WorldWideScience

Sample records for cantaloupe cucumis melo

  1. Cantaloupe melon ( Cucumis melo L. conservation using hydrocooling

    Directory of Open Access Journals (Sweden)

    Edna Maria Mendes Aroucha

    2016-04-01

    Full Text Available ABSTRACT Maintaining cantaloupe melon at field temperature impairs conservation as it speeds up cell metabolism and transpiration, and, consequently, reduces shelf life. This study aimed to evaluate the conservation of Torreon hybrid cantaloupe using the hydrocooling treatment. Fruits were harvested at the commercial maturity stage (60 days after planting, in the morning, at the Nova California Farm, municipality of Mossoró-RN, in September 2007. One set of fruit was immersed in chilled water at 5 ºC for 5 min, at the packing house, while the remaining set was not hydro cooled. Then, both sets (treated and untreated with hydrocooling were pre-cooled in air forced tunnels at 7 ºC, until the temperature in the pulp reached 10 ºC. Both fruit sets were stored for 0, 14, 21, 28 and 35 days under modified atmosphere at 3 ± 1 oC and 90 ± 5% RH. After each storage period, the fruits were incubated in an atmosphere-controlled chamber at 20 ± 2 oC and 80 ± 5% de RH, for seven days. The following characteristics were evaluated: external and internal appearance, mass loss, soluble solids, firmness and titrable acidity. The experiment was arranged in a completely randomized split-plot design with four replications of three fruits. The plots consisted of the hydrocooling conditions (with and without fruit soaking in chilled water, and the sub-plots consisted of the storage times (0, 14, 21, 28 and 35 days.The treatment with hydrocooling was efficient in keeping the firmness and soluble solids of the fruits and shortened the pre-cooling time in the cooling tunnel. However, hydrocooling did not increase fruit shelf-life.

  2. Caractéristiques physiques de la production du melon cantaloup Cucumis melo L., cultivé sous serre

    Directory of Open Access Journals (Sweden)

    Hannachi, C.

    1994-01-01

    Full Text Available Physical Characteristics Of Muskmelon Production, Cucumis melo L., Cultivated Under Greenhouse- Tunisia. Seven varieties of cantaloup muskmelon (Pancha, Sugdor, Supersprint, F^6802, Gallicum, Polidor, Pallas were cultivated in plastic house and tested for yield and fruit quality (fruit weight, index of refraction, thickness of flesh. Supersprint, Pancha and Sugdor were the more productive varieties. Their early yield represents 61 %, 62 %> and 53 %> of total yield : 4, 2 ; 5, 2 and 5, 7 kg/m2 respectively. Fruits had a commercial weight of more than 500 g and an acceptable gustative quality ; IR> 10. Fruit weight was positively correlated with viable seed number (pancha : IR was appreciated for Pancha, Sugdor and F^802 (IR> 12. The flesh of these three varieties was well developped, and it was probably influenced by the important seed number (523-610 seeds/fruit. It was 3 cm wide and 6 times as thick as the cortex (0, 5 cm. Pancha was significantly distinguished from others by the fruit number (6 fruits/plant. The introduction of honey bees may improve pollination of flowers and allowed to exploit better its potentialities.

  3. The use of gamma radiation aiming to post harvest conservation of Cantaloupe melon (Cucumis melo L. var. Cantaloupensis);Utilizacao de radiacao gama em meloes cantaloupe (Cucumis melo L. var. Cantaloupensis) como tecnica de conservacao pos-colheita

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Alessandra Aparecida Zilio Cozzo de

    2007-07-01

    Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a{sup *}) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a{sup *} and b{sup *}), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)

  4. The use of gamma radiation aiming to post harvest conservation of Cantaloupe melon (Cucumis melo L. var. Cantaloupensis)

    International Nuclear Information System (INIS)

