ourcurrent paper research covers the basics of two complementary territorialpillars-rural and tourism potential and proves the lack of specific designmechanisms which explain the current diminishing value of Galati Brailaregion. The proposed management system, relying upon territorial controlmechanism, will ensure knowledge sharing process via collaborative learning,with the final role of appropriate territorial attractivity signals, reinforcingidentity as key factor of territorial attractability. Our paper is fully documentedon there years of data analyzing from territorial area of interest. This offers usthe necessary empiric contrasting for our proposed solution.
Henriksson, Jakob; Bermudez, Luis; Satapathy, Goutam
2013-04-01
There is a large amount of sensor data generated today by various sensors, from in-situ buoys to mobile underwater gliders. Providing sensor data to the users through standardized services, language and data model is the promise of OGC's Sensor Web Enablement (SWE) initiative. As the amount of data grows it is becoming difficult for data providers, planners and managers to ensure reliability of data and services and to monitor critical data changes. Intelligent Automation Inc. (IAI) is developing a net-centric alerting capability to address these issues. The capability is built on Sensor Observation Services (SOSs), which is used to collect and monitor sensor data. The alerts can be configured at the service level and at the sensor data level. For example it can alert for irregular data delivery events or a geo-temporal statistic of sensor data crossing a preset threshold. The capability provides multiple delivery mechanisms and protocols, including traditional techniques such as email and RSS. With this capability decision makers can monitor their assets and data streams, correct failures or be alerted about a coming phenomena.
Aircraft Capability Management
Mumaw, Randy; Feary, Mike
2018-01-01
This presentation presents an overview of work performed at NASA Ames Research Center in 2017. The work concerns the analysis of current aircraft system management displays, and the initial development of an interface for providing information about aircraft system status. The new interface proposes a shift away from current aircraft system alerting interfaces that report the status of physical components, and towards displaying the implications of degradations on mission capability. The proposed interface describes these component failures in terms of operational consequences of aircraft system degradations. The research activity was an effort to examine the utility of different representations of complex systems and operating environments to support real-time decision making of off-nominal situations. A specific focus was to develop representations that provide better integrated information to allow pilots to more easily reason about the operational consequences of the off-nominal situations. The work is also seen as a pathway to autonomy, as information is integrated and understood in a form that automated responses could be developed for the off-nominal situations in the future.
Materials Capability Review Los Alamos National Laboratory May 4-7, 2009
Energy Technology Data Exchange (ETDEWEB)
Taylor, Antoniette J [Los Alamos National Laboratory
2009-01-01
Los Alamos National Laboratory (LANL) uses external peer review to measure and continuously improve the quality of its science, technology and engineering (STE). LANL uses capability reviews to assess the STE quality and institutional integration and to advise Laboratory Management on the current and future health of the STE. Capability reviews address the STE integration that LANL uses to meet mission requirements. STE capabilities are define to cut across directorates providing a more holistic view of the STE quality, integration to achieve mission requirements, and mission relevance. The scope of these capabilities necessitate that there will be significant overlap in technical areas covered by capability reviews (e.g ., materials research and weapons science and engineering). In addition, LANL staff may be reviewed in different capability reviews because of their varied assignments and expertise. LANL plans to perform a complete review of the Laboratory's STE capabilities (hence staff) in a three-year cycle. The principal product of an external review is a report that includes the review committee's assessments, commendations, and recommendations for STE. The Capability Review Committees serve a dual role of providing assessment of the Laboratory's technical contributions and integration towards its missions and providing advice to Laboratory Management. The assessments and advice are documented in reports prepared by the Capability Review Committees that are delivered to the Director and to the Principal Associate Director for Science, Technology and Engineering (PADSTE). This report will be used by Laboratory Management for STE assessment and planning. The report is also provided to the Department of Energy (DOE) as part of LANL's Annual Performance Plan and to the Los Alamos National Security (LANS) LLC's Science and Technology Committee (STC) as part of its responsibilities to the LANS Board of Governors. LANL has defined fourteen
Resource-Based Capability on Development Knowledge Management Capabilities of Coastal Community
Teniwut, Roberto M. K.; Hasyim, Cawalinya L.; Teniwut, Wellem A.
2017-10-01
Building sustainable knowledge management capabilities in the coastal area might face a whole new challenge since there are many intangible factors involved from openness on new knowledge, access and ability to use the latest technology to the various local wisdom that still in place. The aimed of this study was to identify and analyze the resource-based condition of coastal community in this area to have an empirical condition of tangible and intangible infrastructure on developing knowledge management capability coastal community in Southeast Maluku, Indonesia. We used qualitative and quantitative analysis by depth interview and questionnaire for collecting the data with multiple linear regression as our analysis method. The result provided the information on current state of resource-based capability of a coastal community in this Southeast Maluku to build a sustainability model of knowledge management capabilities especially on utilization marine and fisheries resources. The implication of this study can provide an empirical information for government, NGO and research institution to dictate on how they conducted their policy and program on developing coastal community region.
An innovative approach to capability-based emergency operations planning.
Keim, Mark E
2013-01-01
This paper describes the innovative use information technology for assisting disaster planners with an easily-accessible method for writing and improving evidence-based emergency operations plans. This process is used to identify all key objectives of the emergency response according to capabilities of the institution, community or society. The approach then uses a standardized, objective-based format, along with a consensus-based method for drafting capability-based operational-level plans. This information is then integrated within a relational database to allow for ease of access and enhanced functionality to search, sort and filter and emergency operations plan according to user need and technological capacity. This integrated approach is offered as an effective option for integrating best practices of planning with the efficiency, scalability and flexibility of modern information and communication technology.
Cytosine arabinoside enhancement of gamma irradiation induced mutations in human T-lymphocytes
International Nuclear Information System (INIS)
O'Neill, J.P.; Sullivan, L.M.; Hunter, T.C.; Nicklas, J.A.
1991-01-01
The frequency of 6-thioguanine resistant (TGr) mutants induced in human G0 phase T-lymphocytes by 200 cGy of gamma irradiation is greatly enhanced by incubation with cytosine arabinoside (ara-C) after irradiation. The mutant frequency increased with increasing incubation time in ara-C for up to 2 hr. This mutation induction required a phenotypic expression time of 5-8 days mass culture growth, similar to that found with mutants induced by 300 cGy of irradiation alone. Southern blot analysis of 40 isolated mutant clones revealed 8 independent mutations by T-cell receptor (TCR) gene rearrangement patterns. Four of these eight showed hprt gene structural alterations (0.50). An alternative method to allow phenotypic expression was developed to minimize the isolation of hprt/TCR sibling mutants. The use of in situ expression in the microtiter dish wells resulted in the isolation of 17 independent mutations in 19 mutant clones. Ten of these 17 mutations showed hprt structural alterations (0.59). The high fraction of mutations involving structural alterations detected by Southern blot analysis is consistent with the known induction of chromosome aberrations by irradiation plus ara-C treatment. We propose that both the increase in Mf and the increase in the incidence of hprt gene structural alterations are due to the accumulation of strand breaks in repairing regions of DNA under these conditions of ara-C induced inhibition of repair. We further propose that upon release of the ara-C inhibition, these repairing regions can interact to yield both gene mutations and chromosome aberrations
Development of students learning capabilities and professional capabilities
DEFF Research Database (Denmark)
Ringtved, Ulla Lunde; Wahl, Christian; Belle, Gianna
This paper describes the work-in-progress on a project that aims todevelop a tool that via learning analytic methods enable studentsto enhance, document and assess the development of their learningcapabilities and professional capabilities in consequence of theirself-initiated study activities...... during their bachelor educations. Thetool aims at enhancing the development of students’ capabilities toself-initiate, self-regulate and self-assess their study activities.The tool uses the concept of collective intelligence as source formotivation and inspiration in self-initiating study activities...... as wellas self-assessing them. The tool is based on a heutagogical approachto support reflection on learning potential in these activities. Thisenhances the educational use of students self-initiated learningactivities by bringing visibility and evidence to them, and therebybringing value to the assessment...
Ulrich, Dave; Smallwood, Norm
2004-06-01
By making the most of organizational capabilities--employees' collective skills and fields of expertise--you can dramatically improve your company's market value. Although there is no magic list of proficiencies that every organization needs in order to succeed, the authors identify 11 intangible assets that well-managed companies tend to have: talent, speed, shared mind-set and coherent brand identity, accountability, collaboration, learning, leadership, customer connectivity, strategic unity, innovation, and efficiency. Such companies typically excel in only three of these capabilities while maintaining industry parity in the other areas. Organizations that fall below the norm in any of the 11 are likely candidates for dysfunction and competitive disadvantage. So you can determine how your company fares in these categories (or others, if the generic list doesn't suit your needs), the authors explain how to conduct a "capabilities audit," describing in particular the experiences and findings of two companies that recently performed such audits. In addition to highlighting which intangible assets are most important given the organization's history and strategy, this exercise will gauge how well your company delivers on its capabilities and will guide you in developing an action plan for improvement. A capabilities audit can work for an entire organization, a business unit, or a region--indeed, for any part of a company that has a strategy to generate financial or customer-related results. It enables executives to assess overall company strengths and weaknesses, senior leaders to define strategy, midlevel managers to execute strategy, and frontline leaders to achieve tactical results. In short, it helps turn intangible assets into concrete strengths.
Energy Storage Opportunities and Capabilities in a Type 3 Wind Turbine Generator: Preprint
Energy Technology Data Exchange (ETDEWEB)
Muljadi, Eduard; Gevorgian, Vahan; Hoke, Andy
2016-09-01
Wind power plants and other renewable power plants with power electronic interfaces are capable of delivering frequency response (both governor and/or inertial response) to the grid by a control action; thus, the reduction of available online inertia as conventional power plants are retired can be compensated by designing renewable power plant controls to include frequency response. The source of energy to be delivered as inertial response is determined by the type of generation and control strategy chosen. The cost of energy storage is expected to drop over time, and global research activities on energy storage are very active, funded both by the private industry and governments. Different industry sectors (e.g., transportation, energy) are the major drivers of the recent storage research and development. This work investigates the opportunities and capabilities of deploying energy storage in renewable power plants. In particular, we focus on wind power plants with doubly-fed induction generators, or Type 3 wind turbine generator (WTGs). We find that the total output power of a system with Type 3 WTGs with energy storage can deliver a power boost during inertial response that is up to 45% higher than one without energy storage without affecting the torque limit, thus enabling an effective delivery of ancillary services to the grid.
The evolution of alliance capabilities
Heimeriks, K.H.; Duysters, G.M.; Vanhaverbeke, W.P.M.
2004-01-01
This paper assesses the effectiveness and differential performance effects of learning mechanisms on the evolution of alliance capabilities. Relying on the concept of capability lifecycles, prior research has suggested that different capability levels could be identified in which different
International Nuclear Information System (INIS)
Elisova, T.V.; Feoktistova, T.P.; Stavrakova, N.M.
1988-01-01
A study was made of the effect of two-hour treatment of Chinese hamster cells with cytosine arabinoside (AraC) combined with hydroxyurea (HU) at the G 1 phase of the cell cycle on lethal and mutagenic effects of X-radiation (50 to 400 cGy). The inhibitors were shown to increase a spontaneous mutation level of the resistance to 6-thioguanine: this increase augmented by 3 times as the time the treatment increased from 1-2 to 6 h. However, while shorply enhancing the inactivating effect of X-radiation (the enhancement coefficient was 2.6) Arac+HU caused an additive, or a somewhat lesser, effect as estimated by the yield of mutations. It is suggested that AraC combined with hydroxyurea fail to modify the radiation-induced premutation damages
Siirt Arapçasının Türkçeyle Zenginleştirilmesi
Bankır, Mehmet Malik; Akdemir, Yılmaz
2017-01-01
Bu çalışmamızda dilin sadece bir iletişim aracı olmadığını bunun yanı sıra çok daha önemli unsurları içerdiğini belirtmeye çalışacağız. Dili her bilim dalı kendisine göre bir araç olarak kullandığı gibi dil de her bilim dalından kendince faydalanmak zorundadır. Öncelikle dil her şeyden önce bir iletişim aracıdır. Fakat dile iletişim aracı olarak bakmamak gerekir. Dilin bireyler arasındaki iletişim fonksiyonunun yanında, kültürel, toplumsal, beyins...
Analytical capabilities and services of Lawrence Livermore Laboratory's General Chemistry Division
International Nuclear Information System (INIS)
Gutmacher, R.; Crawford, R.
1978-01-01
This comprehensive guide to the analytical capabilities of Lawrence Livermore Laboratory's General Chemistry Division describes each analytical method in terms of its principle, field of application, and qualitative and quantitative uses. Also described are the state and quantity of sample required for analysis, processing time, available instrumentation, and responsible personnel
Brandishing Cyberattack Capabilities
2013-01-01
Advertising cyberwar capabilities may be helpful. It may back up a deterrence strategy. It might dissuade other states from conventional mischief or...to enable the attack.5 Many of the instruments of the attack remain with the target system, nestled in its log files, or even in the malware itself...debat- able. Even if demonstrated, what worked yesterday may not work today. But difficult does not mean impossible. Advertising cyberwar capabilities
Prerequisites for building a computer security incident response capability
CSIR Research Space (South Africa)
Mooi, M
2015-08-01
Full Text Available . 1]. 2) Handbook for Computer Security Incident Response Teams (CSIRTs) [18] (CMU-SEI): Providing guidance on building and running a CSIRT, this handbook has a particular focus on the incident handling service [18, p. xv]. In addition, a basic CSIRT... stream_source_info Mooi_2015.pdf.txt stream_content_type text/plain stream_size 41092 Content-Encoding UTF-8 stream_name Mooi_2015.pdf.txt Content-Type text/plain; charset=UTF-8 Prerequisites for building a computer...
KSC Technical Capabilities Website
Nufer, Brian; Bursian, Henry; Brown, Laurette L.
2010-01-01
This document is the website pages that review the technical capabilities that the Kennedy Space Center (KSC) has for partnership opportunities. The purpose of this information is to make prospective customers aware of the capabilities and provide an opportunity to form relationships with the experts at KSC. The technical capabilities fall into these areas: (1) Ground Operations and Processing Services, (2) Design and Analysis Solutions, (3) Command and Control Systems / Services, (4) Materials and Processes, (5) Research and Technology Development and (6) Laboratories, Shops and Test Facilities.
Organizational Economics of Capability and Heterogeneity
DEFF Research Database (Denmark)
Argyres, Nicholas S.; Felin, Teppo; Foss, Nicolai Juul
2012-01-01
For decades, the literatures on firm capabilities and organizational economics have been at odds with each other, specifically relative to explaining organizational boundaries and heterogeneity. We briefly trace the history of the relationship between the capabilities literature and organizational...... economics, and we point to the dominance of a “capabilities first” logic in this relationship. We argue that capabilities considerations are inherently intertwined with questions about organizational boundaries and internal organization, and we use this point to respond to the prevalent capabilities first...... logic. We offer an integrative research agenda that focuses first on the governance of capabilities and then on the capability of governance....
DEFF Research Database (Denmark)
Kozine, Igor; Andersen, Henning Boje
2015-01-01
We suggest an approach for maintaining and enhancing resilience that integrates the resilience capabilities of Critical Infrastructures (CIs) into the emergency management cycle (prevention, preparedness, response, and recovery). This allows emergency services to explicitly address resilience...
Metrology Measurement Capabilities
Energy Technology Data Exchange (ETDEWEB)
Dr. Glen E. Gronniger
2007-10-02
This document contains descriptions of Federal Manufacturing & Technologies (FM&T) Metrology capabilities, traceability flow charts, and the measurement uncertainty of each measurement capability. Metrology provides NIST traceable precision measurements or equipment calibration for a wide variety of parameters, ranges, and state-of-the-art uncertainties. Metrology laboratories conform to the requirements of the Department of Energy Development and Production Manual Chapter 13.2, ANSI/ISO/IEC ANSI/ISO/IEC 17025:2005, and ANSI/NCSL Z540-1. FM&T Metrology laboratories are accredited by NVLAP for the parameters, ranges, and uncertainties listed in the specific scope of accreditation under NVLAP Lab code 200108-0. See the Internet at http://ts.nist.gov/Standards/scopes/2001080.pdf. These parameters are summarized. The Honeywell Federal Manufacturing & Technologies (FM&T) Metrology Department has developed measurement technology and calibration capability in four major fields of measurement: (1) Mechanical; (2) Environmental, Gas, Liquid; (3) Electrical (DC, AC, RF/Microwave); and (4) Optical and Radiation. Metrology Engineering provides the expertise to develop measurement capabilities for virtually any type of measurement in the fields listed above. A strong audit function has been developed to provide a means to evaluate the calibration programs of our suppliers and internal calibration organizations. Evaluation includes measurement audits and technical surveys.
Tsunami disaster risk management capabilities in Greece
Marios Karagiannis, Georgios; Synolakis, Costas
2015-04-01
Greece is vulnerable to tsunamis, due to the length of the coastline, its islands and its geographical proximity to the Hellenic Arc, an active subduction zone. Historically, about 10% of all world tsunamis occur in the Mediterranean region. Here we review existing tsunami disaster risk management capabilities in Greece. We analyze capabilities across the disaster management continuum, including prevention, preparedness, response and recovery. Specifically, we focus on issues like legal requirements, stakeholders, hazard mitigation practices, emergency operations plans, public awareness and education, community-based approaches and early-warning systems. Our research is based on a review of existing literature and official documentation, on previous projects, as well as on interviews with civil protection officials in Greece. In terms of tsunami disaster prevention and hazard mitigation, the lack of tsunami inundation maps, except for some areas in Crete, makes it quite difficult to get public support for hazard mitigation practices. Urban and spatial planning tools in Greece allow the planner to take into account hazards and establish buffer zones near hazard areas. However, the application of such ordinances at the local and regional levels is often difficult. Eminent domain is not supported by law and there are no regulatory provisions regarding tax abatement as a disaster prevention tool. Building codes require buildings and other structures to withstand lateral dynamic earthquake loads, but there are no provisions for resistance to impact loading from water born debris Public education about tsunamis has increased during the last half-decade but remains sporadic. In terms of disaster preparedness, Greece does have a National Tsunami Warning Center (NTWC) and is a Member of UNESCO's Tsunami Program for North-eastern Atlantic, the Mediterranean and connected seas (NEAM) region. Several exercises have been organized in the framework of the NEAM Tsunami Warning
Directory of Open Access Journals (Sweden)
Ieva Martinkenaite
2017-01-01
Full Text Available This empirical paper examines a process, starting with the managerial decision to make service design an organizational capability, and follows it as it unfolds over time within one organization. Service design has become an established business practice of how firms create new products and services to promote differentiation in an increasingly uncertain business landscape. Implicit in the literature on service design are assumptions about strategic implications of adopting the prescribed innovation methods and tools. However, little is known about how service design evolves into an organizational capability enabling firms to transform their existing businesses and sustain competitiveness. Through a longitudinal, exploratory case study of service design practices in one of the world’s largest telecommunications companies, we explicate mechanisms through which service design evolves into an organizational capability by exploring the research question: what are the mechanisms through which service design develops into an organizational capability? Our study reveals the effect of an initial introduction of service design tools, identification of boundaryspanning actors and co-alignment of dedicated resources between internal functions, as well as through co-creation with customers. Over time, these activities lead to the adoption of service design practices, and subsequently these practices spark incremental learning throughout the organization, alter managerial decisions and influence multiple paths for the development of new capabilities. Reporting on this process, we are able to describe how service design practices were disseminated and institutionalized within the organization we observed. This study thus contributes by informing how service design can evolve into an organizational capability, as well as by bridging the emerging literature on service design and design thinking with established strategy theory. Further research will have to
Space Logistics: Launch Capabilities
Furnas, Randall B.
1989-01-01
The current maximum launch capability for the United States are shown. The predicted Earth-to-orbit requirements for the United States are presented. Contrasting the two indicates the strong National need for a major increase in Earth-to-orbit lift capability. Approximate weights for planned payloads are shown. NASA is studying the following options to meet the need for a new heavy-lift capability by mid to late 1990's: (1) Shuttle-C for near term (include growth versions); and (2) the Advanced Lauching System (ALS) for the long term. The current baseline two-engine Shuttle-C has a 15 x 82 ft payload bay and an expected lift capability of 82,000 lb to Low Earth Orbit. Several options are being considered which have expanded diameter payload bays. A three-engine Shuttle-C with an expected lift of 145,000 lb to LEO is being evaluated as well. The Advanced Launch System (ALS) is a potential joint development between the Air Force and NASA. This program is focused toward long-term launch requirements, specifically beyond the year 2000. The basic approach is to develop a family of vehicles with the same high reliability as the Shuttle system, yet offering a much greater lift capability at a greatly reduced cost (per pound of payload). The ALS unmanned family of vehicles will provide a low end lift capability equivalent to Titan IV, and a high end lift capability greater than the Soviet Energia if requirements for such a high-end vehicle are defined.In conclusion, the planning of the next generation space telescope should not be constrained to the current launch vehicles. New vehicle designs will be driven by the needs of anticipated heavy users.
International Nuclear Information System (INIS)
Mirzayans, R.; Enns, L.; Dietrich, K.; Barley, R.D.C.; Paterson, M.C.; Alberta Univ., Edmonton, AB; Alberta Univ., Edmonton, AB
1996-01-01
Dermal fibroblast strains cultured from affected members of a cancer-prone family with Li-Fraumeni syndrome (LFS) harbor a point mutation in one allele of the p53 tumor suppressor gene, resulting in loss of normal p53-deficient strains to carry out the long-patch mode of excision repair, mediated by DNA polymerases delta and epsilon, after exposure to Co-60 gamma radiation or far ultraviolet (UV) (chiefly 254 mm) light. Repair was monitored by incubation of the irradiated cultures in the presence of aphidicolin (ape) or 1-beta-D-arabinofuranosylcytosine (araC), each a specific inhibitor of long-patch repair, followed by measurement of drug-induced DNA strand breaks (reflecting non-ligated strand incision events) by alkaline surcrose velocity sedimentation. The LFS strains displayed deficient repair capacity in response to both gamma rays and UV light. The repair anomaly in UV-irradiated LFS cultures was manifested not only in the overall genome, but also in the transcriptionally active, preferentially repaired c-myc gene. Using autoradiography we also assessed unscheduled DNA synthesis (UDS) after UV irradiation and found this conventional measure of repair replication to be deficient in LFS strains. Moreover, both ape and araC decreased the level of UV-induced UDS by similar to 75% in normal cells, but each had only a marginal effect on LFS cells. We further demonstrated that the LFS strains are impaired in the recovery of both RNA and replicative DNA syntheses after UV treatment, two molecular anomalies of the DNA repair deficiency disorders xeroderma pigmentosum and Cockayne's syndrome. Together these results imply a critical role for wild-type p53 protein in DNA polymerase delta/epsilon-mediated excision repair, both the mechanism operating on the entire genome and that acting on expressed genes. (Author)
The Capability to Hold Property
Claassen, Rutger
2015-01-01
This paper discusses the question of whether a capability theory of justice (such as that of Martha Nussbaum) should accept a basic “capability to hold property.” Answering this question is vital for bridging the gap between abstract capability theories of justice and their institutional
Conceptualizing innovation capabilities: A contingency perspective
Directory of Open Access Journals (Sweden)
Tor Helge Aas
2017-01-01
Full Text Available Empirical research has confirmed that a positive relationship exists between the implementation of innovation activities and the future performance of organizations. Firms utilize resources and capabilities to develop innovations in the form of new products, services or processes. Some firms prove to be better at reproducing innovation success than others, and the capacity to do so is referred to as innovation capability. However, the term innovation capability is ambiguously treated in extant literature. There are several different definitions of the concept and the distinction between innovation capabilities and other types of capabilities, such as dynamic capabilities, is neither explicitly stated, nor is the relationship between the concept and other resource- and capability-based concepts within strategy theory established. Although innovation is increasingly identified as crucial for a firm’s sustainable competitiveness in contemporary volatile and complex markets, the strategy-innovation link is underdeveloped in extant research. To overcome this challenge this paper raises the following research question: What type of innovation capabilities are required to innovate successfully? Due to the status of the extant research, we chose a conceptual research design to answer our research question and the paper contributes with a conceptual framework to discuss what innovation capabilities firms need to reproduce innovation success. Based on careful examination of current literature on innovation capability specifically, and the strategy-innovation link in general, we suggest that innovation capability must be viewed along two dimensions – innovation novelty and market characteristics. This framework enables the identification of four different contexts for innovation capabilities in a two-bytwo matrix. We discuss the types of innovation capabilities necessary within the four different contexts. This novel framework contributes to the
Developing Collaborative Product Development Capabilities
DEFF Research Database (Denmark)
Mahnke, Volker; Tran, Yen
2012-01-01
innovation strategies’. Our analyses suggest that developing such collaboration capabilities benefits from the search for complementary practices, the combination of learning styles, and the development of weak and strong ties. Results also underscore the crucial importance of co-evolution of multi......Collaborative product development capabilities support a company’s product innovation activities. In the context of the fast fashion sector, this paper examines the development of the product development capabilities (PDC) that align product development capabilities in a dual innovation context......, one, slow paced, where the firm is well established and the other, fast paced, which represents a new competitive arena in which the company competes. To understand the process associated with collaborative capability development, we studied three Scandinavian fashion companies pursuing ‘dual...
Developing an operational capabilities index of the emergency services sector.
Energy Technology Data Exchange (ETDEWEB)
Collins, M.J.; Eaton, L.K.; Shoemaker, Z.M.; Fisher, R.E.; Veselka, S.N.; Wallace, K.E.; Petit, F.D. (Decision and Information Sciences)
2012-02-20
In order to enhance the resilience of the Nation and its ability to protect itself in the face of natural and human-caused hazards, the ability of the critical infrastructure (CI) system to withstand specific threats and return to normal operations after degradation must be determined. To fully analyze the resilience of a region and the CI that resides within it, both the actual resilience of the individual CI and the capability of the Emergency Services Sector (ESS) to protect against and respond to potential hazards need to be considered. Thus, a regional resilience approach requires the comprehensive consideration of all parts of the CI system as well as the characterization of emergency services. This characterization must generate reproducible results that can support decision making with regard to risk management, disaster response, business continuity, and community planning and management. To address these issues, Argonne National Laboratory, in collaboration with the U.S. Department of Homeland Security (DHS) Sector Specific Agency - Executive Management Office, developed a comprehensive methodology to create an Emergency Services Sector Capabilities Index (ESSCI). The ESSCI is a performance metric that ranges from 0 (low level of capabilities) to 100 (high). Because an emergency services program has a high ESSCI, however, does not mean that a specific event would not be able to affect a region or cause severe consequences. And because a program has a low ESSCI does not mean that a disruptive event would automatically lead to serious consequences in a region. Moreover, a score of 100 on the ESSCI is not the level of capability expected of emergency services programs; rather, it represents an optimal program that would rarely be observed. The ESSCI characterizes the state of preparedness of a jurisdiction in terms of emergency and risk management. Perhaps the index's primary benefit is that it can systematically capture, at a given point in time, the
Space Environmental Effects Testing Capability at the Marshall Space Flight Center
DeWittBurns, H.; Craven, Paul; Finckenor, Miria; Nehls, Mary; Schneider, Todd; Vaughn, Jason
2012-01-01
Understanding the effects of the space environment on materials and systems is fundamental and essential for mission success. If not properly understood and designed for, the effects of the environment can lead to degradation of materials, reduction of functional lifetime, and system failure. In response to this need, the Marshall Space Flight Center has developed world class Space Environmental Effects (SEE) expertise and test facilities to simulate the space environment. Capabilities include multiple unique test systems comprising the most complete SEE testing capability available. These test capabilities include charged particle radiation (electrons, protons, ions), ultraviolet radiation (UV), vacuum ultraviolet radiation (VUV), atomic oxygen, plasma effects, space craft charging, lunar surface and planetary effects, vacuum effects, and hypervelocity impacts as well as the combination of these capabilities. In addition to the uniqueness of the individual test capabilities, MSFC is the only NASA facility where the effects of the different space environments can be tested in one location. Combined with additional analytical capabilities for pre- and post-test evaluation, MSFC is a one-stop shop for materials testing and analysis. The SEE testing and analysis are performed by a team of award winning experts nationally recognized for their contributions in the study of the effects of the space environment on materials and systems. With this broad expertise in space environmental effects and the variety of test systems and equipment available, MSFC is able to customize tests with a demonstrated ability to rapidly adapt and reconfigure systems to meet customers needs. Extensive flight experiment experience bolsters this simulation and analysis capability with a comprehensive understanding of space environmental effects.