    Siqueira, Alessandra Aparecida Zilio Cozzo de

    2007-01-01

    Although Brazilian fruit culture has been growing in the international market, the fruit quality and the post harvest technology have not been improved properly. In Brazil, fruit nutritional factors are very important because of their potential to provide suitable nutrients for a significant part of the Country population. Some post harvest technologies, such as ionizing radiation, can keep the physical, chemical, nutritional and sensorial characteristics of the natural fruit, improving the quality of the fruits in the market. This work evaluated the effects of Cobalt 60 irradiation in Cantaloupe melon, aiming the post harvest conservation during 7 days of storage, at a temperature ranging from 20 to 22 deg C. The doses of irradiation were set to 0, 150, 300, 450, 600, 750 and 900 Gy, based on the multiple of 150 Gy quarantine dose, aiming to establish the lowest, the highest and the ideal doses. Afterwards, physical, chemical and nutritional characteristics of irradiated fruit were checked and, finally, the sensorial characteristics through acceptability test. Results indicated that the doses higher than 450 Gy affected firmness, pulp yield and color (L and a * ) parameters. Nevertheless, analyzing physical, chemical and nutritional parameters, doses of 450 and 900 Gy kept pH, tetrable acidity, soluble solids, color (a * and b * ), chlorophyll and carotenoids, phenolic compounds, respiratory rate and ethylene level. The storage period was the most important factor that affected the quality of the fruit, despite of the radiation doses. Based on the acceptability test, the best evaluated fruits were from the treatments of 450 and 900 Gy. This work allowed to conclude that fruit radiation is an appropriate technology for Cantaloupe melon post harvest conservation, but it is necessary to be used in combination with other technologies, especially to fungi control. (author)

  5. Agrobacterium mediated transformation of Tunisian Cucumis melo ...

    African Journals Online (AJOL)

    Transgenic Cucumis melo cv. Maazoun containing the neomycin phosphotransferase II (NPT II) chimeric gene conferring resistance to kanamycin were obtained from cotyledons explants inoculated with Agrobacterium tumefaciens (GV3101) that contained the binary vector plasmid pADI. Transformed shoots were obtained ...

  6. Calidad de melón cantaloupe ( Cucumis melo cubierto con una película comestible de alginato - hpmc - parafina

    Directory of Open Access Journals (Sweden)

    Ma Concepción Reyes-Avalos

    2017-01-01

    Full Text Available Introducción : El melón es un fruto que tiene un corto periodo de almacenamiento. Una alternativa para extender este periodo es el uso de películas comestibles. En el presente estudio se evaluó el efecto de la aplicación de una película comestible de alginato de sodio - hidroxipropilmetilcelulosa - parafina (ALG - HPMC - PAR, sobre la calidad de melón Cantaloupe durante dos tipos de almacenamiento. Método : Frutos de melón Cantaloupe se cubrieron con una película comestible de alginato - hidroxipropilmetil celulosa - parafina (ALG - HPMC - PAR, y no cubiertos (CONTROL. Los melones se almacenaron por 21 días a 5ºC y 95% de humedad relativa (Hr. Cada siete días, los frutos se sometieron a análisis de índice de daños por frío, pérdida de peso, textura, y concentración de CO 2 y etileno d e la atmósfera interna del fruto. Además, para simular manejo comercial, al término de cada periodo de siete días en refrigeración, una muestra de melones era extraída del frigorífico y expuesta a condiciones ambientales de temperatura y humedad relativa ( 25ºC y 21 - 25% respectivamente durante tres días (almacenamiento combinado, y medidos los parámetros anteriormente mencionados. Resultados : La aplicación de la película comestible provocó que los frutos cubiertos tuvieran una mayor concentración de CO 2 y menor concentración de etileno en la atmósfera interna del fruto, contribuyendo a que los melones cubiertos mantuvieron su calidad por un mayor tiempo de almacenamiento, manteniéndose más firmes, con menor pérdida de peso y sufrir menor índice de daños por frío con respecto los frutos control. Discusión : Los resultados demuestran la factibilidad de la aplicación de películas comestibles para mantener la calidad del melón Cantaloupe almacenado en refrigeración y en almacenamiento combinado.

  7. Efeito do tipo de corte nas características físico-químicas e microbiológicas do melão 'cantaloupe' (Cucumis melo L. Híbrido hy-Mark minimamente processado Effect of type of cutting on the physical chemical and microbiological characteristics of 'Cantaloupe' melon (Cucumis melo L. Hybrid hy-Mark minimally processed

    Directory of Open Access Journals (Sweden)

    Ariane Cordeiro de Oliveira

    2007-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de dois tipos de cortes (manual e mecânico nas características físico-químicas e microbiológicas do melão 'Cantaloupe' minimamente processado e refrigerado. Frutos com grau de maturação adequado foram selecionados, lavados, sanificados (200 ppm de cloro ativo/2 minutos e processados de acordo com o tipo de corte. Os frutos utilizados para o corte mecânico foram descascados em máquina descascadora e após a retirada das sementes, submetidos ao corte com auxílio de máquina de corte. Os destinados ao corte manual foram descascados e cortados com auxílio facas, colocados em imersão em solução de hipoclorito de sódio (20 ppm de cloro ativo por 30 segundos e acondicionados em embalagens flexíveis PET, armazenados a 4°C ± 1°C e avaliados a cada três dias por um período de 15 dias. Ao final dos experimentos, concluiu-se que para o processamento mínimo de melão 'Cantaloupe', o corte manual foi o mais indicado, por apresentar melhor estabilidade das características de cor, textura, pH, umidade e contagens microbiológicas durante o armazenamento.The purpose of this work was to evaluate the effect of two types of cutting (manual and mechanic on the physical-chemical and microbiological characteristics of processed and refrigerated 'Cantaloupe' melon. The fruits in the appropriate stage of ripening were selected, washed, sanitized (200ppm of active chlorine/2 minutes and processed in agreement with types of cutting. The fruits used for the mechanical cutting were cutting in peeling machine and after at retreat of the seeds, submitted to the cutting with aid of cutting machine. The fruits destined at manual cutting were peeled and cut with aid of knives, immerged in chlorinated water (20 mg.L-1 of active chlorine for 30 seconds and conditioned in PET flexible packing, stored at 4°C ± 1°C and were carried out each three days during 15 days. At the end of the experiments it was

  8. Penetration, Post-penetration Development, and Reproduction of Meloidogyne incognita on Cucumis melo var. texanus.

    Science.gov (United States)

    Faske, T R

    2013-03-01

    Cucumis melo var. texanus, a wild melon commonly found in the southern United States and two accessions, Burleson Co. and MX 1230, expressed resistance to Meloidogyne incognita in preliminary experiments. To characterize the mechanism of resistance, we evaluated root penetration, post-penetration development, reproduction, and emigration of M. incognita on these two accessions of C. melo var. texanus. Additionally, we evaluated 22 accessions of C. melo var. texanus for their reaction against M. incognita in a greenhouse experiment. Fewer (P ≤ 0.05) J2 penetrated the root system of C. melo var. texanus accessions (Burleson Co. and MX 1230) and C. metuliferus (PI 482452) (resistant control), 7 days after inoculation (DAI) than in C. melo 'Hales Best Jumbo' (susceptible control). A delayed (P ≤ 0.05) rate of nematode development was observed at 7, 14, and 21 DAI that contributed to lower (P ≤ 0.05) egg production on both accessions and C. metuliferus compared with C. melo. Though J2 emigration was observed on all Cucumis genotypes a higher (P ≤ 0.05) rate of J2 emigration was observed from 3 to 6 DAI on accession Burleson Co. and C. metuliferus than on C. melo. The 22 accessions of C. melo var. texanus varied relative to their reaction to M. incognita with eight supporting similar levels of nematode reproduction to that of C. metuliferus. Cucumis melo var. texanus may be a useful source of resistance against root-knot nematode in melon.