No Money Down. Boost State Nuclear Forensics Capabilities with Less
International Nuclear Information System (INIS)
Henriques, Sasha
2013-01-01
Any mention of boosting nuclear forensics capabilities can have governments clutching their wallets reflexively. That's because it sounds very high tech, and therefore very expensive. In a time of austerity measures, countries can find it difficult to take on additional financial responsibilities, even when those responsibilities have to do with nuclear security. But according to the IAEA's Office of Nuclear Security, becoming proficient in nuclear forensics isn't as expensive as it initially appears. Nuclear forensics is the science of uncovering the origin and history of nuclear materials, especially those found at a crime scene. ''And every country can engage in a nuclear forensics examination, using existing technical capabilities that are readily adapted as part of a nuclear security infrastructure,'' says David Smith, IAEA Nuclear Security Coordinator. ''They already have the right analytical equipment - spectrometry and inorganic chemistry equipment, for example - in universities, regulatory bodies and mining companies, just to name a few places. And they have much of the expertise - trained technicians and law enforcement officials - but are unaware that putting these things together along with workable plans and strategies - that the IAEA can provide - can create an effective means for the practice of nuclear forensics''
Dynamic Capabilities and Performance
DEFF Research Database (Denmark)
Wilden, Ralf; Gudergan, Siegfried P.; Nielsen, Bo Bernhard
2013-01-01
are contingent on the competitive intensity faced by firms. Our findings demonstrate the performance effects of internal alignment between organizational structure and dynamic capabilities, as well as the external fit of dynamic capabilities with competitive intensity. We outline the advantages of PLS...
Winterton, Rachel; Clune, Samantha; Warburton, Jeni; Martin, John
2014-09-01
To explore how local governance enables access to resources, creates opportunities and increases capability for older people in rural communities to experience social inclusion. Twenty-six semi-structured interviews were undertaken with community stakeholders across two rural communities in north-east Victoria. Stakeholders were drawn from local government, and a range of community groups and organisations, as identified in a scoping study. Through the provision of community resources (e.g. physical and human infrastructure, organisational partnerships), local services and supports offer social and productive environments for participation. They also build individual resources (e.g. health, skills, finances, networks) to enable older people to participate within these environments, and provide assistance to allow older people to use individual and community resources. Community resources are integral in facilitating the development of older people's individual resources, and opportunities and capabilities for participation. These enable greater choice in participation, and contribute to the sustainability of community resources serving ageing populations. © 2013 The Authors. Australasian Journal on Ageing © 2013 ACOTA.
Marketing Capability in Strategy Research
DEFF Research Database (Denmark)
Ritter, Thomas; Distel, Andreas Philipp
Following the call for a demand-side perspective of strategic management (e.g., Priem et al., 2012), a firm’s marketing capability, i.e. its ability to interact with down-stream stakeholders, becomes a pivotal element in explaining a firm’s competitiveness. While marketing capability is recognized...... in the strategic management literature as an important driver of firm performance, our review of 86 articles reveals a lack of a generally accepted definition of marketing capability, a lack of a common conceptualization as well as differences in the measurement of marketing capability. In order to build a common...... ground for advancing marketing capability research and thus supporting the demand-side perspective in strategic management, we develop an integrative framework to explain the differences and propose a research agenda for developing the field....
International Nuclear Information System (INIS)
2010-12-01
This stakeholder review discussed the planning and response capabilities for marine oil spills on the United States and Canadian transboundary areas of the Pacific coast. An overview of the transboundary area was presented, as well as details of the area's climate, demographics, and economics. Historical and cultural features of the region were discussed, and the environmental impacts of actual and potential oil spills were evaluated. Risks related to increased marine traffic and development of new harbours and inland railways were discussed along with issues related to First Nations groups in the region. This document also reviewed spill notification procedures and presented oil spill response recommendations. It also outlined transboundary coordination procedures and incident investigation procedures. Issues related to fisheries were also discussed, with particular reference to oil spill response training procedures and available oil spill response software. Response funding regimes were also discussed. refs., tabs., figs.
Chae, Ho-Chang
2009-01-01
This study empirically examines the impact of IT capability on firms' performance and evaluates whether firms' IT capabilities play a role in improving employee capability, customer value, customer satisfaction, and ultimately business performance. The results were based on comparing the business performance of the IT leader companies with that of…
Traces of social life in Bećarci from Drežnica
Directory of Open Access Journals (Sweden)
Ćupurdija Branko
2016-01-01
Full Text Available Firstly, the identification of folk dances and pair dances of Serbian population on the border between Gorski kotar, Lika, and the Croatian Littoral has been performed. As it turned out, in the period between the two world wars and some fifteen years later this population knew 15 folk dances and 7 pair dances, among which was bećarac. Between 1989 and 2015, 29 bećarac dances were discovered in Drežnica, Bajmok, and Subotica, where many people from Drežnica settled after World War II. Secondly, the information on songs recordings and the names of song tellers, singers and dancers are given here. In addition, certain characteristics of the manner of singing and dancing are indicated here on the descriptive, verbal level, as well as the social oblivion which prevailed upon bećarac in both old and new surroundings and the attempt of its renewal. As it turns out, these songs tell about the physical appearance and habits of a bećar and a bećaruša, their social life (country gatherings, families, taverns, possible tensions and animosities between certain people and poverty of their families. All this is often presented in a cheerful and humorous manner. In this work, primarily because, in a way, ojkan and bećarac function as a system of adjoint dishes, a belief is stated that a systematization of social motifs on which ojkan from Drežnica is based upon could put a new light on the knowledge about bećarac and the social poetics which lies in its foundations.
Amartya Sen's Capability Approach and Education
Walker, Melanie
2005-01-01
The human capabilities approach developed by the economist Amartya Sen links development, quality of life and freedom. This article explores the key ideas in the capability approach of: capability, functioning, agency, human diversity and public participation in generating valued capabilities. It then considers how these ideas relate specifically…
McGowan, E; Elliott, N; Stokes, E
2018-05-07
Investigation of the leadership capabilities of physiotherapy managers found that they report predominantly demonstrating capabilities associated with the human resource and structural frames. However, little is known about the leadership capabilities of clinical specialists and advanced physiotherapy practitioners (APPs) who also are identified as having responsibility for leadership. To explore clinical specialists´ and APPs' perceptions of their leadership capabilities and compare them with the reported leadership capabilities of physiotherapy managers. Semi-structured interviews were conducted with a purposive sample of 17 physiotherapy clinical specialists and APPs from a range of practice settings across Ireland. The interviews were analyzed using template analysis and the coding template was based on the Bolman and Deal Leadership framework. The participants described demonstrating leadership capabilities associated with each of the four leadership frames. However, the language used by the clinical specialists/APPs suggested that they work predominantly through the human resource frame. Structural frame capabilities were reported by the clinical specialists/APPs and there were some differences to those reported by the managers. In keeping with the reported leadership capabilities of the physiotherapy managers, the employment of capabilities associated with the political frame varied between participants and symbolic frame capabilities were underused. There are many similarities in the self-reported leadership capabilities of managers and clinical specialists/APPs. However, differences were also noted. Both cohorts of physiotherapy leaders may benefit from specific development programs to develop leadership capabilities associated with the political and symbolic frames.
Energy Technology Data Exchange (ETDEWEB)
Tempel, K.; Wulffius-Kock, M.; Winkle, J.; Schmerold, I.
1982-02-01
The effects of aminoethylisothiuroniumbromide (AET), cysteamine (CY-A), cysteine (CY-E), glutathione (GLU), mercaptoethanol (MA), mercaptopropionylglycine (MPG), N-ethylmaleimide (NEM), metronidazole (MNA), nitroacetophenone (NAP), nitrofurazone (NFA), arabinofuranosylcytosine (araC), fluorouracil (FU), adriamycin (AM), ethidiumbromide (E), bleomycin (BM), and diethyldithiocarbamate (DDC) on the semiconservative and unscheduled incorporation of /sup 3/H-thymidine into the DNA were tested on rat thymocytes in vitro. DNA damage has been measured using the hydroxylapatite system. Unscheduled DNA synthesis was induced by UV-light and/or X-irradiation. The semiconservative DNA synthesis was inhibited by the above substances-with exception of MA and MPG. Aminothioles, NAP, NFA, and BM enhanced, araC, FU, AM, E, and DDC diminished unscheduled DNA synthesis. After alkaline unwinding, the duplex form of DNA decreased under the influence of CY-A, CY-E, GLU, MPG, NEM, NAP, NFA, araC, FU, AM, E, and BM. It is suggested that stimulation of unscheduled DNA synthesis combined with a transient decrease of semiconservative DNA synthesis will amplify the DNA repair capacity of thymocytes, whereas radiation damage may be intensified by araC, FU, AM,E, and DDC - at least partly, through inhibition of unscheduled DNA synthesis. With respect to the action of NAP, NFA, and BM, DNA repair may be concerned in a more indirect manner.
International Nuclear Information System (INIS)
Tempel, K.; Wulffius-Kock, M.; Winkle, J.; Schmerold, I.
1982-01-01
The effects of aminoethylisothiuroniumbromide (AET), cysteamine (CY-A), cysteine (CY-E), glutathione (GLU), mercaptoethanol (MA), mercaptopropionylglycine (MPG), N-ethylmaleimide (NEM), metronidazole (MNA), nitroacetophenone (NAP), nitrofurazone (NFA), arabinofuranosylcytosine (araC), fluorouracil (FU), adriamycin (AM), ethidiumbromide (E), bleomycin (BM), and diethyldithiocarbamate (DDC) on the semiconservative and unscheduled incorporation of 3 H-thymidine into the DNA were tested on rat thymocytes in vitro. DNA damage has been measured using the hydroxylapatite system. Unscheduled DNA synthesis was induced by UV-light and/or X-irradiation. The semiconservative DNA synthesis was inhibited by the above subtrances-with exception of MA and MPG. Aminothioles, NAP, NFA, and BM enhanced, araC, FU, AM, E, and DDC diminished unscheduled DNA synthesis. After alkaline unwinding, the duplex form of DNA decreased under the influence of CY-A, CY-E, GLU, MPG, NEM, NAP, NFA, araC, FU, AM, E, and BM. It is suggested that stimulation of unscheduled DNA synthesis combined with a transient decrease of semiconservative DNA synthesis will amplify the DNA repair capacity of thymocytes, whereas radiation damage may be intensified by araC, FU, AM,E, and DDC - at least partly, through inhibition of unscheduled DNA synthesis. With respect to the action of NAP, NFA, and BM, DNA repair may be concerned in a more indirect manner. (orig.) [de
DEFF Research Database (Denmark)
Nielsen, Peter; Nielsen, Rene Nesgaard; Bamberger, Simon Grandjean
2012-01-01
is a survey that collected information from 601 firms belonging to the private urban sector in Denmark. The survey was carried out in late 2010. Keywords: dynamic capabilities/innovation/globalization/employee/employer cooperation/Nordic model Acknowledgment: The GOPA study was financed by grant 20080053113......Technological developments combined with increasing levels of competition related to the ongoing globalization imply that firms find themselves in dynamic, changing environments that call for dynamic capabilities. This challenges the internal human and organizational resources of firms in general...
Improving Effectiveness of Capabilities in EU Conflict Prevention
DEFF Research Database (Denmark)
Rodt, Annemarie Peen
– severely challenging the Union’s current capabilities as an international security provider. The urgency of improving conflict preventive and crisis management measures is particularly pertinent in Africa, where the numbers affected by conflicts across the continent are staggering. This contribution sets...... out to answer whether – and if so how – EU responses to African conflicts have made a meaningful contribution to preventing (further) conflict. The Union’s efforts in Libya, South Sudan, Democratic Republic of Congo and Central African Republic are critically examined in a comparative case study...
Airborne Tactical Intent-Based Conflict Resolution Capability
Wing, David J.; Vivona, Robert A.; Roscoe, David A.
2009-01-01
Trajectory-based operations with self-separation involve the aircraft taking the primary role in the management of its own trajectory in the presence of other traffic. In this role, the flight crew assumes the responsibility for ensuring that the aircraft remains separated from all other aircraft by at least a minimum separation standard. These operations are enabled by cooperative airborne surveillance and by airborne automation systems that provide essential monitoring and decision support functions for the flight crew. An airborne automation system developed and used by NASA for research investigations of required functionality is the Autonomous Operations Planner. It supports the flight crew in managing their trajectory when responsible for self-separation by providing monitoring and decision support functions for both strategic and tactical flight modes. The paper focuses on the latter of these modes by describing a capability for tactical intent-based conflict resolution and its role in a comprehensive suite of automation functions supporting trajectory-based operations with self-separation.
Telematics Options and Capabilities
Energy Technology Data Exchange (ETDEWEB)
Hodge, Cabell [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-05
This presentation describes the data tracking and analytical capabilities of telematics devices. Federal fleet managers can use the systems to keep their drivers safe, maintain a fuel efficient fleet, ease their reporting burden, and save money. The presentation includes an example of how much these capabilities can save fleets.
Capability Handbook- offline metrology
DEFF Research Database (Denmark)
Islam, Aminul; Marhöfer, David Maximilian; Tosello, Guido
This offline metrological capability handbook has been made in relation to HiMicro Task 3.3. The purpose of this document is to assess the metrological capability of the HiMicro partners and to gather the information of all available metrological instruments in the one single document. It provides...
Robeyns, Ingrid
2011-01-01
textabstract In its most general description, the capability approach is a flexible and multi-purpose normative framework, rather than a precise theory of well-being, freedom or justice. At its core are two normative claims: first, the claim that the freedom to achieve well-being is of primary moral importance, and second, that freedom to achieve well-being is to be understood in terms of people’s capabilities, that is, their real opportunities to do and be what they have reason to value. Thi...
Energy Technology Data Exchange (ETDEWEB)
Muller, Richard P. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-07-01
Sandia National Laboratories has developed a broad set of capabilities in quantum information science (QIS), including elements of quantum computing, quantum communications, and quantum sensing. The Sandia QIS program is built atop unique DOE investments at the laboratories, including the MESA microelectronics fabrication facility, the Center for Integrated Nanotechnologies (CINT) facilities (joint with LANL), the Ion Beam Laboratory, and ASC High Performance Computing (HPC) facilities. Sandia has invested $75 M of LDRD funding over 12 years to develop unique, differentiating capabilities that leverage these DOE infrastructure investments.
The Antimetabolite ara-CTP Blocks Long-Term Memory of Conditioned Taste Aversion
Wang, Jianpeng; Ren, Keqin; Pérez, Javier; Silva, Alcino J.; Peña de Ortiz, Sandra
2003-01-01
We examined the hypothesis that processes related to DNA recombination and repair are involved in learning and memory. Rats received intracerebroventricular (icv) infusions of the antimetabolite 1-beta-D-arabinofuranosylcytosine triphosphate (ara-CTP) or its precursor cytosine arabinoside (ara-C) 30 min prior to conditioned taste aversion (CTA) training. Both ara-CTP and ara-C caused significant impairments in long-term memory (LTM) of CTA. Control experiments indicate that the effect of ara-...
ZHANG, YUBO
2009-01-01
Hotel industry has been an increasingly significant service industry across the whole world. The performance measurement method is crucial for hotels’ operations. This study examines the impacts of marketing capability, operations capability, environmental capability and diversification strategy on the business performance of hotel industry in the UK. Based on the financial archival data in the database and information obtained in the firm websites from 2004 to 2007, the investigation is carr...
Horney, Jennifer A; Carbone, Eric G; Lynch, Molly; Wang, Z Joan; Jones, Terrance; Rose, Dale A
2017-09-01
To assess how health department contextual factors influence perceptions of the 15 Public Health Preparedness Capabilities, developed by the Centers for Disease Control and Prevention (CDC) to provide guidance on organizing preparedness activities. We conducted an online survey and focus group between September 2015 and May 2016 with directors of preparedness programs in state, metropolitan, and territorial jurisdictions funded by CDC's Public Health Emergency Preparedness (PHEP) cooperative agreement. The survey collected demographic information and data on contextual factors including leadership, partnerships, organizational structure, resources and structural capacity, and data and evaluation. Seventy-seven percent (48 of 62) of PHEP directors completed the survey and 8 participated in the focus group. Respondents were experienced directors (mean = 10.6 years), and 58% led 7 or more emergency responses. Leadership, partnerships, and access to fiscal and human resources were associated with perception and use of the capabilities. Despite some deficiencies, PHEP awardees believe the capabilities provide useful guidance and a flexible framework for organizing their work. Contextual factors affect perceptions of the capabilities and possibly the effectiveness of their use. Public Health Implications. The capabilities can be used to address challenges in preparedness, including identifying evidence-based practices, developing performance measures, and improving responses.
Barnett, Ralph L; Liber, Theodore
2006-02-22
Use of unassisted human push capability arises from time to time in the areas of crowd and animal control, the security of locked doors, the integrity of railings, the removal of tree stumps and entrenched vehicles, the manoeuvering of furniture, and athletic pursuits such as US football or wrestling. Depending on the scenario, human push capability involves strength, weight, weight distribution, push angle, footwear/floor friction, and the friction between the upper body and the pushed object. Simple models are used to establish the relationships among these factors.
International Nuclear Information System (INIS)
Shi, Lin; Song, Quansheng; Zhang, Yingmei; Lou, Yaxin; Wang, Yanfang; Tian, Linjie; Zheng, Yi; Ma, Dalong; Ke, Xiaoyan; Wang, Ying
2010-01-01
Conventional chemotherapy is still frequently used. Programmed cell death 5 (PDCD5) enhances apoptosis of various tumor cells triggered by certain stimuli and is lowly expressed in leukemic cells from chronic myelogenous leukemia patients. Here, we describe for the first time that recombinant human PDCD5 protein (rhPDCD5) in combination with chemotherapy drugs has potent antitumor effects on chronic myelogenous leukemia K562 cells in vitro and in vivo. The antitumor efficacy of rhPDCD5 protein with chemotherapy drugs, idarubicin (IDR) or cytarabine (Ara-C), was examined in K562 cells in vitro and K562 xenograft tumor models in vivo. rhPDCD5 protein markedly increased the apoptosis rates and decreased the colony-forming capability of K562 cells after the combined treatment with IDR or Ara-C. rhPDCD5 protein by intraperitoneal administration dramatically improved the antitumor effects of IDR treatment in the K562 xenograft model. The tumor sizes and cell proliferation were significantly decreased; and TUNEL positive cells were significantly increased in the combined group with rhPDCD5 protein and IDR treatment compared with single IDR treatment groups. rhPDCD5 protein, in combination with IDR, has potent antitumor effects on chronic myelogenous leukemia K562 cells and may be a novel and promising agent for the treatment of chronic myelogenous leukemia.
People Capability Maturity Model. SM.
1995-09-01
tailored so it consumes less time and resources than a traditional software process assessment or CMU/SEI-95-MM-02 People Capability Maturity Model...improved reputation or customer loyalty. CMU/SEI-95-MM-02 People Capability Maturity Model ■ L5-17 Coaching Level 5: Optimizing Activity 1...Maturity Model CMU/SEI-95-MM-62 Carnegie-Mellon University Software Engineering Institute DTIC ELECTE OCT 2 7 1995 People Capability Maturity
International Nuclear Information System (INIS)
Dobranich, Dean; Blanchat, Thomas K.
2008-01-01
Sandia National Laboratories, as a Department of Energy, National Nuclear Security Agency, has major responsibility to ensure the safety and security needs of nuclear weapons. As such, with an experienced research staff, Sandia maintains a spectrum of modeling and simulation capabilities integrated with experimental and large-scale test capabilities. This expertise and these capabilities offer considerable resources for addressing issues of interest to the space power and propulsion communities. This paper presents Sandia's capability to perform thermal qualification (analysis, test, modeling and simulation) using a representative weapon system as an example demonstrating the potential to support NASA's Lunar Reactor System
Unpacking dynamic capability : a design perspective
Mulders, D.E.M.; Romme, A.G.L.; Bøllingtoft, A.; Håkonsson, D.D.; Nielsen, J.F.; Snow, C.C; Ulhøi, J.
2009-01-01
This chapter reviews the dynamic capability literature to explore relationships between definition, operationalization, and measurement of dynamic capability. Subsequently, we develop a design-oriented approach toward dynamic capability that distinguishes between design rules, recurrent patterns of
Summary of Sandia Laboratories technical capabilities
International Nuclear Information System (INIS)
1977-05-01
The technical capabilities of Sandia Laboratories are detailed in a series of companion reports. In this summary the use of the capabilities in technical programs is outlined and the capabilities are summarized. 25 figures, 3 tables
Sandia Laboratories technical capabilities: testing
International Nuclear Information System (INIS)
Lundergan, C.D.
1975-12-01
The testing capabilities at Sandia Laboratories are characterized. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs
International Nuclear Information System (INIS)
Hembree, D.M.; Carter, J.A.; Hinton, E.R. Jr.
2002-01-01
Full text: The Oak Ridge Y-12 National Security Complex has been involved in the U.S. nuclear weapons program since the program's inception in the 1940's. Known as the U.S. 'Fort Knox of uranium', the site is also a repository of unique expertise and experience related to enriched uranium and other weapons-related materials. Y-12's Analytical Chemistry Organization (ACO) contains a wide range of analytical instrumentation that has demonstrated the ability to provide important forensic information in a short period of time. This rapid response capability is in part due to having all of the analytical instrumentation and expertise contained in one building, within one organization. Rapid-response teams are easily formed to quickly obtain key information. The infrastructure to handle nuclear materials, e.g. chain-of-custody, radiological control, information management, etc. is maintained for normal operations. As a result, the laboratory has demonstrated the capability for rapid response times for nuclear forensic samples. This poster presentation will discuss Y-12's analytical capabilities and the importance of key instruments and highly trained personnel in providing critical information. The laboratory has collaborated with both state and federal law enforcement agencies to analyze non-nuclear forensic evidence. Y-12's participation in two nuclear forensic events, as part of multi-laboratory teams, will be described. (author)
Capability Development in an Offshoring Context
DEFF Research Database (Denmark)
Jaura, Manya
Capability development can be defined as deliberate firm-level investment involving a search and learning process aimed at modifying or enhancing existing capabilities. Increasingly, firms are relocating advanced services to offshore locations resulting in the challenge of capability development ...
Consolidating AMC’s Contingency Response Capabilities: A Delphi Study
2015-06-19
Africa in support of Operation UNITED ASSISTANCE, the international response to contain the Ebola epidemic (US Transportation Command, 2014). Though JTF...DO, 2015). The deployment of the 817 CRG to Liberia also underutilized its full capacity as only 79 Airmen and 10 Soldiers of the 140-member JTF-PO...pdf 89 Gonzalez, G. S. (2014, November 13). JTF-PO Leaves Liberia . Retrieved from US Air Force Expeditionary Center: http
Sandia Laboratories technical capabilities: electronics
International Nuclear Information System (INIS)
Lundergan, C.D.
1975-12-01
This report characterizes the electronics capabilities at Sandia Laboratories. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs
Combining Land Capability Evaluation, Geographic Information ...
African Journals Online (AJOL)
Combining Land Capability Evaluation, Geographic Information Systems, AnD Indigenous Technologies for Soil Conservation in Northern Ethiopia. ... Land capability and land use status were established following the procedures of a modified treatment-oriented capability classification using GIS. The case study ...
A Human Development and Capabilities "Prospective Analysis" of Global Higher Education Policy
Walker, Melanie
2010-01-01
In global times, university education policy that holds the greatest promise for social responsibility is the focus here; the argument made is that such policy ought to be conceptualised using a normative human development and capabilities approach, drawing on the work of Amartya Sen and Martha Nussbaum. Their ideas offer a values-based way of…
Crisis management, capabilities and preparedness: the case of public hospitals in Iran.
Najafbagy, Reza
2010-01-01
Crises occurred in recent decades show that organizations' preparedness to predict and respond to undesired problems is directly related to the degree of their capabilities and preparedness to manage crises in this context, hospitals compared to other organizations are more viable to suffer damages if a crisis occurs. This study investigates the degree of public hospitals capabilities and preparedness to handled possible crises. Responses from hospital managers and directors show that most of them were not familiar with crisis management, while majority of them mentioned that they had crisis management plan and committee in their hospitals. Moreover, most of the respondents believed that if a crisis occurs in the hospital, patients, personnel and documents will be the first victims of the crisis. The study also indicates that having a crisis plan and crisis committee without being familiar with knowledge of crisis management, do not help managers to cope with crisis. Moreover, correlations show that older managers were more familiar with crisis management experiences abroad, and defined responsibilities contributed to setting up crisis committee, and taking crisis seriously.
On the formal definition of the systems' interoperability capability: an anthropomorphic approach
Zdravković, Milan; Luis-Ferreira, Fernando; Jardim-Goncalves, Ricardo; Trajanović, Miroslav
2017-03-01
The extended view of enterprise information systems in the Internet of Things (IoT) introduces additional complexity to the interoperability problems. In response to this, the problem of systems' interoperability is revisited by taking into the account the different aspects of philosophy, psychology, linguistics and artificial intelligence, namely by analysing the potential analogies between the processes of human and system communication. Then, the capability to interoperate as a property of the system, is defined as a complex ability to seamlessly sense and perceive a stimulus from its environment (assumingly, a message from any other system), make an informed decision about this perception and consequently, articulate a meaningful and useful action or response, based on this decision. Although this capability is defined on the basis of the existing interoperability theories, the proposed approach to its definition excludes the assumption on the awareness of co-existence of two interoperating systems. Thus, it establishes the links between the research of interoperability of systems and intelligent software agents, as one of the systems' digital identities.
Accelerator and Electrodynamics Capability Review
International Nuclear Information System (INIS)
Jones, Kevin W.
2010-01-01
Los Alamos National Laboratory (LANL) uses capability reviews to assess the science, technology and engineering (STE) quality and institutional integration and to advise Laboratory Management on the current and future health of the STE. Capability reviews address the STE integration that LANL uses to meet mission requirements. The Capability Review Committees serve a dual role of providing assessment of the Laboratory's technical contributions and integration towards its missions and providing advice to Laboratory Management. The assessments and advice are documented in reports prepared by the Capability Review Committees that are delivered to the Director and to the Principal Associate Director for Science, Technology and Engineering (PADSTE). Laboratory Management will use this report for STE assessment and planning. LANL has defined fifteen STE capabilities. Electrodynamics and Accelerators is one of the seven STE capabilities that LANL Management (Director, PADSTE, technical Associate Directors) has identified for review in Fiscal Year (FY) 2010. Accelerators and electrodynamics at LANL comprise a blend of large-scale facilities and innovative small-scale research with a growing focus on national security applications. This review is organized into five topical areas: (1) Free Electron Lasers; (2) Linear Accelerator Science and Technology; (3) Advanced Electromagnetics; (4) Next Generation Accelerator Concepts; and (5) National Security Accelerator Applications. The focus is on innovative technology with an emphasis on applications relevant to Laboratory mission. The role of Laboratory Directed Research and Development (LDRD) in support of accelerators/electrodynamics will be discussed. The review provides an opportunity for interaction with early career staff. Program sponsors and customers will provide their input on the value of the accelerator and electrodynamics capability to the Laboratory mission.
Accelerator and electrodynamics capability review
Energy Technology Data Exchange (ETDEWEB)
Jones, Kevin W [Los Alamos National Laboratory
2010-01-01
Los Alamos National Laboratory (LANL) uses capability reviews to assess the science, technology and engineering (STE) quality and institutional integration and to advise Laboratory Management on the current and future health of the STE. Capability reviews address the STE integration that LANL uses to meet mission requirements. The Capability Review Committees serve a dual role of providing assessment of the Laboratory's technical contributions and integration towards its missions and providing advice to Laboratory Management. The assessments and advice are documented in reports prepared by the Capability Review Committees that are delivered to the Director and to the Principal Associate Director for Science, Technology and Engineering (PADSTE). Laboratory Management will use this report for STE assessment and planning. LANL has defined fifteen STE capabilities. Electrodynamics and Accelerators is one of the seven STE capabilities that LANL Management (Director, PADSTE, technical Associate Directors) has identified for review in Fiscal Year (FY) 2010. Accelerators and electrodynamics at LANL comprise a blend of large-scale facilities and innovative small-scale research with a growing focus on national security applications. This review is organized into five topical areas: (1) Free Electron Lasers; (2) Linear Accelerator Science and Technology; (3) Advanced Electromagnetics; (4) Next Generation Accelerator Concepts; and (5) National Security Accelerator Applications. The focus is on innovative technology with an emphasis on applications relevant to Laboratory mission. The role of Laboratory Directed Research and Development (LDRD) in support of accelerators/electrodynamics will be discussed. The review provides an opportunity for interaction with early career staff. Program sponsors and customers will provide their input on the value of the accelerator and electrodynamics capability to the Laboratory mission.
Does STES-Oriented Science Education Promote 10th-Grade Students' Decision-Making Capability?