  9. CmMDb: a versatile database for Cucumis melo microsatellite markers and other horticulture crop research.

    Science.gov (United States)

    Bhawna; Chaduvula, Pavan K; Bonthala, Venkata S; Manjusha, Verma; Siddiq, Ebrahimali A; Polumetla, Ananda K; Prasad, Gajula M N V

    2015-01-01

    Cucumis melo L. that belongs to Cucurbitaceae family ranks among one of the highest valued horticulture crops being cultivated across the globe. Besides its economical and medicinal importance, Cucumis melo L. is a valuable resource and model system for the evolutionary studies of cucurbit family. However, very limited numbers of molecular markers were reported for Cucumis melo L. so far that limits the pace of functional genomic research in melon and other similar horticulture crops. We developed the first whole genome based microsatellite DNA marker database of Cucumis melo L. and comprehensive web resource that aids in variety identification and physical mapping of Cucurbitaceae family. The Cucumis melo L. microsatellite database (CmMDb: http://65.181.125.102/cmmdb2/index.html) encompasses 39,072 SSR markers along with its motif repeat, motif length, motif sequence, marker ID, motif type and chromosomal locations. The database is featured with novel automated primer designing facility to meet the needs of wet lab researchers. CmMDb is a freely available web resource that facilitates the researchers to select the most appropriate markers for marker-assisted selection in melons and to improve breeding strategies.

  10. Characteristics and composition of cucumis melo seed oil

    International Nuclear Information System (INIS)

    Mushtaq, S.; Batool, F.; Akhtar, T.; Tariq, M.I.

    2011-01-01

    A comprehensive characterization study was carried out on Cucumis melo seed oil, in order to evaluate its suitability as an edible vegetable oil. The oil was extracted by sohxlet apparatus using n-hexane as solvent that produced a yield of 47.33% (w/w). The oil was found to have light yellow colour and an agreeable odour, showing density up to 0.728 g/cm/sup 3/. The values of refractive index, iodine number and saponification number came out to be 1.466 (at 25 deg. C), 135.6 g/100 g and 301.6 mg KOH/100 g, respectively. GC-analysis gave total unsaturation content of 64.9% with linolenic acid (C18:3) being the predominant showing a proportion of 43.4%, followed by heptadecanoic acid (C17:0) with 23.1% and palmitic acid (C16:0) with 8.7%. The physicochemical properties of this oil are highly comparable to those of soybean and sunflower oils. Therefore, the test melon seed-oil could be developed into different commercial products to serve as an alternate vegetable oil in region like Pakistan, where this melon grows abundantly. (author)

  11. Medieval emergence of sweet melons, Cucumis melo (Cucurbitaceae).

    Science.gov (United States)

    Paris, Harry S; Amar, Zohar; Lev, Efraim

    2012-07-01

    Sweet melons, Cucumis melo, are a widely grown and highly prized crop. While melons were familiar in antiquity, they were grown mostly for use of the young fruits, which are similar in appearance and taste to cucumbers, C. sativus. The time and place of emergence of sweet melons is obscure, but they are generally thought to have reached Europe from the east near the end of the 15th century. The objective of the present work was to determine where and when truly sweet melons were first developed. Given their large size and sweetness, melons are often confounded with watermelons, Citrullus lanatus, so a list was prepared of the characteristics distinguishing between them. An extensive search of literature from the Roman and medieval periods was conducted and the findings were considered in their context against this list and particularly in regard to the use of the word 'melon' and of adjectives for sweetness and colour. Medieval lexicographies and an illustrated Arabic translation of Dioscorides' herbal suggest that sweet melons were present in Central Asia in the mid-9th century. A travelogue description indicates the presence of sweet melons in Khorasan and Persia by the mid-10th century. Agricultural literature from Andalusia documents the growing of sweet melons, evidently casabas (Inodorous Group), there by the second half of the 11th century, which probably arrived from Central Asia as a consequence of Islamic conquest, trade and agricultural development. Climate and geopolitical boundaries were the likely causes of the delay in the spread of sweet melons into the rest of Europe.

  12. Fine genetic mapping of a locus controlling short internode length in melon (Cucumis melo L.)

    Science.gov (United States)

    Compact and dwarfing vining habits in melon (Cucumis melo L.; 2n = 2x = 24) may have commercial importance since they can contribute to the promotion of concentrated fruit set and can be planted in higher plant densities than standard vining types. A diminutive (dwarf) melon mutant line (PNU-D1) wi...

  13. A comparative analysis of phloem exudate proteins from Cucumis melo, Cucumis sativus and Cucurbita maxima by polyacrylamide gel electrophoresis and isoelectric focusing.

    Science.gov (United States)

    Sabnis, D D; Hart, J W

    1976-01-01

    Proteins in sieve tube exudate from Cucumis melo L., Cucumis sativus L. and Cucurbita maxima Duch. were analysed by gel electrophoresis and isoelectric focusing. Estimated molecular weights and isoelectric points for the major and minor proteins from each plant species are presented. Electrophoresis revealed striking differences between the protein complements of exudatc from the two genera investigated. Similarly, although a few exudate proteins from the two species of Cucumis possessed identical molecular weights, several major proteins were peculiar to each species. Isoelectric focusing of proteins in exudate samples from the three plants confirmed the marked differences in their protein complements. Furthermore, focusing also revealed differences between cultivars of Cucumis sativus. Both Cucumis sativus and Cucurbita maxima possessed relatively large amounts of basic proteins; these were absent in exudate from Cucumis melo. The implications of these results are discussed in relation to present concepts regarding the interrelationships and possible functional roles of P-proteins.

  14. Phylogenetics of Cucumis (Cucurbitaceae: Cucumber (C. sativus belongs in an Asian/Australian clade far from melon (C. melo

    Directory of Open Access Journals (Sweden)

    Schaefer Hanno

    2007-04-01

    Full Text Available Abstract Background Melon, Cucumis melo, and cucumber, C. sativus, are among the most widely cultivated crops worldwide. Cucumis, as traditionally conceived, is geographically centered in Africa, with C. sativus and C. hystrix thought to be the only Cucumis species in Asia. This taxonomy forms the basis for all ongoing Cucumis breeding and genomics efforts. We tested relationships among Cucumis and related genera based on DNA sequences from chloroplast gene, intron, and spacer regions (rbcL, matK, rpl20-rps12, trnL, and trnL-F, adding nuclear internal transcribed spacer sequences to resolve relationships within Cucumis. Results Analyses of combined chloroplast sequences (4,375 aligned nucleotides for 123 of the 130 genera of Cucurbitaceae indicate that the genera Cucumella, Dicaelospermum, Mukia, Myrmecosicyos, and Oreosyce are embedded within Cucumis. Phylogenetic trees from nuclear sequences for these taxa are congruent, and the combined data yield a well-supported phylogeny. The nesting of the five genera in Cucumis greatly changes the natural geographic range of the genus, extending it throughout the Malesian region and into Australia. The closest relative of Cucumis is Muellerargia, with one species in Australia and Indonesia, the other in Madagascar. Cucumber and its sister species, C. hystrix, are nested among Australian, Malaysian, and Western Indian species placed in Mukia or Dicaelospermum and in one case not yet formally described. Cucumis melo is sister to this Australian/Asian clade, rather than being close to African species as previously thought. Molecular clocks indicate that the deepest divergences in Cucumis, including the split between C. melo and its Australian/Asian sister clade, go back to the mid-Eocene. Conclusion Based on congruent nuclear and chloroplast phylogenies we conclude that Cucumis comprises an old Australian/Asian component that was heretofore unsuspected. Cucumis sativus evolved within this Australian

  15. Carbon dioxide evolution and temperature factors in early growth of plastic mulched plants. [Cucumis melo L. var. reticulatus; Lactuca sativa L. var. crispa

    Energy Technology Data Exchange (ETDEWEB)

    Betts, C.; Ruf, R.H. Jr.