Levy Nahum, Tami; Ben-Chaim, David; Azaiza, Ibtesam; Herskovitz, Orit; Zoller, Uri
2010-07-01
Today's society is continuously coping with sustainability-related complex issues in the Science-Technology-Environment-Society (STES) interfaces. In those contexts, the need and relevance of the development of students' higher-order cognitive skills (HOCS) such as question-asking, critical-thinking, problem-solving and decision-making capabilities within science teaching have been argued by several science educators for decades. Three main objectives guided this study: (1) to establish "base lines" for HOCS capabilities of 10th grade students (n = 264) in the Israeli educational system; (2) to delineate within this population, two different groups with respect to their decision-making capability, science-oriented (n = 142) and non-science (n = 122) students, Groups A and B, respectively; and (3) to assess the pre-post development/change of students' decision-making capabilities via STES-oriented HOCS-promoting curricular modules entitled Science, Technology and Environment in Modern Society (STEMS). A specially developed and validated decision-making questionnaire was used for obtaining a research-based response to the guiding research questions. Our findings suggest that a long-term persistent application of purposed decision-making, promoting teaching strategies, is needed in order to succeed in affecting, positively, high-school students' decision-making ability. The need for science teachers' involvement in the development of their students' HOCS capabilities is thus apparent.
Enhancing Financial Capability and Inclusion in the Philippines : A Demand-Side Survey
World Bank Group
2015-01-01
In response to a request of the Bangko Sentral ng Pilipinas (BSP) and as part of a broader engagement on enhancing financial consumer protection and education in the Philippines, the World Bank has implemented a financial capability survey. Financial inclusion, financial literacy and consumer protection are important priorities for the BSP and the Philippines government. Consumer protectio...
Quantumness-generating capability of quantum dynamics
Li, Nan; Luo, Shunlong; Mao, Yuanyuan
2018-04-01
We study quantumness-generating capability of quantum dynamics, where quantumness refers to the noncommutativity between the initial state and the evolving state. In terms of the commutator of the square roots of the initial state and the evolving state, we define a measure to quantify the quantumness-generating capability of quantum dynamics with respect to initial states. Quantumness-generating capability is absent in classical dynamics and hence is a fundamental characteristic of quantum dynamics. For qubit systems, we present an analytical form for this measure, by virtue of which we analyze several prototypical dynamics such as unitary dynamics, phase damping dynamics, amplitude damping dynamics, and random unitary dynamics (Pauli channels). Necessary and sufficient conditions for the monotonicity of quantumness-generating capability are also identified. Finally, we compare these conditions for the monotonicity of quantumness-generating capability with those for various Markovianities and illustrate that quantumness-generating capability and quantum Markovianity are closely related, although they capture different aspects of quantum dynamics.
Clinical capabilities of graduates of an outcomes-based integrated medical program
Directory of Open Access Journals (Sweden)
Scicluna Helen A
2012-06-01
Full Text Available Abstract Background The University of New South Wales (UNSW Faculty of Medicine replaced its old content-based curriculum with an innovative new 6-year undergraduate entry outcomes-based integrated program in 2004. This paper is an initial evaluation of the perceived and assessed clinical capabilities of recent graduates of the new outcomes-based integrated medical program compared to benchmarks from traditional content-based or process-based programs. Method Self-perceived capability in a range of clinical tasks and assessment of medical education as preparation for hospital practice were evaluated in recent graduates after 3 months working as junior doctors. Responses of the 2009 graduates of the UNSW’s new outcomes-based integrated medical education program were compared to those of the 2007 graduates of UNSW’s previous content-based program, to published data from other Australian medical schools, and to hospital-based supervisor evaluations of their clinical competence. Results Three months into internship, graduates from UNSW’s new outcomes-based integrated program rated themselves to have good clinical and procedural skills, with ratings that indicated significantly greater capability than graduates of the previous UNSW content-based program. New program graduates rated themselves significantly more prepared for hospital practice in the confidence (reflective practice, prevention (social aspects of health, interpersonal skills (communication, and collaboration (teamwork subscales than old program students, and significantly better or equivalent to published benchmarks of graduates from other Australian medical schools. Clinical supervisors rated new program graduates highly capable for teamwork, reflective practice and communication. Conclusions Medical students from an outcomes-based integrated program graduate with excellent self-rated and supervisor-evaluated capabilities in a range of clinically-relevant outcomes. The program
Distinctive Dynamic Capabilities for New Business Creation
DEFF Research Database (Denmark)
Rosenø, Axel; Enkel, Ellen; Mezger, Florian
2013-01-01
This study examines the distinctive dynamic capabilities for new business creation in established companies. We argue that these are very different from those for managing incremental innovation within a company's core business. We also propose that such capabilities are needed in both slow...... and fast-paced industries, and that similarities exist across industries. Hence, the study contributes to dynamic capabilities literature by: 1) identifying the distinctive dynamic capabilities for new business creation; 2) shifting focus away from dynamic capabilities in environments characterised by high...... clock-speed and uncertainty towards considering dynamic capabilities for the purpose of developing new businesses, which also implies a high degree of uncertainty. Based on interviews with 33 companies, we identify distinctive dynamic capabilities for new business creation, find that dynamic...
Organisational Capability--What Does It Mean?
National Centre for Vocational Education Research (NCVER), 2006
2006-01-01
Organisational capability is rapidly becoming recognized as the key to organizational success. However, the lack of research on it has been well documented in the literature, and organizational capability remains an elusive concept. Yet an understanding of organizational capability can offer insights into how RTOs might work most effectively,…
Friedberg, Mark W; Coltin, Kathryn L; Safran, Dana Gelb; Dresser, Marguerite; Zaslavsky, Alan M; Schneider, Eric C
2009-10-06
Recent proposals to reform primary care have encouraged physician practices to adopt such structural capabilities as performance feedback and electronic health records. Whether practices with these capabilities have higher performance on measures of primary care quality is unknown. To measure associations between structural capabilities of primary care practices and performance on commonly used quality measures. Cross-sectional analysis. Massachusetts. 412 primary care practices. During 2007, 1 physician from each participating primary care practice (median size, 4 physicians) was surveyed about structural capabilities of the practice (responses representing 308 practices were obtained). Data on practice structural capabilities were linked to multipayer performance data on 13 Healthcare Effectiveness Data and Information Set (HEDIS) process measures in 4 clinical areas: screening, diabetes, depression, and overuse. Frequently used multifunctional electronic health records were associated with higher performance on 5 HEDIS measures (3 in screening and 2 in diabetes), with statistically significant differences in performance ranging from 3.1 to 7.6 percentage points. Frequent meetings to discuss quality were associated with higher performance on 3 measures of diabetes care (differences ranging from 2.3 to 3.1 percentage points). Physician awareness of patient experience ratings was associated with higher performance on screening for breast cancer and cervical cancer (1.9 and 2.2 percentage points, respectively). No other structural capabilities were associated with performance on more than 1 measure. No capabilities were associated with performance on depression care or overuse. Structural capabilities of primary care practices were assessed by physician survey. Among the investigated structural capabilities of primary care practices, electronic health records were associated with higher performance across multiple HEDIS measures. Overall, the modest magnitude and
Community psychology and the capabilities approach.
Shinn, Marybeth
2015-06-01
What makes for a good life? The capabilities approach to this question has much to offer community psychology, particularly with respect to marginalized groups. Capabilities are freedoms to engage in valued social activities and roles-what people can do and be given both their capacities, and environmental opportunities and constraints. Economist Amartya Sen's focus on freedoms and agency resonates with psychological calls for empowerment, and philosopher Martha Nussbaum's specification of requirements for a life that is fully human provides an important guide for social programs. Community psychology's focus on mediating structures has much to offer the capabilities approach. Parallels between capabilities, as enumerated by Nussbaum, and settings that foster positive youth development, as described in a National Research Council Report (Eccles and Gootman (Eds) in Community programs to promote youth development. National Academy Press, Washington, 2002) suggest extensions of the approach to children. Community psychologists can contribute to theory about ways to create and modify settings to enhance capabilities as well as empowerment and positive youth development. Finally, capabilities are difficult to measure, because they involve freedoms to choose but only choices actually made or enacted can be observed. The variation in activities or goals across members of a setting provides a measure of the capabilities that the setting fosters.
Turtle Hearing Capability Based on ABR Signal assessment
Directory of Open Access Journals (Sweden)
Raja Bidin Raja Hassan
2010-08-01
Full Text Available Sea turtles have existed for millions of years. International Union for Conservation of Nature (IUCN has reported that the Hawksbill Turtle (Eretmochelys imbricata is classified as critically endangered. Turtle excluder device (TED deployment on shrimpnet fisheries is needed for turtle conservation.TED using sound technique is challenge method in fisheries development.The knowledge on turtle hearing capability is limited. The auditory brainstem response (ABR assessment is method to determine turtle hearing capability. Turtle hearing assessment is basis to design TED. The objective of this paper is to determine turtle hearing cability by analyze its ABR spectral.The subject is Hawksbill turtle with number 2 turtles ie: 3 and 2 years. The measurement was taken at Pusat Pengurusan Penyu (Turtle Management Centre Padang Kemunting Masjid Tanah Melaka Malaysia. The results shows that turtle 3 years have peak power frequencies 50.78, 101.6, 152.3, 304.7, 355.5, 457, and 507.8Hz respectively whereas the spectral amplitude is ranging 0.03-32.44% spectral. Turtle 2 years has peak power at 457Hz in whole stimulus frequencies while the spectral amplitude is ranging 0.01-2.5% spectral.
Directory of Open Access Journals (Sweden)
Tiantian Gao
2014-10-01
Full Text Available Purpose: A critical issue has been absent from the conversation on supply chain coordination: how supply chain coordination influence the enterprise performance. This research proposes a new vision to research the performance mechanism of supply chain coordination capability as a dynamic capability. Manufacturing capabilities are existed as mediating role. Design/methodology/approach: Data from International Manufacturing Strategy Survey in 2009 is used to verify the mediating model by hierarchical regression analysis. Findings: The results show that supply chain coordination impacts the enterprise performance positively and indirect impacts the enterprise performance through quality, cost, flexibility. Research implications: This study presents an overview of the impact of supply chain coordination and manufacturing capabilities on enterprise performance, giving grasp for further research of the relationships that exist between them. Originality/value: This finding integrates insights from previous research in dynamic capability framework and supply chain management into a generalization and extension of the performance mechanism in manufacturing enterprises.
Technological Dynamics and Social Capability
DEFF Research Database (Denmark)
Fagerberg, Jan; Feldman, Maryann; Srholec, Martin
2014-01-01
for the sample as a whole between 1998 and 2008. The results indicate that social capabilities, such as well-developed public knowledge infrastructure, an egalitarian distribution of income, a participatory democracy and prevalence of public safety condition the growth of technological capabilities. Possible...
ompW is cooperatively upregulated by MarA and SoxS in response to menadione.
Collao, B; Morales, E H; Gil, F; Calderón, I L; Saavedra, C P
2013-04-01
OmpW is a minor porin whose biological function has not been clearly defined. Evidence obtained in our laboratory indicates that in Salmonella enterica serovar Typhimurium the expression of OmpW is activated by SoxS upon exposure to paraquat and it is required for resistance. SoxS belongs to the AraC family of transcriptional regulators, like MarA and Rob. Due to their high structural similarity, the genes under their control have been grouped in the mar/sox/rob regulon, which presents a DNA-binding consensus sequence denominated the marsox box. In this work, we evaluated the role of the transcription factors MarA, SoxS and Rob of S. enterica serovar Typhimurium in regulating ompW expression in response to menadione. We determined the transcript and protein levels of OmpW in different genetic backgrounds; in the wild-type and Δrob strains ompW was upregulated in response to menadione, while in the ΔmarA and ΔsoxS strains the induction was abolished. In a double marA soxS mutant, ompW transcript levels were lowered after exposure to menadione, and only complementation in trans with both genes restored the positive regulation. Using transcriptional fusions and electrophoretic mobility shift assays with mutant versions of the promoter region we demonstrated that two of the predicted sites were functional. Additionally, we demonstrated that MarA increases the affinity of SoxS for the ompW promoter region. In conclusion, our study shows that ompW is upregulated in response to menadione in a cooperative manner by MarA and SoxS through a direct interaction with the promoter region.
Directory of Open Access Journals (Sweden)
Crain Soudien
2013-11-01
Full Text Available The purpose of this essay is to reflect on how we in South Africa are managing the task of higher education in an environment marked by poverty. The paper makes the argument that the question of how to proceed when considering the relationship between the phenomenon of poverty and the experience of education is regularly resolved through invoking the syllogism that increased levels of education will bring about increased levels of income. Drawing on Sen and his ideas of capability deprivation, it is contended here that income-deprivation ideas by themselves do not adequately encompass the full complexity of how deprivation works. The approach taken here, therefore, is different. It works with the proposition that education needs to respond to the full range of social, cultural and other inhibiting factors with respect to the development of capabilities. Positing, therefore, the contention that human beings need to flourish in all the areas of their social lives and not just the space of work, the paper argues for the need to develop an education system that works with capabilities that are valuable in the full range of social spaces young South Africans inhabit. Using this introduction as a point of departure, the paper begins with an attempt at characterising the phenomenon of poverty and then moves on to look at the challenges the sector faces in teaching and learning with respect to it. Thereafter it provides an overview of the sector’s responses to these challenges and finally, drawing on the idea of capability deprivation, makes a critical assessment of these responses.
Energy Technology Data Exchange (ETDEWEB)
Stammberger, I.; Tempel, K. (Muenchen Univ. (Germany, F.R.). Inst. fuer Pharmakologie und Toxikologie); Schmahl, W. (Gesellschaft fuer Strahlen- und Umweltforschung m.b.H. Muenchen, Neuherberg (Germany, F.R.). Inst. fuer Pathologie)
1989-09-01
Three hours following X-irradiation of chick embryos with doses of 4 and 8 Gy the in vitro incorporation of tritiated thymidine (({sup 3}H)dT) into DNA (scheduled DNA synthesis, ss) of hepatocytes was reduced to about one-third. Within 24 h after the exposure, ss returned to control values. The return of ss to a normal rate could be strongly inhibited by 2', 3'-dideoxythymidine (ddT), and to a lesser extent by 1-beta-D-arabinofuranosylcytosine (araC). In strong contrast to ss, the hydroxyurea (hu)-resistant ({sup 3)H}dT incorporation (unscheduled DNA synthesis, us) showed a highly significant increase 24 h after treatment of the embryos with araC and/or X-irradiation. Autoradiographic studies revealed no change of total ({sup 3}H)dT labelling frequency in the whole chick embryo liver 24 h after treatment with araC and/or X-irradiation, but a persistent depression of ss and a simultaneous increase of us. (author).
Directory of Open Access Journals (Sweden)
Ahmad EI
2011-07-01
Full Text Available Ebtesam I Ahmad, Heba H Gawish, Nashwa MA Al Azizi, Ashraf M ElhefniClinical Pathology Department, Hematology and Oncology Unit of Internal Medicine Department, Faculty of Medicine, Zagazig University, Sharkia, EgyptBackground: Activating point mutation of the RAS gene has been generally accepted as an oncogenic event in a variety of malignancies. It represents one of the most common genetic alterations in acute myeloid leukemia (AML. However, little is known about its clinical relevance in the treatment outcome for this leukemia.Objective: This study aimed to clarify the biologic and prognostic impact of K-RAS mutations in relation to the dose of cytarabine (ara-C used in postinduction consolidation chemotherapy in adult AML patients.Patients and methods: The study comprised of 71 de novo AML patients with male/female ratio 1.4:1; their ages ranged from 21–59 years with a median of 37 years. They were subjected to full clinical evaluation, routine laboratory investigations, cytogenetic studies by G-banding (Giemsa staining, and K-RAS mutation detection using real-time polymerase chain reaction. The patients were randomized into two groups according to the ara-C dose used in consolidation treatment, the high the dose ara-C (HDAC group receiving 400 mg ara-C and-low-dose ara-C (LDAC group receiving 100 mg ara-C; they were followed over a period of five years.Results: Mutations in the K-RAS gene (mutRAS were detected in 23 patients (32% with the remaining 48 patients (68% having wild-type RAS (wtRAS. The percent of blast cells was significantly lower in mutRAS compared to wtRAS patients (P ≤ 0.001 while M4 subtype of AML and Inv(16 frequencies were significantly higher in mutRAS compared to wtRAS patients (P = 0.015 and (P = 0.003, respectively. The patients were followed up for a median of 43 months (range 11–57 months. There was no significant difference in overall survival (OS between mutRAS and wtRAS (P = 0.326. Within the mut
Information Fusion and Extraction Priorities for Australia’s Information Capability
2004-03-01
also been in response to the global threats of terrorism and the utilisation of weapons of mass destruction or long-range ballistic missiles by...missiles and weapons of mass destruction by rogue states [4]. Accordingly, “maintaining first-rate intelligence capabilities, developing a comprehensive...number of customised views. For example, temporal data based on a particular activity may be displayed in a variety of modes on a grid or clock face
Managing corporate capabilities:theory and industry approaches.
Energy Technology Data Exchange (ETDEWEB)
Slavin, Adam M.
2007-02-01
This study characterizes theoretical and industry approaches to organizational capabilities management and ascertains whether there is a distinct ''best practice'' in this regard. We consider both physical capabilities, such as technical disciplines and infrastructure, and non-physical capabilities such as corporate culture and organizational procedures. We examine Resource-Based Theory (RBT), which is the predominant organizational management theory focused on capabilities. RBT seeks to explain the effect of capabilities on competitiveness, and thus provide a basis for investment/divestment decisions. We then analyze industry approaches described to us in interviews with representatives from Goodyear, 3M, Intel, Ford, NASA, Lockheed Martin, and Boeing. We found diversity amongst the industry capability management approaches. Although all organizations manage capabilities and consider them to some degree in their strategies, no two approaches that we observed were identical. Furthermore, we observed that theory is not a strong driver in this regard. No organization used the term ''Resource-Based Theory'', nor did any organization mention any other guiding theory or practice from the organizational management literature when explaining their capabilities management approaches. As such, we concluded that there is no single best practice for capabilities management. Nevertheless, we believe that RBT and the diverse industry experiences described herein can provide useful insights to support development of capabilities management approaches.
Y-12 defense programs. Nuclear Packaging Systems testing capabilities
International Nuclear Information System (INIS)
1995-06-01
The Nuclear Packaging Systems (NPS) Department can manage/accomplish any packaging task. The NPS organization is responsible for managing the design, testing, certification, procurement, operation, refurbishment, maintenance, and disposal of packaging used to transport radioactive materials, other hazardous materials, and general cargoes on public roads and within the Oak Ridge Y-12 Plant. Additionally, the NPS Department has developed a Quality Assurance plan for all packaging, design and procurement of nonweapon shipping containers for radioactive materials, and design and procurement of performance-oriented packaging for hazardous materials. Further, the NPS Department is responsible for preparation and submittal of Safety Analysis Reports for Packaging (SARP). The NPS Department coordinates shipping container procurement and safety certification activities that have lead-times of up to two years. A Packaging Testing Capabilities Table at the Oak Ridge complex is included as a table
Capabilities and Equality of Health II
DEFF Research Database (Denmark)
Keiding, Hans
The concept of capabilities, introduced originally by Sen, has inspired many researchers but has not found any simple formal representation which might be instrumental in the construction of a comprehensive theory of equality. In a previous paper (Keiding, 2005), we investigated whether preferences...... of the capability approach to questions of health or equality. In the present paper we extend the notion of rationalizing orderings of capabilities to a dynamical context, in the sense that the utility function is not yet revealed to the individual at the time when the capabilities are ordered. It turns out...... over capabilities as sets of functionings can be rationalized by maximization of a suitable utility function over the set of functionings. Such a rationalization turned out to be possible only in cases which must be considered exceptional and which do not allowfor interesting applications...
National Research Council Canada - National Science Library
Love, John
1998-01-01
... (Special Operations Capable) (MEU (SOC) to determine their relative validity. The methodology utilizes a multiple criteria decision-making model to determine the relative validity of each MEU (SOC) capability...
Signaling the End of Deterrence Afforded by Dual Capable Aircraft
2017-04-06
what might happen in response to a Soviet attack would make extended nuclear deterrence work .”3 Schelling advocated for the deployment of...strategic forces to possess an array of offensive and defensive 3 capabilities to limit damage to the US using an imbalance of terror argument...initiated a $8.9B B61 Life Extension Program (LEP).18 Dubbed the B61-12, the new variant of the B61 is intended to replace all previous variants (-3, -4
Joyce, Michael; Pollock, Brad H.; Devidas, Meenakshi; Buchanan, George; Camitta, Bruce
2013-01-01
Children with acute lymphocytic leukemia (ALL) who fail to enter remission have a poor prognosis. In a previous study, 9 of 14 children with induction failure entered remission after teniposide (VM26) plus cytosine arabinoside (Ara-C). We attempted to confirm these results. Twenty children received teniposide (200 mg/m2/day IV) for 3 days and cytosine arabinoside (100 mg/m2/day continuous IV infusion) for 7 days. There were 3 complete and 3 partial responses. Two additional patients achieved ...
DEFF Research Database (Denmark)
Jensen, Niels Rosendal; Kjeldsen, Christian Christrup
Lærebogen er den første samlede danske præsentation af den af Amartya Sen og Martha Nussbaum udviklede Capability Approach. Bogen indeholder en præsentation og diskussion af Sen og Nussbaums teoretiske platform. I bogen indgår eksempler fra såvel uddannelse/uddannelsespolitik, pædagogik og omsorg....
Item Response Data Analysis Using Stata Item Response Theory Package
Yang, Ji Seung; Zheng, Xiaying
2018-01-01
The purpose of this article is to introduce and review the capability and performance of the Stata item response theory (IRT) package that is available from Stata v.14, 2015. Using a simulated data set and a publicly available item response data set extracted from Programme of International Student Assessment, we review the IRT package from…
The impact of a leadership development programme on nurses' self-perceived leadership capability.
Paterson, Karyn; Henderson, Amanda; Burmeister, Elizabeth
2015-11-01
This paper reports on the outcomes of a locally designed educational programme to support leadership capability of junior registered nurses. The Developing Leader Programme is an in-house programme delivered in three face-to-face workshops, comprising self-directed reflective and application activities. Surveys were used to evaluate self-perceived leadership capability over a 9-month period. The survey comprised a Leadership Capability Instrument adapted from two existing tools. Participants completed surveys at the commencement of the programme, after the third and final workshop and approximately 6 months afterwards. In addition, examples of descriptive accounts of programme activities submitted by individual participants were included to enrich data. Of 124 participants, 79 completed surveys at the first workshop, 28 at the final workshop and 31 were returned 6 months after completion of the programme. Mean scores for each area of leadership capability significantly improved throughout the duration of the programme (P leadership behaviours through reported activities. Survey responses indicated that participants perceived improved leadership capability after completing the Developing Leader Programme. Early educational intervention to facilitate the development of leadership skills as well as clinical skills in junior registered nurses can assist with how they interact with the team. Participation of junior registered nurses in a locally designed leadership programme can assist them to develop leadership behaviours for everyday practice. © 2014 John Wiley & Sons Ltd.
CASL Dakota Capabilities Summary
Energy Technology Data Exchange (ETDEWEB)
Adams, Brian M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Simmons, Chris [Univ. of Texas, Austin, TX (United States); Williams, Brian J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-10-10
The Dakota software project serves the mission of Sandia National Laboratories and supports a worldwide user community by delivering state-of-the-art research and robust, usable software for optimization and uncertainty quantification. These capabilities enable advanced exploration and riskinformed prediction with a wide range of computational science and engineering models. Dakota is the verification and validation (V&V) / uncertainty quantification (UQ) software delivery vehicle for CASL, allowing analysts across focus areas to apply these capabilities to myriad nuclear engineering analyses.
Statistical methods for quality assurance basics, measurement, control, capability, and improvement
Vardeman, Stephen B
2016-01-01
This undergraduate statistical quality assurance textbook clearly shows with real projects, cases and data sets how statistical quality control tools are used in practice. Among the topics covered is a practical evaluation of measurement effectiveness for both continuous and discrete data. Gauge Reproducibility and Repeatability methodology (including confidence intervals for Repeatability, Reproducibility and the Gauge Capability Ratio) is thoroughly developed. Process capability indices and corresponding confidence intervals are also explained. In addition to process monitoring techniques, experimental design and analysis for process improvement are carefully presented. Factorial and Fractional Factorial arrangements of treatments and Response Surface methods are covered. Integrated throughout the book are rich sets of examples and problems that help readers gain a better understanding of where and how to apply statistical quality control tools. These large and realistic problem sets in combination with the...
Understanding dynamic capabilities through knowledge management
DEFF Research Database (Denmark)
Nielsen, Anders Paarup
2006-01-01
In the paper eight knowledge management activities are identified; knowledge creation, acquisition, capture, assembly, sharing, integration, leverage and exploitation. These activities are assembled into the three dynamic capabilities of knowledge development, knowledge (re......)combination and knowledge use. The dynamic capabilities and the associated knowledge management activities create flows to and from the firm’s stock of knowledge and they support the creation and use of organizational capabilities....
Technological Capability's Predictor Variables
Directory of Open Access Journals (Sweden)
Fernanda Maciel Reichert
2011-03-01
Full Text Available The aim of this study was to identify the factors that influence in configuration of the technological capability of companies in sectors with medium-low technological intensity. To achieve the goal proposed in this article a survey was carried out. Based on the framework developed by Lall (1992 which classifies firms in basic, intermediate and advanced level of technological capability; it was found that the predominant technological capability is intermediate, with 83.7% of respondent companies (plastics companies in Brazil. It is believed that the main contribution of this study is the finding that the dependent variable named “Technological Capability” can be explained at a rate of 65% by six variables: development of new processes; selection of the best equipment supplier; sales of internally developed new technology to third parties; design and manufacture of equipment; study of the work methods and perform inventory control; and improvement of product quality.
Dynamic capabilities and innovation management: a conceptual approach
Directory of Open Access Journals (Sweden)
Jose Javier Aguilar Zambrano
2006-07-01
Full Text Available Organizational capabilities are those behavioral routines oriented to develop a specific task (NELSON; WINTER, 1982. These capabilities define what the company knows to do and how must to do it. Nevertheless, the repetitive character of these capabilities could be producing stopped processes (METCALFE, 1995 which both limit the generation of new capabilities and diminishing the dynamism in the production, reproduction and reconfiguration of new capabilities (TEECE; PISANO, 1997. This article compares and analyzes different theoretical-conceptual perspectives for generation and reconfiguration of technological capabilities within an organization. Additionally this article suggests that dynamic capabilities to make feasible innovation processes within an organization. The general concept of dynamic capacities will be used like driver of changes to produce and reconfigurate capabilities in the organization. The glance of the dynamic capabilities allows understanding the complexity of the creation, development and use of capabilities. This understanding could constitute material fundamental to manage learning processes and organizational change oriented to innovation.
Human Exploration Systems and Mobility Capability Roadmap Progress Review
Culbert, Chris; Taylor, Jeff
2005-01-01
Contents include the following: Capability Roadmap Team. Capability Description and Capability Breakdown Structure. Benefits of the Human Systems and Mobility Capability. Roadmap Process and Approach. Drivers and Assumptions for the whole team. Current State-of-the-Art, Assumptions and Requirements will be covered in the appropriate sections. Capability Presentations by Leads under Roadmap (Repeated for each capability under roadmap). Capability Description, Benefits, Current State-of-the-Art. Capability Requirements and Assumptions. Roadmap for Capability. Capability Readiness Level. Technology Readiness Level. Figures of Merit. Summary of Top Level Capability. Significant Technical Challenges. Summary and Forward Work.
Spill response exercises and lessons learned : a response organization's perspective
International Nuclear Information System (INIS)
Taylor, E.; Green, M.