    1966-01-01

    Cantaloupe (Cucumis melo L. var. reticulatus) and lettuce (Lactuca sativa L. var. crispa) were grown in the greenhouse in redwood boxes with bare and plastic mulched soil. Soil temperature in the bare boxes was equated to the plastic mulch with buried temperature coils. Bottled CO/sub 2/ was used to bring the concentration around the plants in bare soil up to the concentration around mulched plants. Carbon dioxide was sampled in leaf canopy. The temperature treatment increased the yields of the bare soil so that they were comparable to those of the plastic mulched soil. Yields from the soil with the auxiliary CO/sub 2/ were lower than those of the mulched treatment.

  16. Qualidade fisiológica e sanitária de sementes de melão (Cucumis melo Physiological and health quality of melon (Cucumis melo seeds

    Directory of Open Access Journals (Sweden)

    Marlove Fátima Brião Muniz

    2004-06-01

    Full Text Available O objetivo do trabalho foi avaliar a eficiência de diferentes testes na identificação do nível de vigor e da qualidade sanitária de lotes de sementes de melão (Cucumis melo L.. Foram avaliados quatro lotes de sementes das cultivares Gaúcho e Carvalho, submetidas aos testes de primeira contagem de germinação, emergência em campo, deterioração controlada, envelhecimento acelerado e sanidade. Os resultados indicaram que os testes de deterioração controlada e envelhecimento acelerado apresentam sensibilidade suficiente para avaliação do potencial fisiológico de sementes de melão, mas os testes de avaliação de plântulas não mostraram sensibilidade suficiente para realizar uma estratificação dos lotes pelo vigor. Aspergillus spp. e Fusarium oxysporum foram encontrados associados às sementes.The objective of this work was to evaluate the efficiency of different vigour tests in the identification of vigour levels and health quality of melon (Cucumis melo L. seeds. Four seed lots of Gaúcho and Carvalho cultivars were evaluated. Seeds were submitted to the first germination counting, field emergence, controlled deterioration and aging, cold vigour and health tests. Results indicated that controlled deterioration and accelerated aging tests presented enough sensibility for evaluating the physiological potential of melon seeds. Tests of seedling evaluation did not show enough sensibility to identify hiht quality seed lots. Aspergillus ssp. and Fusarium oxysporum were detected associated with seeds.

  17. KARAKTERISTIK ES KRIM HASIL MODIFIKASI DENGAN FORMULASI BUBUR TIMUN SURI (Cucumis melo L. DAN SARI KEDELAI [Characteristics of Modified Ice Cream Formulated with Cucumis melo L. Puree and Soybean Milk

    Directory of Open Access Journals (Sweden)

    Oksilia

    2012-06-01

    Full Text Available The objective of this research was to observe the physical and chemical characteristics of ice cream made with various formulations of Cucumis melo L. puree and soybean milk. The experiment was designed using Factorial Randomized Block Design with two treatments and each combination was replicated three times. The factors investigated were formulations of Cucumis melo L. puree (10, 12.5 and 15 % and soybean milk (40, 50 and 60%. The ice cream’s viscosity, overrun and melting time were determined, where as protein, fat and potassium content were analyzed. The results showed that the interaction of Cucumis melo L. puree and soybean milk formulation had significant effect on viscosity and overrun. Modified ice cream made with 12.5% Cucumis melo L. puree and 40% soybean milk was the best formula for producing modified ice cream. The resulted ice cream had viscosity of 1.03 cP, overrun 53.93% and melting time 23,58 minutes, while the protein, fat and potassium content were 5.18%, 70% and 1083.33 mg/L, respectively.