2001-01-01
In the past five years, Burrard Clean Operations (BCO) has demonstrated its' oil spill response capabilities through different types of exercises. Such exercises are necessary for certification of Response Organizations in Canada. The exercises can be performed through actual response to spills or through simulated situations. Both can provide an opportunity to practice different levels of response to a range of conditions in various settings. They also provide the opportunity to focus on specific themes that can be part of a response and to identify areas for improvement in response actions. They also make it possible to interface with government agencies, industry and others that participate in spill responses. The exercise program for BCO is aimed at maintaining certification and to assist the Canadian Coast Guard. The exercises broaden the lessons learned and set a course for future enhancement to spill readiness should a real incident occur. The goals of the exercise program are to provide real time drills that show the operational capability of a representative sample of BCO equipment, management and trained spill responders. The response functions of the BCO exercise program are: notification, response organization activation, contractor activation, situation analysis, strategy development for marine oil spill response, site safety, equipment deployment, containment, recovery, shoreline assessment, cleanup, communications, decontamination, logistics, and financial management. The BCO experience has led to the basic conclusions that there is a need to vary the exercise design and format and that there is a need to implement follow-up actions provided during exercise evaluations. 7 refs., 3 tabs
Olejarski, Michael; Appleton, Amy; Deltorchio, Stephen
2009-01-01
The Group Capability Model (GCM) is a software tool that allows an organization, from first line management to senior executive, to monitor and track the health (capability) of various groups in performing their contractual obligations. GCM calculates a Group Capability Index (GCI) by comparing actual head counts, certifications, and/or skills within a group. The model can also be used to simulate the effects of employee usage, training, and attrition on the GCI. A universal tool and common method was required due to the high risk of losing skills necessary to complete the Space Shuttle Program and meet the needs of the Constellation Program. During this transition from one space vehicle to another, the uncertainty among the critical skilled workforce is high and attrition has the potential to be unmanageable. GCM allows managers to establish requirements for their group in the form of head counts, certification requirements, or skills requirements. GCM then calculates a Group Capability Index (GCI), where a score of 1 indicates that the group is at the appropriate level; anything less than 1 indicates a potential for improvement. This shows the health of a group, both currently and over time. GCM accepts as input head count, certification needs, critical needs, competency needs, and competency critical needs. In addition, team members are categorized by years of experience, percentage of contribution, ex-members and their skills, availability, function, and in-work requirements. Outputs are several reports, including actual vs. required head count, actual vs. required certificates, CGI change over time (by month), and more. The program stores historical data for summary and historical reporting, which is done via an Excel spreadsheet that is color-coded to show health statistics at a glance. GCM has provided the Shuttle Ground Processing team with a quantifiable, repeatable approach to assessing and managing the skills in their organization. They now have a common
Identifying 21st Century Capabilities
Stevens, Robert
2012-01-01
What are the capabilities necessary to meet 21st century challenges? Much of the literature on 21st century skills focuses on skills necessary to meet those challenges associated with future work in a globalised world. The result is a limited characterisation of those capabilities necessary to address 21st century social, health and particularly…
Integrated System Health Management (ISHM): Systematic Capability Implementation
Figueroa, Fernando; Holland, Randy; Schmalzwel, John; Duncavage, Dan
2006-01-01
This paper provides a credible approach for implementation of ISHM capability in any system. The requirements and processes to implement ISHM capability are unique in that a credible capability is initially implemented at a low level, and it evolves to achieve higher levels by incremental augmentation. In contrast, typical capabilities, such as thrust of an engine, are implemented once at full Functional Capability Level (FCL), which is not designed to change during the life of the product. The approach will describe core ingredients (e.g. technologies, architectures, etc.) and when and how ISHM capabilities may be implemented. A specific architecture/taxonomy/ontology will be described, as well as a prototype software environment that supports development of ISHM capability. This paper will address implementation of system-wide ISHM as a core capability, and ISHM for specific subsystems as expansions and evolution, but always focusing on achieving an integrated capability.
A framework for offshore vendor capability development
Yusuf Wibisono, Yogi; Govindaraju, Rajesri; Irianto, Dradjad; Sudirman, Iman
2016-02-01
Offshore outsourcing is a common practice conducted by companies, especially in developed countries, by relocating one or more their business processes to other companies abroad, especially in developing countries. This practice grows rapidly owing to the ease of accessing qualified vendors with a lower cost. Vendors in developing countries compete more intensely to acquire offshore projects. Indonesia is still below India, China, Malaysia as main global offshore destinations. Vendor capability is among other factors that contribute to the inability of Indonesian vendor in competing with other companies in the global market. Therefore, it is essential to study how to increase the vendor's capability in Indonesia, in the context of global offshore outsourcing. Previous studies on the vendor's capability mainly focus on capabilities without considering the dynamic of capabilities due to the environmental changes. In order to be able to compete with competitors and maintain the competitive advantage, it is necessary for vendors to develop their capabilities continuously. The purpose of this study is to develop a framework that describes offshore vendor capability development along the client-vendor relationship stages. The framework consists of three main components, i.e. the stages of client-vendor relationship, the success of each stage, and the capabilities of vendor at each stage.
Compilation of Sandia Laboratories technical capabilities
International Nuclear Information System (INIS)
Lundergan, C.D.; Mead, P.L.
1975-11-01
This report is a compilation of 17 individual documents that together summarize the technical capabilities of Sandia Laboratories. Each document in this compilation contains details about a specific area of capability. Examples of application of the capability to research and development problems are provided. An eighteenth document summarizes the content of the other seventeen. Each of these documents was issued with a separate report number (SAND 74-0073A through SAND 74-0091, except -0078)
Directory of Open Access Journals (Sweden)
Fei Jiang
Full Text Available Chronic non-progressive pneumonia, a disease that has become a worldwide epidemic has caused considerable loss to sheep industry. Mycoplasma ovipneumoniae (M. ovipneumoniae is the causative agent of interstitial pneumonia in sheep, goat and bighorn. We here have identified by immunogold and immunoblotting that elongation factor Tu (EF-Tu and heat shock protein 70 (HSP 70 are membrane-associated proteins on M. ovipneumonaiea. We have evaluated the humoral and cellular immune responses in vivo by immunizing BALB/c mice with both purified recombinant proteins rEF-Tu and rHSP70. The sera of both rEF-Tu and rHSP70 treated BALB/c mice demonstrated increased levels of IgG, IFN-γ, TNF-α, IL-12(p70, IL-4, IL-5 and IL-6. In addition, ELISPOT assay showed significant increase in IFN-γ+ secreting lymphocytes in the rHSP70 group when compared to other groups. Collectively our study reveals that rHSP70 induces a significantly better cellular immune response in mice, and may act as a Th1 cytokine-like adjuvant in immune response induction. Finally, growth inhibition test (GIT of M. ovipneumoniae strain Y98 showed that sera from rHSP70 or rEF-Tu-immunized mice inhibited in vitro growth of M. ovipneumoniae. Our data strongly suggest that EF-Tu and HSP70 of M. ovipneumoniae are membrane-associated proteins capable of inducing antibody production, and cytokine secretion. Therefore, these two proteins may be potential candidates for vaccine development against M. ovipneumoniae infection in sheep.
Towards a dynamic concept of alliance capability
SLUYTS, Kim; MARTENS, Rudy; MATTHYSSENS, Paul
2008-01-01
This paper has a threefold purpose. First, we offer a literature review on alliance capability based on strategic and competence based management literature. Second, we extend existing literature on alliance capability by breaking this concept down into five sub capabilities, which are each linked to a stage of the alliance life cycle. Finally, we suggest how firms can support these capabilities through structural, technological and people-related tools and techniques. We argue that current l...
The Organizational Economics of Organizational Capability and Heterogeneity
DEFF Research Database (Denmark)
Foss, Nicolai Juul; Argyres, Nicholas; Felin, Teppo
For decades, the literatures on firm capabilities and organizational economics have been at odds with each other, specifically relative to explaining organizational boundaries and heterogeneity. We briefly trace the history of the relationship between the capabilities literature and organizational...... economics and point to the dominance of a “capabilities first” logic in this relationship. We argue that capabilities considerations are inherently intertwined with questions about organizational boundaries and internal organization, and use this point to respond to the prevalent “capabilities first” logic....... We offer an integrative research agenda that focuses, first, on the governance of capabilities and, second, on the capability of governance....
African Journals Online (AJOL)
efforts towards gender equality in education as a means of achieving social justice. ... should mean that a lot of capability approach-oriented commentators are ... processes, their forms of exercising power, and their rules, unwritten cultures, ...
IAEA Response and Assistance Network. Date Effective: 1 January 2011
International Nuclear Information System (INIS)
2010-01-01
This publication is a tool for (1) supporting the provision of international assistance in the event of a nuclear or radiological incident or emergency, (2) cooperation between States, their competent authorities and the IAEA, and (3) harmonization of response capabilities of States offering assistance under the Response and Assistance Network (RANET). The publication may also assist competent authorities and other response organizations in their efforts to establish and/or maintain their own response capabilities.
Jackson, Denise
2012-01-01
In response to the continuing disparity between industry expectations and higher education provision, this study examines the self-assessed capabilities of 1,024 business undergraduates in employability skills typically considered important by industry in developed economies. The findings indicate relative perceived strengths in "social…
Compilation of Sandia Laboratories technical capabilities
Energy Technology Data Exchange (ETDEWEB)
Lundergan, C. D.; Mead, P. L. [eds.
1975-11-01
This report is a compilation of 17 individual documents that together summarize the technical capabilities of Sandia Laboratories. Each document in this compilation contains details about a specific area of capability. Examples of application of the capability to research and development problems are provided. An eighteenth document summarizes the content of the other seventeen. Each of these documents was issued with a separate report number (SAND 74-0073A through SAND 74-0091, except -0078). (RWR)
Spill response : an exercise in teamwork
International Nuclear Information System (INIS)
Anon.
1998-01-01
An offshore oil spill response exercise was conducted at Hibernia to demonstrate to the Canada-Newfoundland Offshore Petroleum Board the emergency response capabilities that are in place in the event of large offshore spills. The Canadian Coast Guard, Eastern Canada Response Corporation Ltd., Hibernia, Husky Oil Operations Ltd., Jeanne d'Arc Basin Operators Group and the Terra Nova Project team participated in the exercise. The exercise was a success in that it demonstrated that the emergency response teams have the capability of containing and recovering large and small offshore oil spills. The two systems that were tested during the exercise were the large wide-swath boom system and a smaller side-sweep system. Two supply vessels worked in tandem. 11 figs
Directory of Open Access Journals (Sweden)
Erkan Yarımkaya
2017-07-01
Full Text Available Bu araştırmanın amacı, akran aracılı uyarlanmış fiziksel aktivite (AAUFA programına katılan otizm spektrum bozukluğu (OSB olan bir bireyin iletişim becerilerindeki değişimlerin incelenmesidir. Durum (Vaka çalışması modelinde desenlenen araştırmaya, OSB tanılı bir birey ve normal gelişim gösteren (NGG üç akran katılmıştır. Araştırmada, OSB tanılı birey ve NGG üç akran ile birlikte üçü serbest fiziksel aktivite oturumu, 18’i ise AAUFA oturumu olmak üzere toplamda 21 eğitim oturumu gerçekleştirilmiştir. AAUFA oturumlarında, 29 farklı uyarlanmış fiziksel aktivite akran aracılı olarak uygulanmıştır. AAUFA oturumları öncesi, NGG üç akran ile birlikte altı oturum akran eğitimi süreci gerçekleştirilmiştir. Araştırma süresince gerçekleştirilen tüm oturumlar video kamera ile kayıt altına alınmıştır. Araştırma verileri farklı veri toplama araçları (gözlem formu, yarı yapılandırılmış görüşme formları, saha notları ve yansıtmacı günlük ile elde edilmiştir. Araştırmanın bulgularına göre, OSB tanılı bireyin göz kontağı, ortak ilgi, iletişim başlatma ve iletişime tepki becerilerinin AAUFA programı süresince olumlu yönde arttığı tespit edilmiştir. İletişim becerilerinde gözlenen bu olumlu değişimlerin araştırmadan üç hafta sonra elde edilen izleme ölçümünde devam ettiği saptanmıştır. Sonuç olarak, AAUFA programının OSB tanılı bireyin iletişim becerileri üzerinde olumlu yönde etkisi olduğu izlenimi edinilmiştir. The objective of this research is the investigation of the changes in the communication skills of an individual with autism spectrum disorder (ASD participating in the peer-mediated adapted physical activity (PMAPA program. One individual with an ASD diagnosis and three peers with typical development (TD participated in the research which was designed in the model of a case study. In the research, a total of 21
Sandia Laboratories technical capabilities: engineering analysis
International Nuclear Information System (INIS)
Lundergan, C.D.
1975-12-01
This report characterizes the engineering analysis capabilities at Sandia Laboratories. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs
Global dynamics, capabilities and the crisis
Czech Academy of Sciences Publication Activity Database
Fagerberg, J.; Srholec, Martin
2016-01-01
Roč. 26, č. 4 (2016), s. 765-784 ISSN 0936-9937 Institutional support: PRVOUK-P23 Keywords : technological capabilities * social capabilities * competitiveness Subject RIV: AH - Economics Impact factor: 0.862, year: 2016
Sandia Laboratories technical capabilities: systems analysis
International Nuclear Information System (INIS)
Lundergan, C.D.
1975-06-01
The systems analysis capabilities at Sandia Laboratories are summarized. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs. (U.S.)
Technological capability at the Brazilian official pharmaceutical laboratories
Directory of Open Access Journals (Sweden)
José Vitor Bomtempo Martins
2008-10-01
Full Text Available This paper studies the technological capability in the Brazilian Official Pharmaceutical Laboratories [OPL]. The technological capability analysis could contribute to organization strategies and governmental actions in order to improve OPL basic tasks as well to incorporate new ones, particularly concerning the innovation management. Inspired in Figueiredo (2000, 2003a, 2003b and Figueiredo and Ariffin (2003, a framework was drawn and adapted to pharmaceutical industry characteristics and current sanitary and health legislation. The framework allows to map different dimensions of the technological capability (installations, processes, products, equipments, organizational capability and knowledge management and the level attained by OPL (ordinary or innovating capability. OPL show a good development of ordinary capabilities, particularly in Product and Processes. Concerning the other dimensions, OPL are quite diverse. In general, innovating capabilities are not much developed. In the short term, it was identified a dispersion in the capacitating efforts. Considering their present level and the absorption efforts, good perspectives can be found in Installations, Processes and Organizational Capability. A lower level of efforts in Products and Knowledge Management could undermine these capabilities in the future.
High-Speed Photorefractive Response Capability in Triphenylamine Polymer-Based Composites
Tsujimura, Sho; Kinashi, Kenji; Sakai, Wataru; Tsutsumi, Naoto
2012-06-01
We present here the poly(4-diphenylamino)styrene (PDAS)-based photorefractive composites with a high-speed response time. PDAS was synthesized as a photoconductive polymer and photorefractive polymeric composite (PPC) films by using triphenylamine (TPA) (or ethylcarbazole, ECZ), 4-homopiperidino-2-fluorobenzylidene malononitrile (FDCST), and [6,6]-phenyl-C61-butyric acid methyl ester (PCBM) were investigated. The photorefractive quantities of the PDAS-based PPCs were determined by a degenerate four-wave mixing (DFWM) technique. Additionally, the holographic images were recorded through an appropriate PDAS-based PPC. Those holographic images clearly reconstruct the original motion with high-speed quality. The present approach provides a promising candidate for the future application of dynamic holographic displays.
Emergency response preparedness analysis for radioactive materials transportation
International Nuclear Information System (INIS)
Parentela, E.M.; Burli, S.S.; Sathisan, S.K.; Vodrazka, W.C.
1994-01-01
This paper evaluates the emergency response capabilities of first responders, specifically fire services, within the state of Nevada. It addresses issues relating to the available emergency responders such as general capabilities, jurisdictions, and response times. Graphical displays of the response units and attribute tables were created using GIS ARC/INFO. These coverages, plus the existing Census Bureau TIGER Files and highway network for the state of Nevada, were utilized to determine approximate service areas of each response unit, population density served by each response unit, population density served by each response unit and the areas that can be served by a response unit for 3, 5, 10, and 30 minutes response times. Results of the analysis enabled identification of the critical areas along the proposed highway route corridor
Directory of Open Access Journals (Sweden)
Cristiano Cuppini
2011-10-01
Full Text Available Different cortical and subcortical structures present neurons able to integrate stimuli of different sensory modalities. Among the others, one of the most investigated integrative regions is the Superior Colliculus (SC, a midbrain structure whose aim is to guide attentive behaviour and motor responses toward external events. Despite the large amount of experimental data in the literature, the neural mechanisms underlying the SC response are not completely understood. Moreover, recent data indicate that multisensory integration ability is the result of maturation after birth, depending on sensory experience. Mathematical models and computer simulations can be of value to investigate and clarify these phenomena. In the last few years, several models have been implemented to shed light on these mechanisms and to gain a deeper comprehension of the SC capabilities. Here, a neural network model (Cuppini et al., 2010 is extensively discussed. The model considers visual-auditory interaction, and is able to reproduce and explain the main physiological features of multisensory integration in SC neurons, and their acquisition during postnatal life. To reproduce a neonatal condition, the model assumes that during early life: 1 cortical-SC synapses are present but not active; 2 in this phase, responses are driven by non-cortical inputs with very large receptive fields (RFs and little spatial tuning; 3 a slight spatial preference for the visual inputs is present. Sensory experience is modeled by a “training phase” in which the network is repeatedly exposed to modality-specific and cross-modal stimuli at different locations. As results, Cortical-SC synapses are crafted during this period thanks to the Hebbian rules of potentiation and depression, RFs are reduced in size, and neurons exhibit integrative capabilities to cross-modal stimuli, such as multisensory enhancement, inverse effectiveness, and multisensory depression. The utility of the modelling
Dynamic capabilities and innovation: a Multiple-Case Study
Bravo Ibarra, Edna Rocío; Mundet Hiern, Joan; Suñé Torrents, Albert
2009-01-01
After a detailed survey of the scientific literature, it was found that several characteristics of dynamic capabilities were similar to those of innovation capability. Therefore, with a deeper study of the first ones, it could be possible to design a model aimed to structure innovation capability. Thus, this work presents a conceptual model, where the innovation capability is shown as result of three processes: knowledge absorption and creation capability, knowledge integration and knowledge ...
Earth Science Capability Demonstration Project
Cobleigh, Brent
2006-01-01
A viewgraph presentation reviewing the Earth Science Capability Demonstration Project is shown. The contents include: 1) ESCD Project; 2) Available Flight Assets; 3) Ikhana Procurement; 4) GCS Layout; 5) Baseline Predator B Architecture; 6) Ikhana Architecture; 7) UAV Capability Assessment; 8) The Big Picture; 9) NASA/NOAA UAV Demo (5/05 to 9/05); 10) NASA/USFS Western States Fire Mission (8/06); and 11) Suborbital Telepresence.
Disability, Capability, and Special Education: Towards a Capability-Based Theory
Reindal, Solveig Magnus
2009-01-01
The main objective of the article was to investigate the claim that the capability approach fares better with an understanding of disability as presented by the World Health Organization's "International Classification of Functioning, Disability and Health" (ICF) than by the social model, which has been promoted within disability studies. Scholars…
Selecting Capabilities for Quality of Life Measurement
Robeyns, Ingrid
2005-01-01
The capability approach advocates that interpersonal comparisons be made in the space of functionings and capabilities. However, Amartya Sen has not specified which capabilities should be selected as the relevant ones. This has provoked two types of criticism. The stronger critique is Martha Nussbaum's claim that Sen should endorse one specific…
An Agency-based Capability Theory of Justice
Claassen, R.J.G.
2017-01-01
The capability approach is one of the main contenders in the field of theorizing social justice. Each citizen is entitled to a set of basic capabilities. But which are these? Martha Nussbaum formulated a set of ten central capabilities. Amartya Sen argued they should be selected in a process of
DDP-516 Computer Graphics System Capabilities
1972-06-01
This report describes the capabilities of the DDP-516 Computer Graphics System. One objective of this report is to acquaint DOT management and project planners with the system's current capabilities, applications hardware and software. The Appendix i...
DEFF Research Database (Denmark)
Rasmussen, Lauge Baungaard; Nielsen, Thorkild
2003-01-01
The aim of this article is to analyse entrepreneurship from an action research perspective. What is entrepreneurship about? Which are the fundamental capabilities and processes of entrepreneurship? To answer these questions the article includes a case study of a Danish entrepreneur and his networ....... Finally, the article discuss, how more long term action research methods could be integrated into the entrepreneurial processes and the possible impacts of such an implementation?...
The new MCNP6 depletion capability
International Nuclear Information System (INIS)
Fensin, M. L.; James, M. R.; Hendricks, J. S.; Goorley, J. T.
2012-01-01
The first MCNP based in-line Monte Carlo depletion capability was officially released from the Radiation Safety Information and Computational Center as MCNPX 2.6.0. Both the MCNP5 and MCNPX codes have historically provided a successful combinatorial geometry based, continuous energy, Monte Carlo radiation transport solution for advanced reactor modeling and simulation. However, due to separate development pathways, useful simulation capabilities were dispersed between both codes and not unified in a single technology. MCNP6, the next evolution in the MCNP suite of codes, now combines the capability of both simulation tools, as well as providing new advanced technology, in a single radiation transport code. We describe here the new capabilities of the MCNP6 depletion code dating from the official RSICC release MCNPX 2.6.0, reported previously, to the now current state of MCNP6. NEA/OECD benchmark results are also reported. The MCNP6 depletion capability enhancements beyond MCNPX 2.6.0 reported here include: (1) new performance enhancing parallel architecture that implements both shared and distributed memory constructs; (2) enhanced memory management that maximizes calculation fidelity; and (3) improved burnup physics for better nuclide prediction. MCNP6 depletion enables complete, relatively easy-to-use depletion calculations in a single Monte Carlo code. The enhancements described here help provide a powerful capability as well as dictate a path forward for future development to improve the usefulness of the technology. (authors)
The New MCNP6 Depletion Capability
International Nuclear Information System (INIS)
Fensin, Michael Lorne; James, Michael R.; Hendricks, John S.; Goorley, John T.
2012-01-01
The first MCNP based inline Monte Carlo depletion capability was officially released from the Radiation Safety Information and Computational Center as MCNPX 2.6.0. Both the MCNP5 and MCNPX codes have historically provided a successful combinatorial geometry based, continuous energy, Monte Carlo radiation transport solution for advanced reactor modeling and simulation. However, due to separate development pathways, useful simulation capabilities were dispersed between both codes and not unified in a single technology. MCNP6, the next evolution in the MCNP suite of codes, now combines the capability of both simulation tools, as well as providing new advanced technology, in a single radiation transport code. We describe here the new capabilities of the MCNP6 depletion code dating from the official RSICC release MCNPX 2.6.0, reported previously, to the now current state of MCNP6. NEA/OECD benchmark results are also reported. The MCNP6 depletion capability enhancements beyond MCNPX 2.6.0 reported here include: (1) new performance enhancing parallel architecture that implements both shared and distributed memory constructs; (2) enhanced memory management that maximizes calculation fidelity; and (3) improved burnup physics for better nuclide prediction. MCNP6 depletion enables complete, relatively easy-to-use depletion calculations in a single Monte Carlo code. The enhancements described here help provide a powerful capability as well as dictate a path forward for future development to improve the usefulness of the technology.
Energy Technology Data Exchange (ETDEWEB)
Redondo, Antonio [Los Alamos National Laboratory
2010-01-01
Los Alamos National Laboratory (LANL) uses external peer review to measure and continuously improve the quality of its science, technology and engineering (STE). LANL uses capability reviews to assess the STE quality and institutional integration and to advise Laboratory Management on the current and future health of the STE. Capability reviews address the STE integration that LANL uses to meet mission requirements. STE capabilities are define to cut across directorates providing a more holistic view of the STE quality, integration to achieve mission requirements, and mission relevance. The scope of these capabilities necessitate that there will be significant overlap in technical areas covered by capability reviews (e.g., materials research and weapons science and engineering). In addition, LANL staff may be reviewed in different capability reviews because of their varied assignments and expertise. LANL plans to perform a complete review of the Laboratory's STE capabilities (hence staff) in a three-year cycle. The principal product of an external review is a report that includes the review committee's assessments, commendations, and recommendations for STE. The Capability Review Committees serve a dual role of providing assessment of the Laboratory's technical contributions and integration towards its missions and providing advice to Laboratory Management. The assessments and advice are documented in reports prepared by the Capability Review Committees that are delivered to the Director and to the Principal Associate Director for Science, Technology and Engineering (PADSTE). This report will be used by Laboratory Management for STE assessment and planning. The report is also provided to the Department of Energy (DOE) as part of LANL's Annual Performance Plan and to the Los Alamos National Security (LANS) LLC's Science and Technology Committee (STC) as part of its responsibilities to the LANS Board of Governors.
Evaluating Internal Technological Capabilities in Energy Companies
Directory of Open Access Journals (Sweden)
Mingook Lee
2016-03-01
Full Text Available As global competition increases, technological capability must be evaluated objectively as one of the most important factors for predominance in technological competition and to ensure sustainable business excellence. Most existing capability evaluation models utilize either quantitative methods, such as patent analysis, or qualitative methods, such as expert panels. Accordingly, they may be in danger of reflecting only fragmentary aspects of technological capabilities, and produce inconsistent results when different models are used. To solve these problems, this paper proposes a comprehensive framework for evaluating technological capabilities in energy companies by considering the complex properties of technological knowledge. For this purpose, we first explored various factors affecting technological capabilities and divided the factors into three categories: individual, organizational, and technology competitiveness. Second, we identified appropriate evaluation items for each category to measure the technological capability. Finally, by using a hybrid approach of qualitative and quantitative methods, we developed an evaluation method for each item and suggested a method to combine the results. The proposed framework was then verified with an energy generation and supply company to investigate its practicality. As one of the earliest attempts to evaluate multi-faceted technological capabilities, the suggested model can support technology and strategic planning.
Analytical Chemistry Core Capability Assessment - Preliminary Report
International Nuclear Information System (INIS)
Barr, Mary E.; Farish, Thomas J.
2012-01-01
The concept of 'core capability' can be nebulous one. Even at a fairly specific level, where core capability equals maintaining essential services, it is highly dependent upon the perspective of the requestor. Samples are submitted to analytical services because the requesters do not have the capability to conduct adequate analyses themselves. Some requests are for general chemical information in support of R and D, process control, or process improvement. Many analyses, however, are part of a product certification package and must comply with higher-level customer quality assurance requirements. So which services are essential to that customer - just those for product certification? Does the customer also (indirectly) need services that support process control and improvement? And what is the timeframe? Capability is often expressed in terms of the currently utilized procedures, and most programmatic customers can only plan a few years out, at best. But should core capability consider the long term where new technologies, aging facilities, and personnel replacements must be considered? These questions, and a multitude of others, explain why attempts to gain long-term consensus on the definition of core capability have consistently failed. This preliminary report will not try to define core capability for any specific program or set of programs. Instead, it will try to address the underlying concerns that drive the desire to determine core capability. Essentially, programmatic customers want to be able to call upon analytical chemistry services to provide all the assays they need, and they don't want to pay for analytical chemistry services they don't currently use (or use infrequently). This report will focus on explaining how the current analytical capabilities and methods evolved to serve a variety of needs with a focus on why some analytes have multiple analytical techniques, and what determines the infrastructure for these analyses. This information will be
A Human Capabilities Framework for Evaluating Student Learning
Walker, Melanie
2008-01-01
This paper proposes a human capabilities approach for evaluating student learning and the social and pedagogical arrangements that support equality in capabilities for all students. It outlines the focus on valuable beings and doings in the capability approach developed by Amartya Sen, and Martha Nussbaum's capabilities focus on human flourishing.…
Directory of Open Access Journals (Sweden)
Maryam Dalkilic
2016-09-01
Full Text Available Scholars have called for the articulation of new frameworks in special education that are responsive to culture and context and that address the limitations of medical and social models of disability. In this article, we advance a theoretical and practical framework for inclusive education based on the integration of a model of relational inclusion with Amartya Sen’s (1985 Capability Approach. This integrated framework engages children, educators, and families in principled practices that acknowledge differences, rather than deficits, and enable attention to enhancing the capabilities of children with disabilities in inclusive educational environments. Implications include the development of policy that clarifies the process required to negotiate capabilities and valued functionings and the types of resources required to permit children, educators, and families to create relationally inclusive environments.
Energy Technology Data Exchange (ETDEWEB)
Hunter, C
2007-12-11
Potential airborne releases of radioactivity from facilities operated for the U. S. Department of Energy at the Savannah River Site could pose significant consequences to the public through the ingestion pathway. The Savannah River National Laboratory has developed a suite of technologies needed to conduct assessments of ingestion dose during emergency response, enabling emergency manager at SRS to develop initial protective action recommendation for state agencies early in the response and to make informed decisions on activation of additional Federal assets that would be needed to support long-term monitoring and assessment activities.
Ensuring US National Aeronautics Test Capabilities
Marshall, Timothy J.
2010-01-01
U.S. leadership in aeronautics depends on ready access to technologically advanced, efficient, and affordable aeronautics test capabilities. These systems include major wind tunnels and propulsion test facilities and flight test capabilities. The federal government owns the majority of the major aeronautics test capabilities in the United States, primarily through the National Aeronautics and Space Administration (NASA) and the Department of Defense (DoD). However, changes in the Aerospace landscape, primarily the decrease in demand for testing over the last 20 years required an overarching strategy for management of these national assets. Therefore, NASA established the Aeronautics Test Program (ATP) as a two-pronged strategic initiative to: (1) retain and invest in NASA aeronautics test capabilities considered strategically important to the agency and the nation, and (2) establish a strong, high level partnership with the DoD. Test facility utilization is a critical factor for ATP because it relies on user occupancy fees to recover a substantial part of the operations costs for its facilities. Decreasing utilization is an indicator of excess capacity and in some cases low-risk redundancy (i.e., several facilities with basically the same capability and overall low utilization). However, low utilization does not necessarily translate to lack of strategic importance. Some facilities with relatively low utilization are nonetheless vitally important because of the unique nature of the capability and the foreseeable aeronautics testing needs. Unfortunately, since its inception, the customer base for ATP has continued to shrink. Utilization of ATP wind tunnels has declined by more than 50% from the FY 2006 levels. This significant decrease in customer usage is attributable to several factors, including the overall decline in new programs and projects in the aerospace sector; the impact of computational fluid dynamics (CFD) on the design, development, and research
CAPABILITY ASSESSMENT OF MEASURING EQUIPMENT USING STATISTIC METHOD
Directory of Open Access Journals (Sweden)
Pavel POLÁK
2014-10-01
Full Text Available Capability assessment of the measurement device is one of the methods of process quality control. Only in case the measurement device is capable, the capability of the measurement and consequently production process can be assessed. This paper deals with assessment of the capability of the measuring device using indices Cg and Cgk.