  18. Pengaruh Kombinasi Komposisi Media Organik dan Konsentrasi Nutrisi terhadap Daya Hasil Tanaman Melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Khoirul Bariyyah

    2015-08-01

    Full Text Available This research was addressed to study the effect of plant growth media composition and nutrients concentration on yield of Cucumis melo L. The research was designed in complete factorial test of 4x4 with three replicates. Mixed growth media of bokashi:cocopeat:husk charcoal were tested in four compositions, i.e. 90%:5%:5% (M1, 80%:10%:10%(M2, 70%:15%:15% (M3 and 60%:20%:20% (M4 respectively. The other tested factor was nutrients concentraion that consists of four levels, i.e. control/no nutrient given (K0, 2 g/L (K1, 4 g/L (K2 and 6 g/L (K3. The Action 434 variety of Cucumis melo L. seedlings were then transplanted into 10 kg’s polybag and allowed to grow till harvested. The results showed that Chlorophyll content of M1 plants were higher than others, but the highest sugar content was resulted by M3 plants, and the highest thick of flesh fruit was resulted by interaction 60% bokashi:20% cocopeat:20% husk charcoal with 4 g/L nutrient concentration.

  19. Pemacuan Pertumbuhan Melon (Cucumis melo L. dengan Cendawan Mikoriza Arbuskula dan Bakteri Azospirillum sp.

    Directory of Open Access Journals (Sweden)

    Lady Diana Tetelepta

    2016-10-01

    Full Text Available ABSTRACTMelon (Cucumis melo L. is a high economic value horticultural crop that is cultivated in some regions of Indonesia under fertilization management. Application of inorganic fertilizer continuously can reduce soil microbial abundance. One of the soil microbial that promote plant growth is arbuscular mycorrhizal fungi (AMF and Azospirillum sp. The aim of this study was to analysed the effect of AMF and Azospirillum sp. in promoting growth and production of melon. The experiment was carried out in a greenhouse and was arranged in a completely randomized design with five replicates. Five treatments tested were: control, fertilized with NPK, inoculated with AMF, inoculated with Azospirillum sp., inoculated with AMF + Azospirillum sp. The results showed that the effect of AMF on root growth and shoot growth were similar to NPK fertilizer. Azospirillum sp. increased root growth. On the other side, the effect of Azospirillum sp. on shoot growth was similar to NPK fertilizer. However, AMF and Azospirillum sp. inoculation solely increased plant height, fruit weight, fruit diameter, flavor and length of fruit storage. Meanwhile, combination of AMF and Azospirillum sp. increased plant height, root growth, shoot growth, fruit weight, fruit diameter, flavor and length of fruit storage. This study revealed that application of AMF and Azospirillum sp. in melon cultivation was more effective and efficient than NPK fertilizer.Keywords: arbuscular mycorrhizal fungi, Azospirillum sp., Cucumis melo L.

  20. Identification of Local Melon (Cucumis melo L. var. Bartek Based on Chromosomal Characters

    Directory of Open Access Journals (Sweden)

    BUDI SETIADI DARYONO

    2011-12-01

    Full Text Available Bartek is one of local melon varieties mainly cultivated in Pemalang, Central Java. Bartek has three variations of fruits; Long-Green, Ellips-Green, and Yellow. Chromosome characterization of the Bartek was investigated to determine the genetic variation. The main purpose of this research was to determine the genetic characters of Bartek including chromosome number, mitosis, cell cycle, and karyotype. Squash method was used for chromosome preparation. The results showed that all of Bartek observed in this study have similar diploid (2n chromosome number = 24. According to the total number of chromosome, Bartek is closer to melon than cucumber. The mitotic analysis exhibited that the Bartek has similar karyotype formula, 2n = 2x = 24m. Based on the R value of the three kinds of Bartek (R < 0.27, it indicated that three kinds of Bartek were considered to be originated from similar species and one of melon varieties (Cucumis melo L. var. Bartek.