2011-08-01
Playing Games ( MMORPG ), which necessitate the management of multiple independent entities with sophisticated capabilities; and finally, arcade-style... MMORPG , SA 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT SAR 18. NUMBER OF PAGES 34 19a. NAME OF RESPONSIBLE...tested platform for simultaneous control of multiple entities. Similarly, the popularity of Massively Multiplayer Online Role Playing Games ( MMORPG
Global dynamics, capabilities and the crisis
Czech Academy of Sciences Publication Activity Database
Fagerberg, J.; Srholec, Martin
2016-01-01
Roč. 26, č. 4 (2016), s. 765-784 ISSN 0936-9937 R&D Projects: GA ČR GAP402/10/2310 Institutional support: RVO:67985998 Keywords : technological capabilities * social capabilities * competitiveness Subject RIV: AH - Economics Impact factor: 0.862, year: 2016
Knowledge Perspectives on Advancing Dynamic Capability
van Reijsen, J.
2014-01-01
Dynamic Capability is the organizational capacity to timely adapt to a changing market environment by reconfiguring resources and routines in order to stay competitive. Although dynamic capability is considered the Holy Grail of strategic management, a connection to the knowledge management domain
International Nuclear Information System (INIS)
Dempsey, G.; Poppell, S.
1999-01-01
This poster presentation will highlight the capability of the US Environmental Protection Agency, Office of Radiation and Indoor Air to process and analyze environmental and emergency response samples in mobile radiological laboratories. Philosophy of use, construction, analytical equipment, and procedures will be discussed in the poster presentation. Accompanying the poster presentation, EPA will also have a static display of its mobile laboratories at the meeting site. (author)
Building Airport Surface HITL Simulation Capability
Chinn, Fay Cherie
2016-01-01
FutureFlight Central is a high fidelity, real-time simulator designed to study surface operations and automation. As an air traffic control tower simulator, FFC allows stakeholders such as the FAA, controllers, pilots, airports, and airlines to develop and test advanced surface and terminal area concepts and automation including NextGen and beyond automation concepts and tools. These technologies will improve the safety, capacity and environmental issues facing the National Airspace system. FFC also has extensive video streaming capabilities, which combined with the 3-D database capability makes the facility ideal for any research needing an immersive virtual and or video environment. FutureFlight Central allows human in the loop testing which accommodates human interactions and errors giving a more complete picture than fast time simulations. This presentation describes FFCs capabilities and the components necessary to build an airport surface human in the loop simulation capability.
Networking capability and new product development
Mu, J.; Di Benedetto, A.C.
2012-01-01
Current research on network theory remains largely focused on structures and outcomes without exploring the capability that firms need to build efficient and effective networks to their advantage. In this paper, we take a networking capability view in studying inter-firm relationships. We assume
Current Capability of Atomic Structure Theory
International Nuclear Information System (INIS)
Kim, Yong Ki
1993-01-01
Current capability of atomic structure theory is reviewed, and advantages, disadvantages and major features of popular atomic structure codes described. Comparisons between theoretical and experimental data on transition energies and lifetimes of excited levels are presented to illustrate the current capability of atomic structure codes.
Williams-Byrd, Julie; Arney, Dale; Rodgers, Erica; Antol, Jeff; Simon, Matthew; Hay, Jason; Larman, Kevin
2015-01-01
NASA is engaged in transforming human spaceflight. The Agency is shifting from an exploration-based program with human activities focused on low Earth orbit (LEO) and targeted robotic missions in deep space to a more sustainable and integrated pioneering approach. Through pioneering, NASA seeks to address national goals to develop the capacity for people to work, learn, operate, live, and thrive safely beyond the Earth for extended periods of time. However, pioneering space involves more than the daunting technical challenges of transportation, maintaining health, and enabling crew productivity for long durations in remote, hostile, and alien environments. This shift also requires a change in operating processes for NASA. The Agency can no longer afford to engineer systems for specific missions and destinations and instead must focus on common capabilities that enable a range of destinations and missions. NASA has codified a capability driven approach, which provides flexible guidance for the development and maturation of common capabilities necessary for human pioneers beyond LEO. This approach has been included in NASA policy and is captured in the Agency's strategic goals. It is currently being implemented across NASA's centers and programs. Throughout 2014, NASA engaged in an Agency-wide process to define and refine exploration-related capabilities and associated gaps, focusing only on those that are critical for human exploration beyond LEO. NASA identified 12 common capabilities ranging from Environmental Control and Life Support Systems to Robotics, and established Agency-wide teams or working groups comprised of subject matter experts that are responsible for the maturation of these exploration capabilities. These teams, called the System Maturation Teams (SMTs) help formulate, guide and resolve performance gaps associated with the identified exploration capabilities. The SMTs are defining performance parameters and goals for each of the 12 capabilities
Exploration Medical Capability (ExMC) Projects
Wu, Jimmy; Watkins, Sharmila; Baumann, David
2010-01-01
During missions to the Moon or Mars, the crew will need medical capabilities to diagnose and treat disease as well as for maintaining their health. The Exploration Medical Capability Element develops medical technologies, medical informatics, and clinical capabilities for different levels of care during space missions. The work done by team members in this Element is leading edge technology, procedure, and pharmacological development. They develop data systems that protect patient's private medical information, aid in the diagnosis of medical conditions, and act as a repository of relevant NASA life sciences experimental studies. To minimize the medical risks to crew health the physicians and scientists in this Element develop models to quantify the probability of medical events occurring during a mission. They define procedures to treat an ill or injured crew member who does not have access to an emergency room and who must be cared for in a microgravity environment where both liquids and solids behave differently than on Earth. To support the development of these medical capabilities, the Element manages the development of medical technologies that prevent, monitor, diagnose, and treat an ill or injured crewmember. The Exploration Medical Capability Element collaborates with the National Space Biomedical Research Institute (NSBRI), the Department of Defense, other Government-funded agencies, academic institutions, and industry.
DEFF Research Database (Denmark)
Eifler, Tobias; Göhler, Simon Moritz; Howard, Thomas J.
2014-01-01
capabilities may lead to low yields and a cost/time overrun, conservatively underestimated capabilities affect quality through the reduced design space, or through increased play, rattle/noise, size or weight. A possibility to overcome the subjective assessment of variation in development projects is a Process...... and Maiti (2012), Breyfogle (2003)]. At the same time, information on the achievable manufacturing accuracy or the supplier’s performance is usually inaccurate and largely qualitative in early development stages. Design decisions as well as the choice of manufacturing processes, therefore, often rely...... Capability Data Base (PCDB) offering valuable insight into the actual or expected performance of production processes (Tata and Thornton, 1999). But although the potential benefits as well as initial challenges for the use of PCDBs have been addressed in earlier research, e. g. by Delaney and Phelan (2008...
I.A.M. Robeyns (Ingrid)
2011-01-01
textabstract In its most general description, the capability approach is a flexible and multi-purpose normative framework, rather than a precise theory of well-being, freedom or justice. At its core are two normative claims: first, the claim that the freedom to achieve well-being is of primary
On the pursuit of a nuclear development capability: The case of the Cuban nuclear program
Benjamin-Alvarado, Jonathan Calvert
1998-09-01
While there have been many excellent descriptive accounts of modernization schemes in developing states, energy development studies based on prevalent modernization theory have been rare. Moreover, heretofore there have been very few analyses of efforts to develop a nuclear energy capability by developing states. Rarely have these analyses employed social science research methodologies. The purpose of this study was to develop a general analytical framework, based on such a methodology to analyze nuclear energy development and to utilize this framework for the study of the specific case of Cuba's decision to develop nuclear energy. The analytical framework developed focuses on a qualitative tracing of the process of Cuban policy objectives and implementation to develop a nuclear energy capability, and analyzes the policy in response to three models of modernization offered to explain the trajectory of policy development. These different approaches are the politically motivated modernization model, the economic and technological modernization model and the economic and energy security model. Each model provides distinct and functionally differentiated expectations for the path of development toward this objective. Each model provides expected behaviors to external stimuli that would result in specific policy responses. In the study, Cuba's nuclear policy responses to stimuli from domestic constraints and intensities, institutional development, and external influences are analyzed. The analysis revealed that in pursuing the nuclear energy capability, Cuba primarily responded by filtering most of the stimuli through the twin objectives of economic rationality and technological advancement. Based upon the Cuban policy responses to the domestic and international stimuli, the study concluded that the economic and technological modernization model of nuclear energy development offered a more complete explanation of the trajectory of policy development than either the
Functional capability of piping systems
International Nuclear Information System (INIS)
Terao, D.; Rodabaugh, E.C.
1992-11-01
General Design Criterion I of Appendix A to Part 50 of Title 10 of the Code of Federal Regulations requires, in part, that structures, systems, and components important to safety be designed to withstand the effects of earthquakes without a loss of capability to perform their safety function. ne function of a piping system is to convey fluids from one location to another. The functional capability of a piping system might be lost if, for example, the cross-sectional flow area of the pipe were deformed to such an extent that the required flow through the pipe would be restricted. The objective of this report is to examine the present rules in the American Society of Mechanical Engineers Boiler and Pressure Vessel Code, Section III, and potential changes to these rules, to determine if they are adequate for ensuring the functional capability of safety-related piping systems in nuclear power plants
Upgrading of TREAT experimental capabilities
International Nuclear Information System (INIS)
Dickerman, C.E.; Rose, D.; Bhattacharyya, S.K.
1982-01-01
The TREAT facility at the Argonne National Laboratory site in the Idaho National Engineering Laboratory is being upgraded to provide capabilities for fast-reactor-safety transient experiments not possible at any other experimental facility. Principal TREAT Upgrade (TU) goal is provision for 37-pin size experiments on energetics of core-disruptive accidents (CDA) in fast breeder reactor cores with moderate sodium void coefficients. this goal requires a significant enhancement of the capabilities of the TREAT facility, specifically including reactor control, hardened neutron spectrum incident on the test sample, and enlarged building. The upgraded facility will retain the capability for small-size experiments of the types currently being performed in TREAT. Reactor building and crane upgrading have been completed. TU schedules call for the components of the upgraded reactor system to be finished in 1984, including upgraded TREAT fuel and control system, and expanded coverage by the hodoscope fuel-motion diagnostics system
Kokkos' Task DAG Capabilities.
Energy Technology Data Exchange (ETDEWEB)
Edwards, Harold C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Ibanez, Daniel Alejandro [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-09-01
This report documents the ASC/ATDM Kokkos deliverable "Production Portable Dy- namic Task DAG Capability." This capability enables applications to create and execute a dynamic task DAG ; a collection of heterogeneous computational tasks with a directed acyclic graph (DAG) of "execute after" dependencies where tasks and their dependencies are dynamically created and destroyed as tasks execute. The Kokkos task scheduler executes the dynamic task DAG on the target execution resource; e.g. a multicore CPU, a manycore CPU such as Intel's Knights Landing (KNL), or an NVIDIA GPU. Several major technical challenges had to be addressed during development of Kokkos' Task DAG capability: (1) portability to a GPU with it's simplified hardware and micro- runtime, (2) thread-scalable memory allocation and deallocation from a bounded pool of memory, (3) thread-scalable scheduler for dynamic task DAG, (4) usability by applications.
Adult Financial Capability Framework. Second Edition
Basic Skills Agency, 2006
2006-01-01
Both the Financial Services Authority and the Basic Skills Agency are committed to supporting those individuals and organisations working to improve the financial capability of themselves and others. The development of the National Strategy for Financial Capability, coordinated by the Financial Services Authority, and the commissioning of a…
Directory of Open Access Journals (Sweden)
Chuli Hu
2014-10-01
Full Text Available Accurate and fine-grained discovery by diverse Earth observation (EO sensors ensures a comprehensive response to collaborative observation-required emergency tasks. This discovery remains a challenge in an EO sensor web environment. In this study, we propose an EO sensor observation capability metadata model that reuses and extends the existing sensor observation-related metadata standards to enable the accurate and fine-grained discovery of EO sensors. The proposed model is composed of five sub-modules, namely, ObservationBreadth, ObservationDepth, ObservationFrequency, ObservationQuality and ObservationData. The model is applied to different types of EO sensors and is formalized by the Open Geospatial Consortium Sensor Model Language 1.0. The GeosensorQuery prototype retrieves the qualified EO sensors based on the provided geo-event. An actual application to flood emergency observation in the Yangtze River Basin in China is conducted, and the results indicate that sensor inquiry can accurately achieve fine-grained discovery of qualified EO sensors and obtain enriched observation capability information. In summary, the proposed model enables an efficient encoding system that ensures minimum unification to represent the observation capabilities of EO sensors. The model functions as a foundation for the efficient discovery of EO sensors. In addition, the definition and development of this proposed EO sensor observation capability metadata model is a helpful step in extending the Sensor Model Language (SensorML 2.0 Profile for the description of the observation capabilities of EO sensors.
Energy Technology Data Exchange (ETDEWEB)
Martin, Olga [Los Alamos National Laboratory
2012-06-04
The briefing provides an overview of the training capabilities at Los Alamos National Laboratory that can be applied to nonproliferation/responsible science education at nuclear institutes in the Former Soviet Union, as part of the programmatic effort under the Global Initiatives for Proliferation Prevention program (GIPP).
Making Capability Lists: Philosophy versus Democracy
Claassen, R.J.G.
2011-01-01
The article discusses a fundamental problem that has to be faced if the general capability approach is to be developed in the direction of a theory of justice: the selection and justification of a list of capabilities. The democratic solution to this problem (defended by Amartya Sen) is to leave the
On the intrinsic transient capability and limitations of solid oxide fuel cell systems
Mueller, F; Jabbari, F; Brouwer, J
2009-01-01
The intrinsic transient performance capability and limitation of integrated solid oxide fuel cell (SOFC) systems is evaluated based on the system balance-of-plant response and fuel cell operating requirements (i.e., allowable deviation from nominal operation). Specifically, non-dimensional relations are derived from conservation principles that quantify the maximum instantaneous current increase that a solid oxide fuel cell system can safely manage based on (1) the desired fuel cell operating...
Methods of ecological capability evaluation of forest
International Nuclear Information System (INIS)
Hosseini, M.; Makhdoum, M.F.; Akbarnia, M.; Saghebtalebi, Kh.
2000-01-01
In this research common methods of ecological capability evaluation of forests were reviewed and limitations for performance were analysed. Ecological capability of forests is an index that show site potential in several role of wood production, soil conservation, flood control, biodiversity, conservation and water supply. This index is related to ecological characteristics of land, such as soil, micro climate, elevation, slope and aspect that affect potential of sites. Suitable method of ecological capability evaluation must be chosen according to the objective of forestry. Common methods for ecological capability evaluation include plant and animal diversity, site index curve, soil and land form, inter branches, index plants, leave analyses, analyses regeneration and ecological mapping
Repair capability and the cellular age response for killing and mutation induction after UV
International Nuclear Information System (INIS)
Wood, R.D.; Burki, H.J.; California Univ., Berkeley
1982-01-01
The cell-cycle response for killing and mutation induction by ultraviolet irradiation was measured in synchronous Chinese hamster ovary cells (CHO wild-type) and in a UV-hypersensitive mutant (43-3B) derived from this line. The CHO 43-3B line shows a greatly enhanced sensitivity to killing (D 0 of 0.3 as compared to 3.2 J/m 2 for the wild-type), is hypermutable, and deficient in DNA repair. For the wild-type, a characteristic age response is seen for killing by UV, with maximum sensitivity in early-S and resistance increasing through the S-phase. There is also a life-cycle specificity for induction of diphtheria-toxin resistance in late-G 1 and early-S. Relatively little variation is seen through the cell cycle for induced 6-thioguanine and ouabain resistance. In contrast, the 43-3B cell line shows a relatively 'flat' response to UV throughout the cell cycle, for both killing and mutation induction. Therefore it appears that the characteristic age responses seen in the wild-type CHO are associated with the function of an essentially error-free repair process. (orig./AJ)
Charles-Niño, Claudia; Pedroza-Roldan, Cesar; Viveros, Monica; Gevorkian, Goar; Manoutcharian, Karen
2011-07-18
The extreme antigenic variability of human immunodeficiency virus (HIV) leads to immune escape of the virus, representing a major challenge in the design of effective vaccine. We have developed a novel concept for immunogen construction based on introduction of massive mutations within the epitopes targeting antigenically variable pathogens and diseases. Previously, we showed that these immunogens carrying large combinatorial libraries of mutated epitope variants, termed as variable epitope libraries (VELs), induce potent, broad and long lasting CD8+IFN-γ+ T-cell response. Moreover, we demonstrated that these T cells recognize more than 50% of heavily mutated variants (5 out of 10 amino acid positions were mutated in each epitope variant) of HIV-1 gp120 V3 loop-derived cytotoxic T lymphocyte epitope (RGPGRAFVTI) in mice. The constructed VELs had complexities of 10000 and 12500 individual members, generated as plasmid DNA or as M13 phage display combinatorial libraries, respectively, and with structural composition RGPGXAXXXX or XGXGXAXVXI, where X is any of 20 natural amino acids. Here, we demonstrated that sera from mice immunized with these VELs are capable of neutralizing 5 out of 10 viral isolates from Tier 2 reference panel of subtype B envelope clones, including HIV-1 isolates which are known to be resistant to neutralization by several potent monoclonal antibodies, described previously. These data indicate the feasibility of the application of immunogens based on VEL concept as an alternative approach for the development of molecular vaccines against antigenically variable pathogens. Copyright © 2011 Elsevier Ltd. All rights reserved.
Land Capability Evaluation of Upper Sekampung Watersheds
Directory of Open Access Journals (Sweden)
Irwan Sukri Banuwa
2008-05-01
Full Text Available Land degradation is a serious problem in the Upper Sekampung Watersheds. This is because the farmers cultivated in steep land to coffee crops without in adequate soil and water conservation practices. The land degradation is mostly caused by erosion. The erosion problem not only stripping the most fertile top soil and decreasing crop production, but also resulting problems in lowland. Therefore, the reorientation land management should be improved to produce agriculture sustainability. The first step is to evaluated land capability this area. The objectives of the research were evaluate land capability of Upper Sekampung Watersheds. The results showed that the Upper Sekampung Watersheds were dominated with class and subclass land capability of III-l2 about 17.630,51 ha (41,58%. All of the constrain for each land capability in this area is erosion hazard, especially land slope. From this research, cultivated land to coffee base crops were allowed in land capability II-l1.e1, III-l2, IV-l3, and VI-l4, with in adequate soil and water conservation practices. In contrary, the land capability of VII-l5 unsuitable for agriculture, they should be a nature or for conservation forest.
Technological Capability and Firm Performance
Directory of Open Access Journals (Sweden)
Fernanda Maciel Reichert
2014-08-01
Full Text Available This research aims to investigate the relationship between investments in technological capability and economic performance in Brazilian firms. Based on economic development theory and on developed countries history, it is assumed that this relationship is positive. Through key indicators, 133 Brazilian firms have been analyzed. Given the economic circumstances of an emerging economy, which the majority of businesses are primarily based on low and medium-low-technology industries, it is not possible to affirm the existence of a positive relation between technological capability and firm performance. There are other elements that allow firms to achieve such results. Firms of lower technological intensity industries performed above average in the economic performance indicators, adversely, they invested below average in technological capability. These findings do not diminish the merit of firms’ and country’s success. They in fact confirm a historical tradition of a country that concentrates its efforts on basic industries.
Capability of the electromagnetic isotope-enrichment facility at ORNL
International Nuclear Information System (INIS)
Newman, E.
1982-01-01
The isotope separation program at Oak Ridge National Laboratory (ORNL) prepares and distributes electromagnetically enriched stable isotopes to the worldwide scientific community. Among the topics discussed in the present paper are the methods of enriching isotopes, the limitations that apply to the quantity and final assay of the separation products, and a generalized production flowsheet indicating the capability of the facility. A brief description of each of the production steps, from the selection and preparation of initial feedstock to the recovery and distribution of the isotopically enriched material, is presented. The future of the facility, the continued supply of enriched isotopes, and the response of the program to new and changing requirements are emphasized
A Monte-Carlo method for ex-core neutron response
International Nuclear Information System (INIS)
Gamino, R.G.; Ward, J.T.; Hughes, J.C.
1997-10-01
A Monte Carlo neutron transport kernel capability primarily for ex-core neutron response is described. The capability consists of the generation of a set of response kernels, which represent the neutron transport from the core to a specific ex-core volume. This is accomplished by tagging individual neutron histories from their initial source sites and tracking them throughout the problem geometry, tallying those that interact in the geometric regions of interest. These transport kernels can subsequently be combined with any number of core power distributions to determine detector response for a variety of reactor Thus, the transport kernels are analogous to an integrated adjoint response. Examples of pressure vessel response and ex-core neutron detector response are provided to illustrate the method
Understanding the Value of a Computer Emergency Response Capability for Nuclear Security
Energy Technology Data Exchange (ETDEWEB)
Gasper, Peter Donald [Idaho National Laboratory; Rodriguez, Julio Gallardo [Idaho National Laboratory
2015-06-01
The international nuclear community has a great understanding of the physical security needs relating to the prevention, detection, and response of malicious acts associated with nuclear facilities and radioactive material. International Atomic Energy Agency (IAEA) Nuclear Security Recommendations (INFCIRC_225_Rev 5) outlines specific guidelines and recommendations for implementing and maintaining an organization’s nuclear security posture. An important element for inclusion into supporting revision 5 is the establishment of a “Cyber Emergency Response Team (CERT)” focused on the international communities cybersecurity needs to maintain a comprehensive nuclear security posture. Cybersecurity and the importance of nuclear cybersecurity require that there be a specific focus on developing an International Nuclear CERT (NS-CERT). States establishing contingency plans should have an understanding of the cyber threat landscape and the potential impacts to systems in place to protect and mitigate malicious activities. This paper will outline the necessary components, discuss the relationships needed within the international community, and outline a process by which the NS-CERT identifies, collects, processes, and reports critical information in order to establish situational awareness (SA) and support decision-making
Federal Radiological Monitoring and Assessment Center Analytical Response
International Nuclear Information System (INIS)
Nielsen, E.C.
2003-01-01
The Federal Radiological Monitoring and Assessment Center (FR-MAC) is authorized by the Federal Radiological Emergency Response Plan to coordinate all off-site radiological response assistance to state and local government s, in the event of a major radiological emergency in the United States. The FR-MAC is established by the U.S. Department of Energy, National Nuclear Security Administration, to coordinate all Federal assets involved in conducting a comprehensive program of radiological environmental monitoring, sampling, radioanalysis, quality assurance, and dose assessment. During an emergency response, the initial analytical data is provided by portable field instrumentation. As incident responders scale up their response based on the seriousness of the incident, local analytical assets and mobile laboratories add additional capability and capacity. During the intermediate phase of the response, data quality objectives and measurement quality objectives are more rigorous. These higher objectives will require the use of larger laboratories, with greater capacity and enhanced capabilities. These labs may be geographically distant FR-om the incident, which will increase sample management challenges. This paper addresses emergency radioanalytical capability and capacity and its utilization during FR-MAC operations
Human-Centered Design Capability
Fitts, David J.; Howard, Robert
2009-01-01
For NASA, human-centered design (HCD) seeks opportunities to mitigate the challenges of living and working in space in order to enhance human productivity and well-being. Direct design participation during the development stage is difficult, however, during project formulation, a HCD approach can lead to better more cost-effective products. HCD can also help a program enter the development stage with a clear vision for product acquisition. HCD tools for clarifying design intent are listed. To infuse HCD into the spaceflight lifecycle the Space and Life Sciences Directorate developed the Habitability Design Center. The Center has collaborated successfully with program and project design teams and with JSC's Engineering Directorate. This presentation discusses HCD capabilities and depicts the Center's design examples and capabilities.
Federal Radiological Monitoring and Assessment Center. The analytical response
International Nuclear Information System (INIS)
Nielsen, E.C.
2005-01-01
The Federal Radiological Monitoring and Assessment Center (FRMAC) is authorized by the Federal Radiological Emergency Response Plan to coordinate all off-site radiological response assistance to state and local governments, in the event of a major radiological emergency in the United States. The FRMAC is established by the U.S. Department of Energy, National Nuclear Security Administration, to coordinate all Federal assets involved in conducting a comprehensive program of radiological environmental monitoring, sampling, radioanalysis, quality assurance, and dose assessment. During an emergency response, the initial analytical data is provided by portable field instrumentation. As incident responders scale up their response based on the seriousness of the incident, local analytical assets and mobile laboratories add additional capability and capacity. During the intermediate phase of the response, data quality objectives and measurement quality objectives are more rigorous. These higher objectives will require the use of larger laboratories, with greater capacity and enhanced capabilities. These labs may be geographically distant from the incident, which will increase sample management challenges. Emergency radioanalytical capability and capacity and its utilization during FRMAC operations are discussed. (author)
Using Porterian Activity Analysis to Understand Organizational Capabilities
DEFF Research Database (Denmark)
Sheehan, Norman T.; Foss, Nicolai Juul
2017-01-01
conceptualized by Porter’s writings on the activity-based view. Porterian activity analysis is becoming more accepted in the strategy literature, but no strategy scholar has explicitly used Porter’s activities, and particularly his concept of drivers, to understand and analyze organizational capabilities....... Introducing Porterian activities into the discussion of capabilities improves strategy scholars’ understanding of the bases of capability heterogeneity, offers academics future directions for research, and provides managers with guidance to enhance their organizations’ capabilities....
Response planning and environmental risk analysis, state of Alaska
International Nuclear Information System (INIS)
Gundlach, E.R.; Marben, G.M.
1993-01-01
Under the sponsorship of the Alaska Dept. of Environmental Conservation (ADEC), a multitasked study was undertaken to determine the relative risk of noncrude oil transport (including marine and freshwater), the status of spill response capability in the state, and the need and most appropriate locations for siting spill response deposits. The project used multidisciplinary transport and environmental data analyzed in a geographic information system (GIS) to enable various scenarios and data changes to be easily visualized. The evaluation concerned (a) designation of significant environmental risk areas, (b) environmentally sensitive areas and fish and wildlife likely to be affected, (c) the level of response capability appropriate for protecting the environment, (d) the adequacy of current capabilities for noncrude vessels, (e) the feasibility of establishing one or more response cooperatives for use by multiple carriers, and (f) other steps that could be taken to reduce the risk of a spill and facilitate control and cleanup
Method for the development of emergency response preparedness for nuclear or radiological accidents
International Nuclear Information System (INIS)
2000-03-01
This report supplements IAEA emergency preparedness guidance published in the 1980s, and is consistent with the new international guidance. It provides practical advice for the development of an emergency response capability based on the potential nature and magnitude of the risk. In order to apply this method, emergency planners should have a good understanding of the basic radiological emergency response principles. Therefore, other applicable international guidance should be reviewed before using this report. This report provides a practical step-by-step method for developing integrated user, local and national emergency response capabilities. It can also be used as the basis for conducting an audit of an existing emergency response capability
Method for the development of emergency response preparedness for nuclear or radiological accidents
International Nuclear Information System (INIS)
1998-04-01
This report supplements IAEA emergency preparedness guidance published in the 1980s, and is consistent with the new international guidance. It provides practical advice for the development of an emergency response capability based on the potential nature and magnitude of the risk. In order to apply this method, emergency planners should have a good understanding of the basic radiological emergency response principles. Therefore, other applicable international guidance should be reviewed before using this report. This report provides a practical step-by-step method for developing integrated user, local and national emergency response capabilities. It can also be used as the basis for conducting an audit of an existing emergency response capability
Radioactive material package testing capabilities at Sandia National Laboratories
International Nuclear Information System (INIS)
Uncapher, W.L.; Hohnstreiter, G.F.
1995-01-01
Evaluation and certification of radioactive and hazardous material transport packages can be accomplished by subjecting these packages to normal transport and hypothetical accident test conditions. The regulations allow package designers to certify packages using analysis, testing, or a combination of analysis and testing. Testing can be used to substantiate assumptions used in analytical models and to demonstrate package structural and thermal response. Regulatory test conditions include impact, puncture, crush, penetration, water spray, immersion, and thermal environments. Testing facilities are used to simulate the required test conditions and provide measurement response data. Over the past four decades, comprehensive testing facilities have been developed at Sandia National Laboratories to perform a broad range of verification and certification tests on hazardous and radioactive material packages or component sections. Sandia's facilities provide an experience base that has been established during the development and certification of many package designs. These unique facilities, along with innovative instrumentation data collection capabilities and techniques, simulate a broad range of testing environments. In certain package designs, package testing can be an economical alternative to complex analysis to resolve regulatory questions or concerns
Developing maturity grids for assessing organisational capabilities
DEFF Research Database (Denmark)
Maier, Anja; Moultrie, James; Clarkson, P John
2009-01-01
Keyword: Maturity Model,Maturity Grid,Maturity Matrix,Organisational Capabilities,Benchmarking,New Product Development,Perfirmance Assessment......Keyword: Maturity Model,Maturity Grid,Maturity Matrix,Organisational Capabilities,Benchmarking,New Product Development,Perfirmance Assessment...
Initiating nuclear power programmes: Responsibilities and capabilities of owners and operators
International Nuclear Information System (INIS)
2009-01-01
There is an increasing interest in developing nuclear power due to growing energy needs, limitations on natural resources and concern for the environment. However, the introduction and development of nuclear power is a major undertaking. This requires building the necessary national infrastructure to construct and operate nuclear power plants in a safe, secure and technically sound manner. Many IAEA Member States that do not yet have nuclear power programmes have expressed their interest to the IAEA about the possibility of introducing nuclear power plants to help meet their energy needs. To assist these Member States, the IAEA is preparing a series of guides and reports. An overall description of the issues was presented by the IAEA in a brochure entitled Considerations to Launch a Nuclear Power Programme (GOV/INF/2007/2), which was targeted mainly at policy makers. A subsequent IAEA Nuclear Energy Series publication, Milestones in the Development of a National Infrastructure for Nuclear Power (NG-G-3.1), describes 19 infrastructure issues that should be addressed through the three phases of development outlined in the brochure, Considerations to Launch a Nuclear Power Programme. The IAEA is preparing a number of guides addressing these issues. Once a firm decision has been made by a government to proceed with the development of a nuclear programme, a number of organizations must be developed. A key organization for the successful construction and operation of the first nuclear power plant is the owner/operator, who provides ownership and management of the project. The owner/operator must clearly understand what must be done and how it has to act, who are partners and supporters and the corresponding interactions that have to be established. The owner or operator may be state owned or a private company. It may be an existing utility, or a specially established project organization. Its responsibilities include bidding, construction, licensing, commissioning
Gastric Lymphoma with Secondary Trigeminal Nerve Lymphoma: A Case Report
Directory of Open Access Journals (Sweden)
Warissara Rongthong
2017-05-01
Full Text Available Data supporting the role of radiotherapy in secondary trigeminal nerve lymphoma is scarce. Here, I report the case of 64-year-old Thai male diagnosed as gastric diffuse large B cell lymphoma with secondary trigeminal nerve lymphoma. He had previously received one cycle of cyclophosphamide, doxorubicin, vincristine, and prednisone (CHOP, followed by five cycles of rituximab plus CHOP (R-CHOP with intrathecal methotrexate (MTX and cytarabine (Ara-C. One month after the last cycle of R-CHOP, he developed a headache and numbness on the left side of his face. MRI revealed thickening of the left trigeminal nerve. He received one intrathecal injection of MTX and Ara-C, followed by systemic chemotherapy. After receiving intrathecal chemotherapy, his symptoms disappeared. Clinical response and MRI studies suggested secondary trigeminal nerve lymphoma. Two months later, our patient’s secondary trigeminal nerve lymphoma had progressed. Salvage whole brain irradiation (36 Gy with boost dose (50 Gy along the left trigeminal nerve was given. Unfortunately, our patient developed heart failure and expired during the radiotherapy session. In conclusion and specific to secondary central nervous system lymphoma (SCNSL, radiotherapy may benefit patients who fail to respond to systemic chemotherapy and palliative treatment. The results this report fail to support the role of radiotherapy in secondary trigeminal nerve lymphoma.
78 FR 20219 - National Financial Capability Month, 2013
2013-04-04
... requires smart financial planning. During National Financial Capability Month, we recommit to empowering... Financial Capability Month, 2013 By the President of the United States of America A Proclamation All... financial literacy. We released a new financial capability toolkit to help schools and employers as they...
Space Communications Capability Roadmap Interim Review
Spearing, Robert; Regan, Michael
2005-01-01
Contents include the following: Identify the need for a robust communications and navigation architecture for the success of exploration and science missions. Describe an approach for specifying architecture alternatives and analyzing them. Establish a top level architecture based on a network of networks. Identify key enabling technologies. Synthesize capability, architecture and technology into an initial capability roadmap.
Engineering Capabilities and Partnerships
Poulos, Steve
2010-01-01
This slide presentation reviews the engineering capabilities at Johnson Space Center, The presentation also reviews the partnerships that have resulted in successfully designed and developed projects that involved commercial and educational institutions.
Directory of Open Access Journals (Sweden)
STEPHAN DILCHERT
2006-09-01
Full Text Available This introductory article to the special issue of Psychology Science devoted to the subject of “Considering Response Distortion in Personality Measurement for Industrial, Work and Organizational Psychology Research and Practice” presents an overview of the issues of response distortion in personality measurement. It also provides a summary of the other articles published as part of this special issue addressing social desirability, impression management, self-presentation, response distortion, and faking in personality measurement in industrial, work, and organizational settings.
Synthetic Immunology: Hacking Immune Cells to Expand Their Therapeutic Capabilities.
Roybal, Kole T; Lim, Wendell A
2017-04-26
The ability of immune cells to survey tissues and sense pathologic insults and deviations makes them a unique platform for interfacing with the body and disease. With the rapid advancement of synthetic biology, we can now engineer and equip immune cells with new sensors and controllable therapeutic response programs to sense and treat diseases that our natural immune system cannot normally handle. Here we review the current state of engineered immune cell therapeutics and their unique capabilities compared to small molecules and biologics. We then discuss how engineered immune cells are being designed to combat cancer, focusing on how new synthetic biology tools are providing potential ways to overcome the major roadblocks for treatment. Finally, we give a long-term vision for the use of synthetic biology to engineer immune cells as a general sensor-response platform to precisely detect disease, to remodel disease microenvironments, and to treat a potentially wide range of challenging diseases.
Aikins, Jan
2005-01-01
Contents include the following: General Background and Introduction of Capability Roadmaps. Agency Objective. Strategic Planning Transformation. Advanced Planning Organizational Roles. Public Involvement in Strategic Planning. Strategic Roadmaps and Schedule. Capability Roadmaps and Schedule. Purpose of NRC Review. Capability Roadmap Development (Progress to Date).
Judgmental Forecasting of Operational Capabilities
DEFF Research Database (Denmark)
Hallin, Carina Antonia; Tveterås, Sigbjørn; Andersen, Torben Juul
This paper explores a new judgmental forecasting indicator, the Employee Sensed Operational Capabilities (ESOC). The purpose of the ESOC is to establish a practical prediction tool that can provide early signals about changes in financial performance by gauging frontline employees’ sensing...... of changes in the firm’s operational capabilities. We present the first stage of the development of ESOC by applying a formative measurement approach to test the index in relation to financial performance and against an organizational commitment scale. We use distributed lag models to test whether the ESOC...
[Run the risk: social disadvantage or capability?
Muñoz-Duque, Luz Adriana
2018-05-10
This article discusses the notions of risk and risk acceptability from a social justice perspective, especially in light of the capability approach proposed by Amartya Sen. The article argues that risk can be the expression of restrictions on subjects' capabilities, deriving from social disadvantages that can be taken for granted in their daily realities. On the other hand, risk can be viewed as an expression of capability in cases where subjects have accepted or admitted the risk through the exercise of freedom, as long as the subjects that relate to the risk do so in keeping with their idea of a good life, the building of which implies the full development of capability for agency. The article concludes with some thoughts on the issues of risk and risk acceptability in the sphere of public health.
Aging and DNA repair capability. [Review
Energy Technology Data Exchange (ETDEWEB)
Tice, R R
1977-01-01
A review of the literature on DNA repair processes in relation to aging is presented under the following headings: DNA repair processes; age-related occurrence of unrepaired DNA lesions; DNA repair capability as a function of age; tissue-specific DNA repair capability; acceleration of the aging process by exposure to DNA damaging agents; human genetic syndromes; and longevity and DNA repair processes. (HLW)
Personality Assessment: A Competency-Capability Perspective.
Kaslow, Nadine J; Finklea, J Tyler; Chan, Ginny
2018-01-01
This article begins by reviewing the proficiency of personality assessment in the context of the competencies movement, which has dominated health service psychology in recent years. It examines the value of including a capability framework for advancing this proficiency and enhancing the quality of personality assessments, including Therapeutic Assessment (Finn & Tonsager, 1997 ), that include a personality assessment component. This hybrid competency-capability framework is used to set the stage for the conduct of personality assessments in a variety of contexts and for the optimal training of personality assessment. Future directions are offered in terms of ways psychologists can strengthen their social contract with the public and offer a broader array of personality assessments in more diverse contexts and by individuals who are both competent and capable.
Radioactive materials transportation emergency response plan
International Nuclear Information System (INIS)
Karmali, N.
1987-05-01
Ontario Hydro transports radioactive material between its nuclear facilities, Atomic Energy of Canada Limited at Chalk River Laboratories and Radiochemical Company in Kanata, on a regular basis. Ontario Hydro also occasionally transports to Whiteshell Laboratories, Hydro-Quebec and New Brunswick Electric Power Commission. Although there are stringent packaging and procedural requirements for these shipments, Ontario Hydro has developed a Radioactive Materials Transportation Emergency Response Plan in the event that there is an accident. The Transportation Emergency Response plan is based on six concepts: 1) the Province id divided into three response areas with each station (Pickering, Darlington, Bruce) having identified response areas; 2) response is activated via a toll-free number. A shift supervisor at Pickering will answer the call, determine the hazards involved from the central shipment log and provide on-line advice to the emergency worker. At the same time he will notify the nearest Ontario Hydro area office to provide initial corporate response, and will request the nearest nuclear station to provide response assistance; 3) all stations have capability in terms of trained personnel and equipment to respond to an accident; 4) all Ontario Hydro shipments are logged with Pickering NGS. Present capability is based on computerized logging with the computer located in the shift office at Pickering to allow quick access to information on the shipment; 5) there is a three tier structure for emergency public information. The local Area Manager is the first Ontario Hydro person at the scene of the accident. The responding facility technical spokesperson is the second line of Corporate presence and the Ontario Hydro Corporate spokesperson is notified in case the accident is a media event; and 6) Ontario Hydro will respond to non-Hydro shipments of radioactive materials in terms of providing assistance, guidance and capability. However, the shipper is responsible
Weaver, Robert R; Lemonde, Manon; Payman, Naghmeh; Goodman, William M
2014-02-01
While the "social determinants of health" view compels us to explore how social structures shape health outcomes, it often ignores the role individual agency plays. In contrast, approaches that focus on individual choice and personal responsibility for health often overlook the influence of social structures. Amartya Sen's "capabilities" framework and its derivative the "health capabilities" (HC) approach attempts to accommodate both points of view, acknowledging that individuals function under social conditions over which they have little control, while also acting as agents in their own health and well-being. This paper explores how economic, social, and cultural resources shape the health capability of people with diabetes, focusing specifically on dietary practices. Health capability and agency are central to dietary practices, while also being shaped by immediate and broader social conditions that can generate habits and a lifestyle that constrain dietary behaviors. From January 2011 to December 2012, we interviewed 45 people with diabetes from a primary care clinic in Ontario (Canada) to examine how their economic, social, and cultural resources combine to influence dietary practices relative to their condition. We classified respondents into low, medium, and high resource groups based on economic circumstances, and compared how economic resources, social relationships, health-related knowledge and values combine to enhance or weaken health capability and dietary management. Economic, social, and cultural resources conspired to undermine dietary management among most in the low resource group, whereas social influences significantly influenced diet among many in the medium group. High resource respondents appeared most motivated to maintain a healthy diet, and also had the social and cultural resources to enable them to do so. Understanding the influence of all three types of resources is critical for constructing ways to enhance health capability, chronic
Directory of Open Access Journals (Sweden)
Cengiz YILMAZ
2016-04-01
Full Text Available Genel olarak kurumlar-arası sistemler (KS olarak bilinen internet tabanlı teknolojiler, işletmeleri tedarik zincirlerindeki ortaklar ile bütünleştirirler ve işletmelere süreçlerini optimize edebilme fırsatı verirler. Bu çalışmada, işletmelerin kendi başarıları yerine tedarik zincirinin bütünününde elde edilebilecek başarıyı hedef alarak, kurumlar-arası sistemlerin işletme performansına olan etkisinde tedarik zinciri işbirliğinin aracılık rolü hakkında daha fazla bilgi sahibi olabilmek için Türk inşaat sektöründe yapılan bir uygulama çalışmasını konu edinmektedir. Türk inşaat sektöründe yapılan bu çalışmadan 138 tane kullanılabilir anket elde edilmiştir ve çalışma analizleri bu anketlerin verilerine göre yapısal eşitlik modellemesi (Lisrel ile kullanılarak yapılmıştır. Araştırma sonuçları, KS kullanımı işletme performansına etki ederken tedarik zinciri işbirliğinin tam bir aracılık rolü üstlendiğini desteklemektedir. Çalışma, bu nedenle tedarik zinciri işbirliğinin kullanımında ve yönetilmesinde ortaklaşa yapılan çalışmaların önemini vurgulamaktadır. Araştırmanın sonunda ise ileride yapılabilecek çalışmalar için öneriler sunulmuştur Internet based technologies, particularly inter-organizational systems (IOS, integrates firms with their supply chain members and give them the opportunity to optimize their processes. So, by working together, firms achieve greater successes than working alone. This study aims this holistic success instead of individual, so in order to have more information about this issue, it examines the mediation role of supply chain collaboration while inter-organizational systems affect the firm performance. Data are collected from national construction sector and 138 usable responses were taken. The statistical methods used include confirmatory factor analysis and structural equation modelling (i.e. LISREL. According to
The Endogenous Origins of Experience, Routines and Organizational Capabilities
DEFF Research Database (Denmark)
Foss, Nicolai Juul; Felin, Teppo
2011-01-01
In this paper we discuss the origins and emergence of organizational routines and capabilities. We first argue that there are theoretical and endogeneity-related concerns associated with the key antecedents and mechanisms specified by the extant routines and capabilities literature. Specifically,...... or rationalist, choice-based approach can provide a more fruitful (though preliminary) foundation for understanding organizational behavior and capabilities.......In this paper we discuss the origins and emergence of organizational routines and capabilities. We first argue that there are theoretical and endogeneity-related concerns associated with the key antecedents and mechanisms specified by the extant routines and capabilities literature. Specifically......, we explicate the behaviorist and empiricist foundations of the organizational routines and capabilities literature and the extant emphasis placed on experience, repetition, and observation as the key antecedents and mechanisms of routines and capabilities. Based on this discussion we highlight...
Hall, Kia M. Q.
2014-01-01
In this study, a dual-level capabilities approach to development is introduced. This approach intends to improve upon individual-focused capabilities approaches developed by Amartya Sen and Martha Nussbaum. Based upon seven months of ethnographic research in the Afro-descendant, autochthonous Garifuna community of Honduras, constructivist grounded…
Zimbelman, Janice; Daly, Janis J; Roenigk, Kristen L; Butler, Kristi; Burdsall, Richard; Holcomb, John P
2012-01-01
To characterize the performance of 2 observational gait measures, the Tinetti Gait Scale (TGS) and the Gait Assessment and Intervention Tool (G.A.I.T.), in identifying improvement in gait in response to gait training. In secondary analysis from a larger study of multimodal gait training for stroke survivors, we measured gait at pre-, mid-, and posttreatment according to G.A.I.T. and TGS, assessing their capability to capture recovery of coordinated gait components. Large medical center. Cohort of stroke survivors (N=44) greater than 6 months after stroke. All subjects received 48 sessions of a multimodal gait-training protocol. Treatment consisted of 1.5 hours per session, 4 sessions per week for 12 weeks, receiving these 3 treatment aspects: (1) coordination exercise, (2) body weight-supported treadmill training, and (3) overground gait training, with 46% of subjects receiving functional electrical stimulation. All subjects were evaluated with the G.A.I.T. and TGS before and after completing the 48-session intervention. An additional evaluation was performed at midtreatment (after session 24). For the total subject sample, there were significant pre-/post-, pre-/mid-, and mid-/posttreatment gains for both the G.A.I.T. and the TGS. According to the G.A.I.T., 40 subjects (91%) showed improved scores, 2 (4%) no change, and 2 (4%) a worsening score. According to the TGS, only 26 subjects (59%) showed improved scores, 16 (36%) no change, and 1 (2%) a worsening score. For 1 treatment group of chronic stroke survivors, the TGS failed to identify a significant treatment response to gait training, whereas the G.A.I.T. measure was successful. The G.A.I.T. is more sensitive than the TGS for individual patients and group treatment response in identifying recovery of volitional control of gait components in response to gait training. Copyright © 2012 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.
ORF Alignment: NC_006349 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available , AraC ... family [Burkholderia mallei ATCC 23344] ... Length = 185 ... Query: 15 ... IVSRACAPMPEEFH...FLLMPGFSALGFMSAVEPLRVANRFRPNLYHWRIVSCDGAPVVASN 74 ... IVSRACAPMPEEFHFLLMPG...FSALGFMSAVEPLRVANRFRPNLYHWRIVSCDGAPVVASN Sbjct: 1 ... IVSRACAPMPEEFHFLLMPGFSALGFMSAVEPLRVANRFRPNLYHWRIVSCDGAPV
The Interface of IT Capabilities and Disruptive Innovations
DEFF Research Database (Denmark)
Baiyere, Abayomi
2017-01-01
The occurrence of disruptive innovations tends to challenge the fabric, structure and capability that define firms facing their threat. Prior research indicates that the capacity of a firm to restructure and reconfigure its resources to face/leverage such turbulent situations is dependent on how...... well it can orchestrate its capabilities. Although IT capability has been identified as one of the essential capability of today’s organisations, managers as well as researchers are yet to uncover the dynamics through which an organisation’s IT capability can be leveraged in disruptive innovation...... situations. This paper contributes to our understanding in this direction by conceptually exploring the different roles of an organisation's IT capabilitiy in disruptive innovation scenarios. The paper provides a synthesis of the current state of knowledge about both concepts and extends this to highlight...
Business and IT Capabilities for Cloud Platform Success
DEFF Research Database (Denmark)
Hahn, Christopher; Huntgeburth, Jan; Winkler, Till J.
2016-01-01
The growing proliferation of cloud platform ecosystems demands a deeper understanding of the capabilities that help existing and emerging platform providers to be successful by creating and appropriating value. This multiple case study of four cloud platform providers (three large, one SME......) instantiates Rai and Tang’s (2014) framework of dyadic IT and network IT capabilities for a cloud platform context and extends it by exploring previously undertheorized cloud platform business capabilities. We further build on this extended framework by employing a configurational perspective to elucidate...... the complementary role of the three proposed business capabilities (incentives and rules, ecosystem marketing and sales, partner development and support) for relevant value creation and appropriation mechanisms. In addition to providing a capability framework catered to the cloud platform context, our findings...
Method for the development of emergency response preparedness for nuclear or radiological accidents
International Nuclear Information System (INIS)
1997-07-01
This report supplements IAEA emergency preparedness guidance published in the 1980s, and is consistent with the new international guidance. It provides practical advice for the development of an emergency response capability based on the potential nature and magnitude of the risk. In order to apply this method, emergency planners should have a good understanding of the basic radiological emergency response principles. Therefore, other applicable international guidance should be reviewed before using this report. This report provides a practical step-by-step method for developing integrated user, local and national emergency response capabilities. It can also be used as the basis for conducting an audit of an existing emergency response capability. 14 refs, 4 figs, 4 tabs
Chen, Renxiang; Wang, Yi-Wen; Fornace, Albert J; Li, Heng-Hong
2016-12-01
Two major CD4 + T-helper (Th) lineages are Th1 and Th2, and well balanced Th1/Th2 responses are essential for immune function. In previously published studies, it was reported that radiation induces a Th1/Th2 immune imbalance toward a Th2-dominant direction, and this imbalance may contribute to postirradiation immune dysfunction. The polarization of Th cells is driven by the cytokine milieu and controlled by intracellular regulatory pathways that respond to cytokine signaling. It is widely accepted that radiation induces cytokine aberration, however, the precise alterations of cytokines in various tissue environments have been difficult to evaluate. In addition, the effects of radiation on the intrinsic functions of Th cells remain uncharacterized. Therefore, how radiation affects Th1/Th2 balance remains somewhat unclear. To address this, we investigated the changes in the polarization capability of Th cells by isolating them from mice previously exposed to radiation and assessing the cells in an established in vitro Th polarization system. Our novel results demonstrate that prior exposure to radiation led to the persistent aberration of the inherent capability of Th cells to differentiate into Th1 and Th2 lineages. The parallel changes in expression of Th1-specific master transcription factors and the key genes in metabolic reprograming indicated that radiation affects the core components in Th1 polarization. While Th1 differentiation was impaired after irradiation, little adverse effect was observed in Th2 differentiation; both of these findings contribute to the known phenotypes of Th1/Th2 imbalance caused by radiation.
Emergency response workers workshop
International Nuclear Information System (INIS)
Agapeev, S.A.; Glukhikh, E.N.; Tyurin, R.L.
2012-01-01
A training workshop entitled Current issues and potential improvements in Rosatom Corporation emergency prevention and response system was held in May-June, 2012. The workshop combined theoretical training with full-scale practical exercise that demonstrated the existing innovative capabilities for radiation reconnaissance, diving equipment and robotics, aircraft, emergency response and rescue hardware and machinery. This paper describes the activities carried out during the workshop [ru
National Response Framework: Annexes
2008-01-01
response Environmental short- and long-term cleanup ESF #11 – Agriculture and Natural Resources Nutrition assistance Animal and plant disease and pest ...continental United States, the Virgin Islands and Puerto Rico, and other U.S. territories and possession other than Alaska and U.S. territories in the...on the Pacific, Atlantic , and Gulf coasts, to provide response capabilities, technical advice, documentation and support assistance, communications
Facility Interface Capability Assessment (FICA) user manual
International Nuclear Information System (INIS)
Pope, R.B.; MacDonald, R.R.; Massaglia, J.L.; Williamson, D.A.; Viebrock, J.M.; Mote, N.
1995-09-01
The US Department of Energy's (DOE) Office of Civilian Radioactive Waste Management (OCRWM) is responsible for developing the Civilian Radioactive Waste Management System (CRWMS) to accept spent nuclear fuel from commercial facilities. The objective of the Facility Interface Capability Assessment (FICA) project was to assess the capability of each commercial spent nuclear fuel (SNF) storage facility, at which SNF is stored, to handle various SNF shipping casks. The purpose of this report is describe the FICA computer software and to provide the FICA user with a guide on how to use the FICA system. The FICA computer software consists of two executable programs: the FICA Reactor Report program and the FICA Summary Report program (written in the Ca-Clipper version 5.2 development system). The complete FICA software system is contained on either a 3.5 in. (double density) or a 5.25 in. (high density) diskette and consists of the two FICA programs and all the database files (generated using dBASE III). The FICA programs are provided as ''stand alone'' systems and neither the Ca-Clipper compiler nor dBASE III is required to run the FICA programs. The steps for installing the FICA software system and executing the FICA programs are described in this report. Instructions are given on how to install the FICA software system onto the hard drive of the PC and how to execute the FICA programs from the FICA subdirectory on the hard drive. Both FICA programs are menu driven with the up-arrow and down-arrow keys used to move the cursor to the desired selection
Liberalism, Humanism, and Feminism in Nussbaum's Capabilities ...
African Journals Online (AJOL)
A purely theoretical analysis of Martha Nussbaum's basis of the capabilities ... Since even a capabilities approach rooted in feminist justice is itself radical and must ... rhetoric of sex and social justice that has already been embraced by current
Conceptual Model of IT Infrastructure Capability and Its Empirical Justification
Institute of Scientific and Technical Information of China (English)
QI Xianfeng; LAN Boxiong; GUO Zhenwei
2008-01-01
Increasing importance has been attached to the value of information technology (IT) infrastructure in today's organizations. The development of efficacious IT infrastructure capability enhances business performance and brings sustainable competitive advantage. This study analyzed the IT infrastructure capability in a holistic way and then presented a concept model of IT capability. IT infrastructure capability was categorized into sharing capability, service capability, and flexibility. This study then empirically tested the model using a set of survey data collected from 145 firms. Three factors emerge from the factor analysis as IT flexibility, IT service capability, and IT sharing capability, which agree with those in the conceptual model built in this study.
Recent Investments by NASA's National Force Measurement Technology Capability
Commo, Sean A.; Ponder, Jonathan D.
2016-01-01
The National Force Measurement Technology Capability (NFMTC) is a nationwide partnership established in 2008 and sponsored by NASA's Aeronautics Evaluation and Test Capabilities (AETC) project to maintain and further develop force measurement capabilities. The NFMTC focuses on force measurement in wind tunnels and provides operational support in addition to conducting balance research. Based on force measurement capability challenges, strategic investments into research tasks are designed to meet the experimental requirements of current and future aerospace research programs and projects. This paper highlights recent and force measurement investments into several areas including recapitalizing the strain-gage balance inventory, developing balance best practices, improving calibration and facility capabilities, and researching potential technologies to advance balance capabilities.
ANTECEDENTS OF CUSTOMER RELATIONSHIP MANAGEMENT CAPABILITIES
Directory of Open Access Journals (Sweden)
Tuleu Daniela
2015-07-01
Full Text Available Customer relationship management, as a process to manage customer relationship initiation, maintenance and termination to maximize the value of the relationship portfolio, is an evolving process. In recent years, the development of interactive technologies (social media have revolutionized the interaction between firms and their customers and between customers. The impact of technology on CRM is improving ways of collecting and processing customer information and transforming communication with customers. In the context of the development of social networks, the introduction of social media applications in customer relationship management activities bring important changes in this area. Thus, managers need to pay attention to the interaction management as an important process of CRM and enhance the customer relationship management capabilities. The study propose a conceptual research model of several antecedents of customer relationship managements capabilities and provide the linkage between this antecedents and CRM capabilities. First, following review of existing research literature related to customer relationship management, there are some conceptual clarification on customer relationship management. Second, are presented the working concepts: the adoption of interactive technologies, customer concept, customer empowerment, customer relationship orientation and customer-centric management system. Then, it is proposed the conceptual model and finally are presented conclusions, managerial implications, limitations and research directions. From a theoretical perspective, this paper highlights the importance of marketing actions at the individual customer level and reveal the impact of adoption by companies of interactive technologies so that organizations have the opportunity to engage in conversations with customers and respond in real time the requirements that they launched the online environment. Nowadays, customers feel empowered and play
Nanofabrication principles, capabilities and limits
Cui, Zheng
2017-01-01
This second edition of Nanofabrication is one of the most comprehensive introductions on nanofabrication technologies and processes. A practical guide and reference, this book introduces readers to all of the developed technologies that are capable of making structures below 100nm. The principle of each technology is introduced and illustrated with minimum mathematics involved. Also analyzed are the capabilities of each technology in making sub-100nm structures, and the limits of preventing a technology from going further down the dimensional scale. This book provides readers with a toolkit that will help with any of their nanofabrication challenges.
International Nuclear Information System (INIS)
Regan, J.D.; Dunn, W.C.
1979-01-01
The bromodeoxyuridine photolysis assay of DNA damage in human cells permits an estimate of both the number of repaired regions in the DNA and the size of the average repaired region - the patch size. The antineoplastic agent arabinofuranosyl cytosine (ara-C) can also be employed to assay the magnitude of repair since this agent appears to block rejoining of single-strand incisions made in the DNA during the initial step of repair. Thus, the number of incisions can be accumulated. The ara-C effect is dependent on the presence of hydroxyurea. Both assays can be employed for the study of physical or chemical DNA damages. Results comparing these assays are presented
Drift reversal capability in helical systems
International Nuclear Information System (INIS)
Yokoyama, M.; Itoh, K.; Okamura, S.
2002-10-01
The maximum-J (J is the second adiabatic invariant) capability, i.e., the drift reversal capability, is examined in quasi-axisymmetric (QAS) stellarators and quasi-poloidally symmetric (QPS) stellarators as a possible mechanism for turbulent transport suppression. Due to the existence of non-axisymmetry of the magnetic field strength in QAS configurations, a local maximum of J is created to cause the drift reversal. The increase of magnetic shear in finite beta equilibria also has favorable effect in realizing the drift reversal. The radial variation of the uniform magnetic field component plays a crucial role for the drift reversal in a QPS configuration. Thus, the drift reversal capability and its external controllability are demonstrated for QAS and QPS stellarators, by which the impact of magnetic configuration on turbulent transport can be studied in experiments. (author)
Drift reversal capability in helical systems
International Nuclear Information System (INIS)
Yokoyama, M.; Itoh, K.; Okamura, S.; Matsuoka, K.; Nakajima, N.; Itoh, S.-I.; Neilson, G.H.; Zarnstorff, M.C.; Rewoldt, G.
2003-01-01
The maximum-J (J is the second adiabatic invariant) capability, i.e., the drift reversal capability, is examined in quasi-axisymmetric (QAS) stellarators and quasi-poloidally symmetric (QPS) stellarators as a possible mechanism for turbulent transport suppression. Due to the existence of non-axisymmetry of the magnetic field strength in QAS configurations, a local maximum of J is created to cause the drift reversal. The increase of magnetic shear in finite beta equilibria also has favorable effect in realizing the drift reversal. The radial variation of the uniform magnetic field component plays a crucial role for the drift reversal in a QPS configuration. Thus, the drift reversal capability and its external controllability are demonstrated for QAS and QPS stellarators, by which the impact of magnetic configuration on turbulent transport can be studied in experiments. (author)
An Interoperability Framework and Capability Profiling for Manufacturing Software
Matsuda, M.; Arai, E.; Nakano, N.; Wakai, H.; Takeda, H.; Takata, M.; Sasaki, H.
ISO/TC184/SC5/WG4 is working on ISO16100: Manufacturing software capability profiling for interoperability. This paper reports on a manufacturing software interoperability framework and a capability profiling methodology which were proposed and developed through this international standardization activity. Within the context of manufacturing application, a manufacturing software unit is considered to be capable of performing a specific set of function defined by a manufacturing software system architecture. A manufacturing software interoperability framework consists of a set of elements and rules for describing the capability of software units to support the requirements of a manufacturing application. The capability profiling methodology makes use of the domain-specific attributes and methods associated with each specific software unit to describe capability profiles in terms of unit name, manufacturing functions, and other needed class properties. In this methodology, manufacturing software requirements are expressed in terns of software unit capability profiles.
Towards a national cybersecurity capability development model
CSIR Research Space (South Africa)
Jacobs, Pierre C
2017-06-01
Full Text Available to be broken down into its components, a model serves as a blueprint to ensure that those building the capability considers all components, allows for cost estimation and facilitates the evaluation of trade-offs. One national cybersecurity capability...
Dynamic Capabilities and Project Management in Small Software Companies
DEFF Research Database (Denmark)
Nørbjerg, Jacob; Nielsen, Peter Axel; Persson, John Stouby
2017-01-01
A small software company depends on its capability to adapt to rapid technological and other changes in its environment—its dynamic capabilities. In this paper, we argue that to evolve and maintain its dynamic capabilities a small software company must pay attention to the interaction between...... dynamic capabilities at different levels of the company — particularly between the project management and the company levels. We present a case study of a small software company and show how successful dynamic capabilities at the company level can affect project management in small software companies...
Current Capabilities and Capacity of Ebola Treatment Centers in the United States.
Herstein, Jocelyn J; Biddinger, Paul D; Kraft, Colleen S; Saiman, Lisa; Gibbs, Shawn G; Le, Aurora B; Smith, Philip W; Hewlett, Angela L; Lowe, John J
2016-03-01
To describe current Ebola treatment center (ETC) locations, their capacity to care for Ebola virus disease patients, and infection control infrastructure features. A 19-question survey was distributed electronically in April 2015. Responses were collected via email by June 2015 and analyzed in an electronic spreadsheet. The survey was sent to and completed by site representatives of each ETC. The survey was sent to all 55 ETCs; 47 (85%) responded. Of the 47 responding ETCs, there are 84 isolation beds available for adults and 91 for children; of these pediatric beds, 35 (38%) are in children's hospitals. In total, the simultaneous capacity of the 47 reporting ETCs is 121 beds. On the basis of the current US census, there are 0.38 beds per million population. Most ETCs have negative pressure isolation rooms, anterooms, and a process for category A waste sterilization, although only 11 facilities (23%) have the capability to sterilize infectious waste on site. Facilities developed ETCs on the basis of Centers for Disease Control and Prevention guidance, but specific capabilities are not mandated at this present time. Owing to the complex and costly nature of Ebola virus disease treatment and variability in capabilities from facility to facility, in conjunction with the lack of regulations, nationwide capacity in specialized facilities is limited. Further assessments should determine whether ETCs can adapt to safely manage other highly infectious disease threats.
A systematic review on perceptual-motor calibration to changes in action capabilities.
van Andel, Steven; Cole, Michael H; Pepping, Gert-Jan
2017-01-01
Perceptual-motor calibration has been described as a mapping between perception and action, which is relevant to distinguish possible from impossible opportunities for action. To avoid movement errors, it is relevant to rapidly calibrate to immediate changes in capabilities and therefore this study sought to explain in what conditions calibration is most efficient. A systematic search of seven databases was conducted to identify literature concerning changes in calibration in response to changes in action capabilities. Twenty-three papers satisfied the inclusion criteria. Data revealed that calibration occurs rapidly if there is a good match between the task that requires calibration and the sources of perceptual-motor information available for exploration (e.g. when exploring maximal braking capabilities by experiencing braking). Calibration can take more time when the perceptual-motor information that is available is less relevant. The current study identified a number of limitations in the field of perceptual-motor research. Most notably, the mean participant age in the included studies was between 18 and 33years of age, limiting the generalizability of the results to other age groups. Also, due to inconsistent terminology used in the field of perceptual-motor research, we argue that investigating calibration in older cohorts should be a focus of future research because of the possible implications of impaired calibration in an aging society. Copyright © 2016 Elsevier B.V. All rights reserved.
Emergency Medical Response Capability Analysis
1982-07-01
Analgesics, non-narcotic Anesthesia aooaratus Antibiotics and anti-bacterials Basin, qash, solution Antidiabetic Agents (Oral) Blade, surgical Knife...for replace- Holder, suture needle nent therapy Inhaler, anesthesia , Yankauer (atner fask) Local anesthetics Intravenous injection sets Lubricant...Medium-Spectrum Erythromycin Kanamycin Clindamycin Narrow-Spectrum Penicillins Oxacillin Methicillin Streptomycin Gentamicin Other Amphotericin B Nystatin
Targeted NextGen Capabilities for 2025
2011-11-01
increased arrival capacity to single runways by reducing longitudinal wake separation standards for Instrument Flight Rules ( IFR ) operations under certain...b. ABSTRACT unclassified c. THIS PAGE unclassified Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 Targeted NextGen Capabilities...The examples cited are not intended to cover every aircraft and every flight. In some instances, the available capabilities for 2025 will not be
Technology support for military capability based acquisition
CSIR Research Space (South Africa)
Thaba, Mphahlela
2017-05-01
Full Text Available gap between capability planning and acquisition of product systems in the SANDF. (Thaba J et al, 2015). The need for decision support tools and technologies to assist capability planners to close this gap and make sound decisions has become more...
International Nuclear Information System (INIS)
Soul, H; Yawny, A
2015-01-01
The hysteretic damping capacity and high recoverable strains characterizing the superelastic response of shape memory alloys (SMA) make these materials attractive for protection systems of structures subjected to dynamic loads. A successful implementation however is conditioned by functional fatigue exhibited by the SMA when subjected to cyclic loading. The residual deformation upon cycling and the efficiency in material usage are the two most restrictive issues in this sense. In this paper, a device equipped with superelastic NiTi SMA wires and capable of supporting external tension compression loads with optimized properties is presented. It is shown how the introduction of the wires’ pre-straining allows for the absorption of deleterious residual deformation without affecting the self-centering capabilities upon unloading, in contrast with what occurs for pre-strained tendons. These features were experimentally verified in an in-scale prototype composed of two 1.2 mm diameter superelastic NiTi SMA wires. In order to numerically assess the dynamic response of a simple structure subjected to seismic excitations, a multilinear superelasticity model for the NiTi wires was developed. (paper)
Resources, constraints and capabilities
Dhondt, S.; Oeij, P.R.A.; Schröder, A.
2018-01-01
Human and financial resources as well as organisational capabilities are needed to overcome the manifold constraints social innovators are facing. To unlock the potential of social innovation for the whole society new (social) innovation friendly environments and new governance structures
Assessing sufficient capability: A new approach to economic evaluation.
Mitchell, Paul Mark; Roberts, Tracy E; Barton, Pelham M; Coast, Joanna
2015-08-01
Amartya Sen's capability approach has been discussed widely in the health economics discipline. Although measures have been developed to assess capability in economic evaluation, there has been much less attention paid to the decision rules that might be applied alongside. Here, new methods, drawing on the multidimensional poverty and health economics literature, are developed for conducting economic evaluation within the capability approach and focusing on an objective of achieving "sufficient capability". This objective more closely reflects the concern with equity that pervades the capability approach and the method has the advantage of retaining the longitudinal aspect of estimating outcome that is associated with quality-adjusted life years (QALYs), whilst also drawing on notions of shortfall associated with assessments of poverty. Economic evaluation from this perspective is illustrated in an osteoarthritis patient group undergoing joint replacement, with capability wellbeing assessed using ICECAP-O. Recommendations for taking the sufficient capability approach forward are provided. Copyright © 2015 Elsevier Ltd. All rights reserved.
Health, vital goals, and central human capabilities.
Venkatapuram, Sridhar
2013-06-01
I argue for a conception of health as a person's ability to achieve or exercise a cluster of basic human activities. These basic activities are in turn specified through free-standing ethical reasoning about what constitutes a minimal conception of a human life with equal human dignity in the modern world. I arrive at this conception of health by closely following and modifying Lennart Nordenfelt's theory of health which presents health as the ability to achieve vital goals. Despite its strengths I transform Nordenfelt's argument in order to overcome three significant drawbacks. Nordenfelt makes vital goals relative to each community or context and significantly reflective of personal preferences. By doing so, Nordenfelt's conception of health faces problems with both socially relative concepts of health and subjectively defined wellbeing. Moreover, Nordenfelt does not ever explicitly specify a set of vital goals. The theory of health advanced here replaces Nordenfelt's (seemingly) empty set of preferences and society-relative vital goals with a human species-wide conception of basic vital goals, or 'central human capabilities and functionings'. These central human capabilities come out of the capabilities approach (CA) now familiar in political philosophy and economics, and particularly reflect the work of Martha Nussbaum. As a result, the health of an individual should be understood as the ability to achieve a basic cluster of beings and doings-or having the overarching capability, a meta-capability, to achieve a set of central or vital inter-related capabilities and functionings. © 2012 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Sunday Adekunle Aduloju
2014-12-01
Full Text Available The potential of information technology (IT as an enabler of customer service process continues to generate interest, which is reflected in the large number of IT-related studies. In spite of the significant progress made in this area, research findings have been mixed and inconsistent. Also, the underlying mechanisms by which IT can affect customer service process remain underexamined. The aim of this study was to find out whether IT investments and IT managerial capabilities can account for variations in customer service performance among insurance companies in Nigeria. Using survey research design, the three formulated hypotheses were tested with data gathered from 402 staff at the managerial level drawn from the selected insurance companies in Nigeria, which have been among the largest investors in IT, and where customer service is widely perceived as strategically important. Responses were analyzed using linear regression. A major finding of this study is that IT is a necessary, but not sufficient, condition for sustainable competitive advantage in customer service. Results show that the interaction of IT investments and tacit, path-dependent, and firm-specific IT managerial capabilities significantly explains variations in customer service performance. Consequently, this study recommends that to realize IT-business value, investments in IT should be accompanied by building and developing IT managerial capabilities.
Manufacturing fuel-switching capability, 1988
International Nuclear Information System (INIS)
1991-09-01
Historically, about one-third of all energy consumed in the United States has been used by manufacturers. About one-quarter of manufacturing energy is used as feedstocks and raw material inputs that are converted into nonenergy products; the remainder is used for its energy content. During 1988, the most recent year for which data are available, manufacturers consumed 15.5 quadrillion British thermal units (Btu) of energy to produce heat and power and to generate electricity. The manufacturing sector also has widespread capabilities to switch from one fuel to another for either economic or emergency reasons. There are numerous ways to define fuel switching. For the purposes of the Manufacturing Energy Consumption Survey (MECS), fuel switching is defined as the capability to substitute one energy source for another within 30 days with no significant modifications to the fuel-consuming equipment, while keeping production constant. Fuel-switching capability allows manufacturers substantial flexibility in choosing their mix of energy sources. The consumption of a given energy source can be maximized if all possible switching into that energy source takes place. The estimates in this report are based on data collected on the 1988 Manufacturing Energy Consumption Survey (MECS), Forms 846 (A through C). The EIA conducts this national sample survey of manufacturing energy consumption on a triennial basis. The MECS is the only comprehensive source of national-level data on energy-related information for the manufacturing industries. The MECS was first conducted in 1986 to collect data for 1985. This report presents information on the fuel-switching capabilities of manufacturers in 1988. This report is the second of a series based on the 1988 MECS. 8 figs., 31 tabs
Manufacturing fuel-switching capability, 1988
Energy Technology Data Exchange (ETDEWEB)
1991-09-01
Historically, about one-third of all energy consumed in the United States has been used by manufacturers. About one-quarter of manufacturing energy is used as feedstocks and raw material inputs that are converted into nonenergy products; the remainder is used for its energy content. During 1988, the most recent year for which data are available, manufacturers consumed 15.5 quadrillion British thermal units (Btu) of energy to produce heat and power and to generate electricity. The manufacturing sector also has widespread capabilities to switch from one fuel to another for either economic or emergency reasons. There are numerous ways to define fuel switching. For the purposes of the Manufacturing Energy Consumption Survey (MECS), fuel switching is defined as the capability to substitute one energy source for another within 30 days with no significant modifications to the fuel-consuming equipment, while keeping production constant. Fuel-switching capability allows manufacturers substantial flexibility in choosing their mix of energy sources. The consumption of a given energy source can be maximized if all possible switching into that energy source takes place. The estimates in this report are based on data collected on the 1988 Manufacturing Energy Consumption Survey (MECS), Forms 846 (A through C). The EIA conducts this national sample survey of manufacturing energy consumption on a triennial basis. The MECS is the only comprehensive source of national-level data on energy-related information for the manufacturing industries. The MECS was first conducted in 1986 to collect data for 1985. This report presents information on the fuel-switching capabilities of manufacturers in 1988. This report is the second of a series based on the 1988 MECS. 8 figs., 31 tabs.
Building Organisational Capability the Private Provider Way
Guthrie, Hugh
2008-01-01
Organisational capability is recognised as a key to organisational success. The combination of human capital (peoples' skills and knowledge), social capital (relationships between people) and organisational capital (the organisation's processes), is central to building an organisation's capability. This paper, presented at the 2008 annual…
Directory of Open Access Journals (Sweden)
2014-03-01
Full Text Available Manufacturing industries of agricultural products, which constitute a considerable part of different countries’ economies, are seeking new profitable opportunities by increasing competition at the international level. Organizational agility is new method and philosophy of production that seeks to react effectively to the variable and unpredictable environment and to utilize the changes as chances for organizational progress and profitability. In this regard, the present research aims to survey the capabilities of organizational agility in complementary and convertor agricultural industries. For this purpose, based on organizational agility literature, four variables- responsiveness, competency, flexibility, and quickness- were examined as the agility capabilities. The research method was descriptive, and the statistical population included 142 managers of Agricultural industries in East Azarbaijan Province during the year 2012. The study sample was calculated 117 using simple random sampling technique. For data collection, the questionnaire was designed by some scholars. The data was analyzed by means of descriptive statistics, inferential statistics and fuzzy set theory. The results showed that the complementary and the convertor agricultural industries of the province have obtained scores higher than the average for the capabilities of responsiveness, flexibility, and quickness but a lower one for the capability of the competency. With regard to the fact that compiling the strategic vision, technological ability, and introducing the new products are among the main components of achieving competency, it is suggested that managers of this sector should, in order to reinforce competency in agricultural industries, pay special attention to compiling the strategic vision, making use of information technology, and using the new opportunities of the market to introduce the new products.
Nuclear and thermal power plant power ramping capability
International Nuclear Information System (INIS)
Golovach, E.A.
1983-01-01
The possibilities of step power increase by NPP and TPP units under emergency conditions of power grids operation are considered. The data analysis has shown that power units ramping capability with WWER-440, WWER-1000 and RBMK-1000 reactors is higher than that of 300 MW power units on fossil fuel, at the initial time interval (0-30 s). These NPP power units satisfy as to ramping capability the energy system requirements. Higher NPP power units ramping capability is explained by the fact that relative pressure before turbine valves is decreased less than in straight-through boilers while the steam volumes time constant of steam separator-superheaters is less than that of intermediate superheatings. Higher power unit ramping capability with WWER-440 and RBMK-1000 reactors as compared with the WWER-1000 reactor is pointed out as well as the increase of WWER-1000 power unit capability using high-speed turbines
A Dynamic Behaviour Analysis on the Frequency Control Capability of Electric Vehicles
DEFF Research Database (Denmark)
Zarogiannis, Athanasios; Marinelli, Mattia; Træholt, Chresten
2014-01-01
The paper presents results of a study on the dynamic response of Electric Vehicle’s (EV) when participating in frequency control of an islanded system. The following cases were considered: when there is no EV performing frequency control, when the EV participates in primary frequency control...... and when the EV participates in both primary and secondary frequency control. Different parameters are tested in various combinations, and their influence on frequency deviation as well as power and energy provided by the EV with vehicle-to-grid (V2G) capability is shown....
Weyand, Jonathan S.; Junck, Emily; Kang, Christopher S.; Heiner, Jason D.
2017-01-01
Introduction Over the past 15 years, violent threats and acts against hospital patients, staff, and providers have increased and escalated. The leading area for violence is the emergency department (ED) given its 24/7 operations, role in patient care, admissions gateway, and center for influxes during acute surge events. This investigation had three objectives: to assess the current security of Washington State EDs; to estimate the prevalence of and response to threats and violence in Washington State EDs; and to appraise the Washington State ED security capability to respond to acute influxes of patients, bystanders, and media during acute surge events. Methods A voluntary, blinded, 28-question Web-based survey developed by emergency physicians was electronically delivered to all 87 Washington State ED directors in January 2013. We evaluated responses by descriptive statistical analyses. Results Analyses occurred after 90% (78/87) of ED directors responded. Annual censuses of the EDs ranged from violent threats or acts occurring in their ED. Of these, 93% were directed towards nursing staff, 90% towards physicians, 74% towards security personnel, and 51% towards administrative personnel. Nearly half (48%) noted incidents directed towards another patient, and 50% towards a patient’s family or friend. These events were variably reported to the hospital administration. After an acute surge event, 35% believed the initial additional security response would not be adequate, with 26% reporting no additional security would be available within 15 minutes. Conclusion Our study reveals the variability of ED security staffing and a heterogeneity of capabilities throughout Washington State. These deficiencies and vulnerabilities highlight the need for other EDs and regional emergency preparedness planners to conduct their own readiness assessments. PMID:28435498
Technological Innovation Capabilities and Firm Performance
Richard C.M. Yam; William Lo; Esther P.Y. Tang; Antonio; K.W. Lau
2010-01-01
Technological innovation capability (TIC) is defined as a comprehensive set of characteristics of a firm that facilities and supports its technological innovation strategies. An audit to evaluate the TICs of a firm may trigger improvement in its future practices. Such an audit can be used by the firm for self assessment or third-party independent assessment to identify problems of its capability status. This paper attempts to develop such an auditing framework that can...
Directory of Open Access Journals (Sweden)
J. Rubén Morones-Ramírez
2014-01-01
Full Text Available Development of porous membranes capable of controlling flow or changing their permeability to specific chemical entities, in response to small changes in environmental stimuli, is an area of appealing research, since these membranes present a wide variety of applications. The synthesis of these membranes has been mainly approached through grafting of environmentally responsive polymers to the surface walls of polymeric porous membranes. This synergizes the chemical stability and mechanical strength of the polymer membrane with the fast response times of the bonded polymer chains. Therefore, different composite membranes capable of changing their effective pore size with environmental triggers have been developed. A recent interest has been the development of porous membranes responsive to light, since these can achieve rapid, remote, noninvasive, and localized flow control. This work describes the synthesis pathway to construct intelligent optothermally responsive membranes. The method followed involved the grafting of optothermally responsive polymer-metal nanoparticle nanocomposites to polycarbonate track-etched porous membranes (PCTEPMs. The nanoparticles coupled to the polymer grafts serve as the optothermal energy converters to achieve optical switching of the pores. The results of the paper show that grafting of the polymer and in situ synthesis of the metallic particles can be easily achieved. In addition, the composite membranes allow fast and reversible switching of the pores using both light and heat permitting control of fluid flow.
Energy Technology Data Exchange (ETDEWEB)
Little, J.B.; Ueno, A.M.; Dahlberg, W.K.
1989-07-01
We have examined the effects of several classes of metabolic inhibitors on the repair of potentially lethal damage in density-inhibited cultures of two rodent and two human cell systems which differ in their growth characteristics. Aphidicolin, 1-..beta..-D-arabinofuranosylcytosine (ara-C) and hydroxyurea showed no effect on PLD repair, whereas the effects of 9-..beta..-D-arabinofuranosyladenine (ara-A) and 3-aminobenzamide (3-AB) were cell line dependent. For example, 3-AB suppressed PLD repair almost completely in CHO cells, but showed no inhibitory effects in human diploid fibroblasts. These results indicate that inhibitors of DNA replication and poly(ADP-ribose) synthesis are not efficient inhibitors of cellular recovery in irradiated cells and, moreover, that such effects may be cell line dependent.
Capabilities of Universities in Achieving the Agricultural ...
African Journals Online (AJOL)
All (100%) the respondents had no capability in acquiring machines and equipment needed for teaching and conducting researches on climate change. Majority (85%) of the respondents had no capability in terms of human resource development with regards to climate change. Funding/manpower (0.657), organizational ...
Leveraging marketing capabilities into competitive advantage and export performance.
Tan, Q.; Sousa, C. M. P.
2015-01-01
Purpose – By using the dynamic capabilities (DC) theory and the theory of competitive advantage, the purpose of this paper is to develop a framework to investigate the role of marketing capabilities on the firm’s export performance. Specifically, this framework depicts the consequences of marketing capabilities and focuses on the relationships among marketing capabilities, competitive advantage, and export performance. Design/methodology/approach – The authors conduct a meta-analysis of ...
ISOPHOT - Capabilities and performance
DEFF Research Database (Denmark)
Lemke, D.; Klaas, U.; Abolins, J.
1996-01-01
ISOPHOT covers the largest wavelength range on ISO from 2.5 to 240 mu m. Its scientific capabilities include multi filter and multi-aperture photometry, polarimetry, imaging and spectrophotometry. All modes can optionally include a focal plane chopper. The backbone of the photometric calibration...
Refueling machine with relative positioning capability
International Nuclear Information System (INIS)
Challberg, R.C.; Jones, C.R.
1998-01-01
A refueling machine is disclosed having relative positioning capability for refueling a nuclear reactor. The refueling machine includes a pair of articulated arms mounted on a refueling bridge. Each arm supports a respective telescoping mast. Each telescoping mast is designed to flex laterally in response to application of a lateral thrust on the end of the mast. A pendant mounted on the end of the mast carries an air-actuated grapple, television cameras, ultrasonic transducers and waterjet thrusters. The ultrasonic transducers are used to detect the gross position of the grapple relative to the bail of a nuclear fuel assembly in the fuel core. The television cameras acquire an image of the bail which is compared to a pre-stored image in computer memory. The pendant can be rotated until the television image and the pre-stored image match within a predetermined tolerance. Similarly, the waterjet thrusters can be used to apply lateral thrust to the end of the flexible mast to place the grapple in a fine position relative to the bail as a function of the discrepancy between the television and pre-stored images. 11 figs
Refueling machine with relative positioning capability
Challberg, R.C.; Jones, C.R.
1998-12-15
A refueling machine is disclosed having relative positioning capability for refueling a nuclear reactor. The refueling machine includes a pair of articulated arms mounted on a refueling bridge. Each arm supports a respective telescoping mast. Each telescoping mast is designed to flex laterally in response to application of a lateral thrust on the end of the mast. A pendant mounted on the end of the mast carries an air-actuated grapple, television cameras, ultrasonic transducers and waterjet thrusters. The ultrasonic transducers are used to detect the gross position of the grapple relative to the bail of a nuclear fuel assembly in the fuel core. The television cameras acquire an image of the bail which is compared to a pre-stored image in computer memory. The pendant can be rotated until the television image and the pre-stored image match within a predetermined tolerance. Similarly, the waterjet thrusters can be used to apply lateral thrust to the end of the flexible mast to place the grapple in a fine position relative to the bail as a function of the discrepancy between the television and pre-stored images. 11 figs.
14 CFR 121.570 - Airplane evacuation capability.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane evacuation capability. 121.570... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Flight Operations § 121.570 Airplane evacuation capability. (a) No person may cause an airplane carrying passengers to be moved on the surface, take off, or...
Emergency department characteristics and capabilities in Beijing, China.
Wen, Leana S; Xu, Jun; Steptoe, Anne P; Sullivan, Ashley F; Walline, Joseph H; Yu, Xuezhong; Camargo, Carlos A
2013-06-01
Emergency Departments (EDs) are a critical, yet heterogeneous, part of international emergency care. We sought to describe the characteristics, resources, capabilities, and capacity of EDs in Beijing, China. Beijing EDs accessible to the general public 24 h per day/7 days per week were surveyed using the National ED Inventories survey instrument (www.emnet-nedi.org). ED staff were asked about ED characteristics during the calendar year 2008. Thirty-six EDs participated (88% response rate). All were located in hospitals and were independent hospital departments. Participating EDs saw a median of 80,000 patients (interquartile range 40,000-118,508). The vast majority (91%; 95% confidence interval [CI] 78-98%) had a contiguous layout, with medical and surgical care provided in one area. Most EDs (55%) saw only adults; 39% saw both adults and children, and 6% saw only children. Availability of technological and consultant resource in EDs was high. The typical ED length of stay was between 1 and 6 h in 49% of EDs (95% CI 32-67%), whereas in the other half, patients reportedly remained for over 6 h; 36% (95% CI 21-54%) of respondents considered their ED over capacity. Beijing EDs have high volume, long length of stay, and frequent reports of EDs being over capacity. To meet its rapidly growing health needs in urban areas, China should consider improving urban ED capacity and training more Emergency Medicine specialists capable of efficiently staffing its crowded EDs. Copyright © 2013 Elsevier Inc. All rights reserved.
Porflow Capabilities, Usage, History, and Testing
International Nuclear Information System (INIS)
Collard, L.B.
1998-05-01
To support closure of the Savannah River Site High Level Waste tanks, the PORFLOW computer program is being applied to predict long term movement of residual contaminants from the tanks. The PORFLOW program has greater capabilities than simpler programs that have been used previously, and PORFLOW results have been accepted by state and federal regulators throughout the United States. This document briefly discusses the PORFLOW capabilities and presents lists of reports showing PORFLOW's usage history and testing
Advanced Post-Irradiation Examination Capabilities Alternatives Analysis Report
Energy Technology Data Exchange (ETDEWEB)
Jeff Bryan; Bill Landman; Porter Hill
2012-12-01
An alternatives analysis was performed for the Advanced Post-Irradiation Capabilities (APIEC) project in accordance with the U.S. Department of Energy (DOE) Order DOE O 413.3B, “Program and Project Management for the Acquisition of Capital Assets”. The Alternatives Analysis considered six major alternatives: ? No Action ? Modify Existing DOE Facilities – capabilities distributed among multiple locations ? Modify Existing DOE Facilities – capabilities consolidated at a few locations ? Construct New Facility ? Commercial Partnership ? International Partnerships Based on the alternatives analysis documented herein, it is recommended to DOE that the advanced post-irradiation examination capabilities be provided by a new facility constructed at the Materials and Fuels Complex at the Idaho National Laboratory.
Model-Based Military Scenario Management for Defence Capability
National Research Council Canada - National Science Library
Gori, Ronnie; Chen, Pin; Pozgay, Angela
2004-01-01
.... This paper describes initial work towards the development of an information model that links scenario and capability related information, and the results of capability analysis and experimentation...
Capabilities and Special Needs
DEFF Research Database (Denmark)
Kjeldsen, Christian Christrup
into international consideration in relation to the implementation of the UN convention on the rights of persons with disabilities. As for the theoretical basis, the research makes use of the sociological open-ended and relational concepts of Pierre Bourdieu and the normative yardstick of the Capability Approach...
Building IT capability in health-care organizations.
Khatri, Naresh
2006-05-01
While computer technology has revolutionized industries such as banking and airlines, it has done little for health care so far. Most of the health-care organizations continue the early-computer-era practice of buying the latest technology without knowing how it might effectively be employed in achieving business goals. By investing merely in information technology (IT) rather than in IT capabilities they acquire IT components--primarily hardware, software, and vendor-provided services--which they do not understand and, as a result, are not capable of fully utilizing for achieving organizational objectives. In the absence of internal IT capabilities, health-care organizations have relied heavily on the fragmented IT vendor market in which vendors do not offer an open architecture, and are unwilling to offer electronic interfaces that would make their 'closed' systems compatible with those of other vendors. They are hamstrung as a result because they have implemented so many different technologies and databases that information stays in silos. Health systems can meet this challenge by developing internal IT capabilities that would allow them to seamlessly integrate clinical and business IT systems and develop innovative uses of IT. This paper develops a comprehensive conception of IT capability grounded in the resource-based theory of the firm as a remedy to the woes of IT investments in health care.
Geometry and gravity influences on strength capability
Poliner, Jeffrey; Wilmington, Robert P.; Klute, Glenn K.
1994-01-01
Strength, defined as the capability of an individual to produce an external force, is one of the most important determining characteristics of human performance. Knowledge of strength capabilities of a group of individuals can be applied to designing equipment and workplaces, planning procedures and tasks, and training individuals. In the manned space program, with the high risk and cost associated with spaceflight, information pertaining to human performance is important to ensuring mission success and safety. Knowledge of individual's strength capabilities in weightlessness is of interest within many areas of NASA, including workplace design, tool development, and mission planning. The weightless environment of space places the human body in a completely different context. Astronauts perform a variety of manual tasks while in orbit. Their ability to perform these tasks is partly determined by their strength capability as demanded by that particular task. Thus, an important step in task planning, development, and evaluation is to determine the ability of the humans performing it. This can be accomplished by utilizing quantitative techniques to develop a database of human strength capabilities in weightlessness. Furthermore, if strength characteristics are known, equipment and tools can be built to optimize the operators' performance. This study examined strength in performing a simple task, specifically, using a tool to apply a torque to a fixture.
Fault Injection and Monitoring Capability for a Fault-Tolerant Distributed Computation System
Torres-Pomales, Wilfredo; Yates, Amy M.; Malekpour, Mahyar R.
2010-01-01
The Configurable Fault-Injection and Monitoring System (CFIMS) is intended for the experimental characterization of effects caused by a variety of adverse conditions on a distributed computation system running flight control applications. A product of research collaboration between NASA Langley Research Center and Old Dominion University, the CFIMS is the main research tool for generating actual fault response data with which to develop and validate analytical performance models and design methodologies for the mitigation of fault effects in distributed flight control systems. Rather than a fixed design solution, the CFIMS is a flexible system that enables the systematic exploration of the problem space and can be adapted to meet the evolving needs of the research. The CFIMS has the capabilities of system-under-test (SUT) functional stimulus generation, fault injection and state monitoring, all of which are supported by a configuration capability for setting up the system as desired for a particular experiment. This report summarizes the work accomplished so far in the development of the CFIMS concept and documents the first design realization.
Development of an Aeroelastic Modeling Capability for Transient Nozzle Side Load Analysis
Wang, Ten-See; Zhao, Xiang; Zhang, Sijun; Chen, Yen-Sen
2013-01-01
Lateral nozzle forces are known to cause severe structural damage to any new rocket engine in development during test. While three-dimensional, transient, turbulent, chemically reacting computational fluid dynamics methodology has been demonstrated to capture major side load physics with rigid nozzles, hot-fire tests often show nozzle structure deformation during major side load events, leading to structural damages if structural strengthening measures were not taken. The modeling picture is incomplete without the capability to address the two-way responses between the structure and fluid. The objective of this study is to develop a coupled aeroelastic modeling capability by implementing the necessary structural dynamics component into an anchored computational fluid dynamics methodology. The computational fluid dynamics component is based on an unstructured-grid, pressure-based computational fluid dynamics formulation, while the computational structural dynamics component is developed in the framework of modal analysis. Transient aeroelastic nozzle startup analyses of the Block I Space Shuttle Main Engine at sea level were performed. The computed results from the aeroelastic nozzle modeling are presented.
Cultivating Human Capabilities in Venturesome Learning Environments
Hogan, Padraig
2013-01-01
The notion of competencies has been a familiar feature of educational reform policies for decades. In this essay, Padraig Hogan begins by highlighting the contrasting notion of capabilities, pioneered by the research of Amartya Sen and Martha Nussbaum. An educational variant of the notion of capabilities then becomes the basis for exploring…
Descriptors of server capabilities in China
DEFF Research Database (Denmark)
Adeyemi, Oluseyi; Slepniov, Dmitrij; Wæhrens, Brian Vejrum
are relevant to determine subsidiary roles and as an indication of the capabilities required. These descriptors are identified through extensive literature review and validated by case studies of two Danish multinational companies subsidiaries operating in China. They provided the empirical basis......China with the huge market potential it possesses is an important issue for subsidiaries of western multinational companies. The objective of this paper is therefore to strengthen researchers’ and practitioners’ perspectives on what are the descriptors of server capabilities. The descriptors...
Capabilities of the Power Burst Facility
International Nuclear Information System (INIS)
Spencer, W.A.; Jensen, A.M.; McCardell, R.K.
1982-01-01
The unique and diverse test capabilities of the Power Burst Facility (PBF) are described in this paper. The PBF test reactor, located at the Idaho National Engineering Laboratory, simulates normal, off-normal, and accident operating conditions of light water reactor fuel rods. An overview description is given, with specific detail on design and operating characteristics of the driver core, experiment test loop, fission product detection system, test train assembly facility, and support equipment which make the testing capability of the PBF so versatile
Evolving Capabilities for Virtual Globes
Glennon, A.
2006-12-01
Though thin-client spatial visualization software like Google Earth and NASA World Wind enjoy widespread popularity, a common criticism is their general lack of analytical functionality. This concern, however, is rapidly being addressed; standard and advanced geographic information system (GIS) capabilities are being developed for virtual globes--though not centralized into a single implementation or software package. The innovation is mostly originating from the user community. Three such capabilities relevant to the earth science, education, and emergency management communities are modeling dynamic spatial phenomena, real-time data collection and visualization, and multi-input collaborative databases. Modeling dynamic spatial phenomena has been facilitated through joining virtual globe geometry definitions--like KML--to relational databases. Real-time data collection uses short scripts to transform user-contributed data into a format usable by virtual globe software. Similarly, collaborative data collection for virtual globes has become possible by dynamically referencing online, multi-person spreadsheets. Examples of these functions include mapping flows within a karst watershed, real-time disaster assessment and visualization, and a collaborative geyser eruption spatial decision support system. Virtual globe applications will continue to evolve further analytical capabilities, more temporal data handling, and from nano to intergalactic scales. This progression opens education and research avenues in all scientific disciplines.
An Empirical Study of Capability Development within Product Innovation Projects
Directory of Open Access Journals (Sweden)
Alireza Javanmardi Kashan
2015-04-01
Full Text Available The objective of this paper is to develop insights into firms’ strategic capability development processes within product innovation projects. In particular, the research aims at investigating the interactions among product innovation, knowledge processes, and capability development within firms. Building on qualitative data from the auto-industry, our analysis reveals that across four product innovation projects, the case company developed architectural knowledge and capability. Findings reveal that, along with changes at each level of product architecture, “design knowledge” and “design capability” have been developed at the same level of product architecture, leading to capability development at that level. Furthermore, findings suggest that such capability transformation resulting from knowledge and capability creation over the course of case projects leads to modularization of product architecture. Overall, the research contributes to identifying and emphasizing the role of micro processes in capability development and renewal, which in turn enhances our understanding of strategic capability development processes.
Gendering dynamic capabilities in micro firms
Directory of Open Access Journals (Sweden)
Yevgen Bogodistov
2017-05-01
Full Text Available Gender issues are well-researched in the general management literature, particular in studies on new ventures. Unfortunately, gender issues have been largely ignored in the dynamic capabilities literature. We address this gap by analyzing the effects of gender diversity on dynamic capabilities among micro firms. We consider the gender of managers and personnel in 124 Ukrainian tourism micro firms. We examine how a manager’s gender affects the firm’s sensing capacities and investigate how it moderates team gender diversity’s impact on sensing capacities. We also investigate how personnel composition impacts seizing and reconfiguration capacities. We find that female managers have several shortcomings concerning a firm’s sensing capacity but that personnel gender diversity increases this capacity. Team gender diversity has positive effects on a firm’s seizing and reconfiguration abilities. Our study advances research on gender diversity and its impact on firm capabilities and illustrates its relevance for staffing practices in micro firms.
Production capability: ERDA methods and results
International Nuclear Information System (INIS)
Klemenic, J.
1977-01-01
Production centers are categorized into four classes, according to the relative certainty of future production. A ''forward cost'' basis is used to establish both the resource base and to define the acceptable production centers. The first phase of the work is called the ''Could'' capability. Resources are assigned to existing production centers, or new production centers are postulated based on adequate resources to support a mill for a reasonable economic life. A production schedule is developed for each center. The last step in the ''Could'' study is to aggregate the capital and operating costs. The final step in the Production Capability study is the rescheduling of the production from the ''Could'' to produce only sufficient U concentrate to meet the feed requirements of enrichment facilities operated at the announced transaction tails assay plans. The optimized production schedules are called the ''Need'' production capability. A separate study was also performed of industry production plans. 4 tables, 7 figs
Cosmopolitan capabilities in the HE classroom
Directory of Open Access Journals (Sweden)
Veronica Crosbie
2014-04-01
Full Text Available This study, concerning the development of cosmopolitan citizenship, draws on theories of human development and capabilities (Sen 1999; Nussbaum 2000 from a social justice perspective, where individual wellbeing is articulated as having the freedom to live a life of one’s choosing. In the context of an English to Speakers of Other Languages (ESOL classroom this involves paying attention to pedagogical strategies, power dynamics and curriculum content as a means of developing valued beings and doings (or capabilities and functionings as they are described in the literature. Sample activities are presented and evaluated to see to what extent they achieve the desired end. These include critical pedagogical interventions, students’ artefacts and extracts from focus group interviews, class reports and reflective journals. Results from the textual data offer research evidence of successful curriculum change, demonstrating that the learning that takes place there can make a difference: in terms of the learners’ identity development, capability enhancement and cosmopolitan citizenship.
Capabilities of a remote work vehicle
International Nuclear Information System (INIS)
Whittaker, W.L.; Champeny, L.
1987-01-01
The remote work vehicle (RWV) is a mobile work system for recovery operations in radiological environments. A teleoperated, electrohydraulically powered system, the RWV features omnidirectional locomotion, a telescoping boom with a seven meter reach, a master/slave manipulator, ten cameras, a tether for sustained power, and an offboard console where three operators control vehicle functions. (The RWV is more fully described elsewhere see bibliography; capability is emphasized here). Capabilities of the base vehicle and specialized tooling allow the RWV to perform accident recovery tasks, including demolishing concrete and steel structures, decontaminating and sealing surfaces, removing water and sediment from flooded areas, emplacing shields, packaging and transporting materials, and performing general inspections. Aspirations for reliability have made the RWV an order of magnitude more complex than its predecessor recovery robots, and ambitions for task performance have made it two orders of magnitude more capable. In addition to nuclear recovery work, the RWV is a viable candidate for other remote work applications, including nuclear facility maintenance and decommissioning
Innovation and dynamic capabilities of the firm: Defining an assessment model
Directory of Open Access Journals (Sweden)
André Cherubini Alves
2017-05-01
Full Text Available Innovation and dynamic capabilities have gained considerable attention in both academia and practice. While one of the oldest inquiries in economic and strategy literature involves understanding the features that drive business success and a firm’s perpetuity, the literature still lacks a comprehensive model of innovation and dynamic capabilities. This study presents a model that assesses firms’ innovation and dynamic capabilities perspectives based on four essential capabilities: development, operations, management, and transaction capabilities. Data from a survey of 1,107 Brazilian manufacturing firms were used for empirical testing and discussion of the dynamic capabilities framework. Regression and factor analyses validated the model; we discuss the results, contrasting with the dynamic capabilities’ framework. Operations Capability is the least dynamic of all capabilities, with the least influence on innovation. This reinforces the notion that operations capabilities as “ordinary capabilities,” whereas management, development, and transaction capabilities better explain firms’ dynamics and innovation.
Scaling-up Support for Emergency Response Organizations
Oomes, A.H.J.; Neef, R.M.
2005-01-01
We present the design of an information system that supports the process of scaling-up of emergency response organizations. This process is vital for effective emergency response but tends to go awry in practice. Our proposed system consists of multiple distributed agents that are capable of
Grid sensitivity capability for large scale structures
Nagendra, Gopal K.; Wallerstein, David V.
1989-01-01
The considerations and the resultant approach used to implement design sensitivity capability for grids into a large scale, general purpose finite element system (MSC/NASTRAN) are presented. The design variables are grid perturbations with a rather general linking capability. Moreover, shape and sizing variables may be linked together. The design is general enough to facilitate geometric modeling techniques for generating design variable linking schemes in an easy and straightforward manner. Test cases have been run and validated by comparison with the overall finite difference method. The linking of a design sensitivity capability for shape variables in MSC/NASTRAN with an optimizer would give designers a powerful, automated tool to carry out practical optimization design of real life, complicated structures.
Sandia Laboratories technical capabilities: materials and processes
International Nuclear Information System (INIS)
Lundergan, C.D.; Mead, P.L.
1977-08-01
Materials and process activities have emphasized the balance between research and development necessary to provide materials compatible with the extreme environments and performance requirements associated with nuclear ordnance. Specific technical areas which have continuing emphasis include metallurgy, composites, surface characterization and thin films, polymers, ceramics, and high-temperature characterization. Complete processing and fabrication facilities assure the capability for early evaluation and use of tailored materials. Efforts are focused on material applications involving structural and electronic materials, thermal and electrical insulation, radiation shields, and shock mitigation. Key elements in these efforts are functionability, reliability, and longevity. This interdisciplinary approach to scientific materials engineering results from the recognition that many disciplines are required to understand, characterize, and apply materials, and from the fact that material design is an essential element in meeting the objectives of quality, functionality, and life. In effect, the responsibility of a materials group extends beyond the development of a material into the understanding and description of its behavior in the extreme environments to which it will be subjected
Radioactive waste material testing capabilities in Romania
International Nuclear Information System (INIS)
Vieru, G.
1999-01-01
Radioactive material including wastes, generated by Romanian nuclear facilities are packaged in accordance with national and IAEA's Regulation for a safe transport to the disposal center. The evaluation and certification of packages is accomplished by subjecting these packages to normal and simulated test conditions in order to prove the package to technical performances. The standards provide to package designers the possibility to use analysis, testing or a combination of these. The paper describes the experimental and simulating qualification tests for type A packages used for transport and storage of radioactive wastes (low level). Testing are used to substantiate assumptions used in analytical models and to demonstrate package structural response. There are also presented testing capabilities which are used to perform and simulate the required qualification tests. By direct comparison of analysis and experimental results, the degree of reliability of analytical methods and admissibility of assumptions taken in package designing and in demonstrating its safety under conditions of INR - Pitesti, within the contract between the INR - Pitesti and IAEA - Vienna, were determined. (author)
Selection of Models for Ingestion Pathway and Relocation Radii Determination
International Nuclear Information System (INIS)
Blanchard, A.
1998-01-01
The distance at which intermediate phase protective actions (such as food interdiction and relocation) may be needed following postulated accidents at three Savannah River Site nonreactor nuclear facilities will be determined by modeling. The criteria used to select dispersion/deposition models are presented. Several models were considered, including ARAC, MACCS, HOTSPOT, WINDS (coupled with PUFF-PLUME), and UFOTRI. Although ARAC and WINDS are expected to provide more accurate modeling of atmospheric transport following an actual release, analyses consistent with regulatory guidance for planning purposes may be accomplished with comparatively simple dispersion models such as HOTSPOT and UFOTRI. A recommendation is made to use HOTSPOT for non-tritium facilities and UFOTRI for tritium facilities
Implementing Firm Dynamic Capabilities Through the Concept Design Process
DEFF Research Database (Denmark)
Nedergaard, Nicky; Jones, Richard
2011-01-01
It is well understood that firms operating in highly dynamic and fluid markets need to possess strong dynamic capabilities of sensing (market trajectories), seizing (to capitalise on these trajectories), and transformation (in order to implement sustainable strategies). Less understood is how firms...... actually implement these capabilities. A conceptual model showing how managing concept design processes can help firms systematically develop dynamic capabilities and help bridge the gap between the market-oriented and resource-focused strategic perspectives is presented. By placing this model in a design......-driven innovation perspective three theoretical propositions is derived explicating both the paper’s implementation approach to dynamic capabilities as well as new ways of understanding these capabilities. Concluding remarks are made discussing both the paper’s contribution to the strategic marketing literature...
Putting Role 1 first: the Role 1 capability review.
Hodgetts, T J; Findlay, S
2012-09-01
To quantify the risk for delivering care at Role 1 in the Land Environment (point of wounding to hospital care) on current operations and set the conditions for systematic change to enhance future capability. UK, US and Danish Army Role 1 Subject Matter Experts (SMEs) (1) Questionnaire study ofUK SMEs to determine capability gaps; (2) Questionnaire study of US and Danish SMEs to benchmark UK capability; (3) Semi-structured interviews of UK SMEs; (4) In-theatre evaluation of deployed Role 1. Thirty two SMEs completed the questionnaire (68% response rate), comprising 25 medical officers (20 in clinical appointments; five in command and staff appointments), six nurses and one medical support officer. Results of the entire review were collated as a cross-Defence Lines of Development analysis, separating the specific experience of 1 Medical Regiment's Hybrid Foundation Training (HFT), Mission Specific Training (MST) and deployment cycle from the analysis gained from questionnaire studies, SME consultation and documentary evidence. The review generated 77 recommendations and 38 sub-recommendations. The top six messages of the review were (1) To balance the expressed desire to increase the ratio of trained Team Medics with the reality of generating credible instructors with clinical experience; (2) To recognise that inadequate experience for Combat Medical Technicians in Primary Healthcare in the Firm Base undermines their operational preparedness; (3) To recognise that Current Regimental Aid Post (RAP) at contingency without power lacks the rudimentary infrastructure of a modern Medical Treatment Facility; (4) To recognise that inappropriate deployment of personnel with chronic disease or acutely limiting conditions is a consistent trend for 20 years that highlights continuing system weaknesses in applying protective medical grading; (5) To accept that General Practitioner manning requires re-evaluating as an Operational Pinch Point, reviewing all options to maintain
Capabilities for Intercultural Dialogue
Crosbie, Veronica
2014-01-01
The capabilities approach offers a valuable analytical lens for exploring the challenge and complexity of intercultural dialogue in contemporary settings. The central tenets of the approach, developed by Amartya Sen and Martha Nussbaum, involve a set of humanistic goals including the recognition that development is a process whereby people's…
Sandia Laboratories technical capabilities: instrumentation and data systems
International Nuclear Information System (INIS)
Lundergain, C.D.; Mead, P.L.
1975-12-01
This report characterizes the instrumentation and data systems capabilities at Sandia Laboratories. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs
Organizational Learning Capability: An Example of University Hospital
Directory of Open Access Journals (Sweden)
Yasin UZUNTARLA
2015-06-01
Full Text Available In health care institutions aiming healthy society by the way protecting and promoting human health, reaching information has a vital importance. This descriptive research purposed an evaluation of organizational learning capability of 396 employees working in Gülhane Military Medical Academy Hospital. A questionnaire including socio-demographic characteristics was used along with Organizational Learning Capability scale designed by Ricardo CHIVA and His Friends. Data acquired was analyzed with SPSS 15.0 program. Participants’ Organizational Learning Capability and its subscales means were assessed in terms of their sociodemographic characteristics. Assessing participants’ answers in terms of 5 subscales which are experimentation, risk taking, interaction with the external environment, dialogue and participatory decision-making; for education level and professional groups, statistical significant differences was found between Organizational Learning Capability and its subscales means.
LOFT Augmented Operator Capability Program
International Nuclear Information System (INIS)
Hollenbeck, D.A.; Krantz, E.A.; Hunt, G.L.; Meyer, O.R.
1980-01-01
The outline of the LOFT Augmented Operator Capability Program is presented. This program utilizes the LOFT (Loss-of-Fluid Test) reactor facility which is located at the Idaho National Engineering Laboratory and the LOFT operational transient experiment series as a test bed for methods of enhancing the reactor operator's capability for safer operation. The design of an Operational Diagnotics and Display System is presented which was backfit to the existing data acquisition computers. Basic color-graphic displays of the process schematic and trend type are presented. In addition, displays were developed and are presented which represent safety state vector information. A task analysis method was applied to LOFT reactor operating procedures to test its usefulness in defining the operator's information needs and workload
DEFF Research Database (Denmark)
Momeni, Mostafa; Nielsen, Susanne Balslev; Kafash, Mahdi Haghighi
2015-01-01
. The innovation capability is associated with other organizational capabilities. So, many organizations have focused on the need to identify innovation capabilities and resources or strengths in relation to external opportunities and threats according to inside-out view because innovation capability has...... capability in the organizations and this paper includes an expert based validation in three rounds of the Delphi method. This research proposed a direct relationship between Innovation Capability and three main capabilities that is called Structural Capability, Personnel Capability and Operational Capability...
Indigenous Technological Innovation : Capability and ...
International Development Research Centre (IDRC) Digital Library (Canada)
Indigenous Technological Innovation : Capability and Competitiveness in China's ... IDRC and key partners will showcase critical work on adaptation and ... Call for new OWSD Fellowships for Early Career Women Scientists now open.
Controlled adhesion and growth of long term glial and neuronal cultures on Parylene-C.
Directory of Open Access Journals (Sweden)
Evangelos Delivopoulos
Full Text Available This paper explores the long term development of networks of glia and neurons on patterns of Parylene-C on a SiO(2 substrate. We harvested glia and neurons from the Sprague-Dawley (P1-P7 rat hippocampus and utilized an established cell patterning technique in order to investigate cellular migration, over the course of 3 weeks. This work demonstrates that uncontrolled glial mitosis gradually disrupts cellular patterns that are established early during culture. This effect is not attributed to a loss of protein from the Parylene-C surface, as nitrogen levels on the substrate remain stable over 3 weeks. The inclusion of the anti-mitotic cytarabine (Ara-C in the culture medium moderates glial division and thus, adequately preserves initial glial and neuronal conformity to underlying patterns. Neuronal apoptosis, often associated with the use of Ara-C, is mitigated by the addition of brain derived neurotrophic factor (BDNF. We believe that with the right combination of glial inhibitors and neuronal promoters, the Parylene-C based cell patterning method can generate structured, active neural networks that can be sustained and investigated over extended periods of time. To our knowledge this is the first report on the concurrent application of Ara-C and BDNF on patterned cell cultures.
Measurement capability overview in PolyNano
DEFF Research Database (Denmark)
Calaon, Matteo; Tosello, Guido; Hansen, Hans Nørgaard
2012-01-01
A measurement capability overview has been conducted to evaluate, among the most used instruments in the field of nanometrology, where the PolyNano project should focus its research. The deliverable presents the most relevant instruments to achieve the best possible measurements accuracy matching...... requirements such as low uncertainty, high repeatability and resolution, adequate measuring range and availability among the different project partners. Based on the present measurement capability overview and in relation to the objective of PolyNano to “remove the technology barrier between lab‐scale proof...
Trends in Microfabrication Capabilities & Device Architectures.
Energy Technology Data Exchange (ETDEWEB)
Bauer, Todd [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Adam [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lentine, Tony [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mudrick, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Okandan, Murat [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Rodrigues, Arun [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-06-01
The last two decades have seen an explosion in worldwide R&D, enabling fundamentally new capabilities while at the same time changing the international technology landscape. The advent of technologies for continued miniaturization and electronics feature size reduction, and for architectural innovations, will have many technical, economic, and national security implications. It is important to anticipate possible microelectronics development directions and their implications on US national interests. This report forecasts and assesses trends and directions for several potentially disruptive microfabrication capabilities and device architectures that may emerge in the next 5-10 years.
Cloud-based Architecture Capabilities Summary Report
Energy Technology Data Exchange (ETDEWEB)
Vang, Leng [Idaho National Lab. (INL), Idaho Falls, ID (United States); Prescott, Steven R [Idaho National Lab. (INL), Idaho Falls, ID (United States); Smith, Curtis [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2014-09-01
In collaborating scientific research arena it is important to have an environment where analysts have access to a shared of information documents, software tools and be able to accurately maintain and track historical changes in models. A new cloud-based environment would be accessible remotely from anywhere regardless of computing platforms given that the platform has available of Internet access and proper browser capabilities. Information stored at this environment would be restricted based on user assigned credentials. This report reviews development of a Cloud-based Architecture Capabilities (CAC) as a web portal for PRA tools.
Sandia Laboratories technical capabilities: design, definition, and fabrication
International Nuclear Information System (INIS)
1976-12-01
This report characterizes the design definition and fabrication capabilities at Sandia Laboratories. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs. 13 figures
Sandia Laboratories technical capabilities: design, definition, and fabrication
Energy Technology Data Exchange (ETDEWEB)
1976-12-01
This report characterizes the design definition and fabrication capabilities at Sandia Laboratories. Selected applications of these capabilities are presented to illustrate the extent to which they can be applied in research and development programs. 13 figures.
Wilkes, R A; Aristilde, L
2017-09-01
Synthetic plastics, which are widely present in materials of everyday use, are ubiquitous and slowly-degrading polymers in environmental wastes. Of special interest are the capabilities of microorganisms to accelerate their degradation. Members of the metabolically diverse genus Pseudomonas are of particular interest due to their capabilities to degrade and metabolize synthetic plastics. Pseudomonas species isolated from environmental matrices have been identified to degrade polyethylene, polypropylene, polyvinyl chloride, polystyrene, polyurethane, polyethylene terephthalate, polyethylene succinate, polyethylene glycol and polyvinyl alcohol at varying degrees of efficiency. Here, we present a review of the current knowledge on the factors that control the ability of Pseudomonas sp. to process these different plastic polymers and their by-products. These factors include cell surface attachment within biofilms, catalytic enzymes involved in oxidation or hydrolysis of the plastic polymer, metabolic pathways responsible for uptake and assimilation of plastic fragments and chemical factors that are advantageous or inhibitory to the biodegradation process. We also highlight future research directions required in order to harness fully the capabilities of Pseudomonas sp. in bioremediation strategies towards eliminating plastic wastes. © 2017 The Society for Applied Microbiology.
Institutional Change, Strategic Orientation and Dynamic Capabilities
DEFF Research Database (Denmark)
Li, Ming Hua
2012-01-01
research streams including the resource-based view, institutional and organizational theory frameworks, as well as the dynamic capabilities perspective, we suggest that institutional change in China serves a formative role in the development of firm strategic orientation and dynamic capabilities leading......The phenomenon of systematic institutional change in many developing countries can produce enduring transformations in the strategic orientation and organization of domestic firms. Such changes may impact the formation of their dynamic capabilities and adaptive learning which can translate...... into visible differences in their internationalization strategies and pathways. Using China as an illustrative example of a transitioning economy experiencing upsurges in outward FDI, this study develops a theoretical framework to explain how institutional transformation at various levels of government led...
Contingent Capability of a Conceived Child: Civil Law Aspect
Kirillova, Elena A.; Suslikov, Vladimir N.; Blinkova, Elena V.; Blinkov, Oleg E.; Staroseltseva, Marina M.
2016-01-01
This paper covers on contingent legal capability of a conceived child. To protect the capability of conceived children and legal rights, including property, emerging on that basis, it is imperative to strictly identify the moment of emergence and termination of legal capability. The objective of this research is to analyze the provisions on civil…
Directory of Open Access Journals (Sweden)
Vaneuza M. Funke
2008-04-01
Full Text Available O mesilato de imatinibe é atualmente o tratamento de escolha para pacientes com Leucemia mielóide Crônica (LMC recém-diagnosticados. Desde os primeiros estudos clínicos em 1998 até o estudo IRIS, que comparou o uso em primeira linha de imatinibe com interferon + ara-C, esta droga vem se consolidando em segurança e eficácia. Ainda há, entretanto questionamentos sobre a melhor dose inicial, a identificação dos pacientes que mais se beneficiariam e a melhor abordagem frente a respostas sub-ótimas e resistência. Os principais estudos clínicos publicados com mesilato de imatinibe são revisados no presente artigo, e discutidos sob a perspectiva da realidade brasileira.Imatinib mesylate is currently the gold-standard therapy for patients with newly diagnosed Chronic Myelogenous Leukemia. From the clinical trials in 1998 to the IRIS study, which compared first line imatinib treatment with interferon and low dose ara-C, this drug has been consolidated in regards to its safety and efficacy. There are still some questions to answer. Which would be the best initial dose? Are there any patients who benefit more than others? What is the best approach to suboptimal response and resistance? The most important published clinical studies are reviewed in the current article and discussed from a Brazilian perspective.