  1. Potencialidades fitoquímicas do melão (Cucumis melo L. na região Noroeste do Rio Grande do Sul - Brasil Phytochemical potentialities of melon (Cucumis melo L. in the northwest region of Rio Grande do Sul - Brazil

    Directory of Open Access Journals (Sweden)

    N.G. Muller

    2013-01-01

    Full Text Available O melão (Cucumis melo L. é uma fruta muito apreciada por suas qualidades e sua produção vem crescendo e ganhando espaço no mercado nacional e internacional. Em regiões como o Noroeste do Rio Grande do Sul, destaca-se como uma nova alternativa de renda para vários agricultores. Neste contexto, o presente trabalho teve como objetivo analisar o potencial fitoquímico de alguns cultivares de melão da região Noroeste do Rio Grande do Sul. A análise fitoquímica utilizando como farmacógeno as folhas, foi realizada para a verificação da presença de metabólitos secundários, tais como: saponinas, cumarinas, cardiotônicos, cianogenéticos, alcalóides, taninos, antraquinonas, flavonoides, e óleos voláteis. Também foi avaliado o teor de suco a partir dos frutos. Dentre os cinco cultivares analisados, Gaúcho, Imperial, Hy Mark, Magelan, e Cantaloupe, o cultivar Gaucho apresentou a maior variedade em metabólitos secundários. Na avaliação do teor de suco a cultivar Magelan se destacou em comparação às demais cultivares testadas.The melon (Cucumis melo L. is a fruit highly appreciated for its qualities and its production has been growing and gaining space in the national and in the international market. In regions like the northwest of Rio Grande do Sul - Brazil, it stands out as a new income alternative for farmers. In this context, this study aimed to analyze the phytochemical potential of some melon cultivars in the northwest region of Rio Grande do Sul. The phytochemical analysis, using the leaves as pharmacogen, was performed to verify the presence of secondary metabolites such as saponins, coumarins, cardiac glycosides, cyanogenetic glicosides, alkaloids, tannins, anthraquinones, flavonoids and volatile oils. The juice content from the fruits was also evaluated. Among the five analyzed cultivars, Gaucho, Imperial, Hy Mark, Magelan and Cantaloupe, cultivar Gaucho had the greatest variety of secondary metabolites. In the

  2. Neuroprotective effect of Cucumis melo Var. flexuosus leaf extract on the brains of rats with streptozotocin-induced diabetes.

    Science.gov (United States)

    Ibrahim, Doaa S

    2017-02-01

    The central nervous system is one of the most vulnerable organs affected by the oxidative stress associated with diabetes mellitus. Healthy food provides an important source for antioxidants. Therefore, the protective effect of Cucumis melo var. flexuosus (C. melo var. flexuosus) leaf extract on the brains of diabetic rats was investigated. Adult male albino rats divided into 5 groups of 6 rats each were assigned into a normal control group and four diabetic groups. Diabetes was induced in rats by a single intraperitoneal injection of streptozotocin (STZ; 60 mg/kg bw). One of the four diabetic groups was left untreated and was considered as a diabetic control group while the three other groups were treated with C. melo var. flexuosus leaf extract at the doses of 30, 60 and 120 mg/kg bw for a period of 30 days. After completion of experimental duration plasma and brains were used for evaluating biochemical changes. The obtained data showed that C. melo var. flexuosus leaf extract treatment lowered blood glucose, glycated hemoglobin, brain tumor necrosis factor-alpha, interleukin levels, brain malondialdehyde content and caspase-3 activity. Furthermore, the treatment resulted in a marked increase in plasma dopamine, melatonin, brain vascular endothelial growth factor-A levels, brain catalase and superoxide dismutase activities. From the present study, it can be concluded that the C. melo var. flexuosus leaf extract exerts a neuroprotective effect against oxidative damage associated with diabetes.

  3. Pembuatan Fruit Leather dari Campuran Buah Sirsak (Annoma Muricata L.)dan Buah Melon (Cucumis Melo L.)

    OpenAIRE

    Risti, Andika Pranata; Herawati, Netti

    2017-01-01

    Theaim of this study wasto get the best treatment fruit leather from mixed soursop (Annoma muricata L.) and melon (Cucumis melo L.). The study used a Complete Randomized Design (CRD) with 6 treatments and 3 replications.The treatments were SM1 (soursop 100 : melon 0), SM2 (soursop80 : melon 20), SM3 (soursop60 : melon40), SM4 (soursop40 : melon60) SM5 (soursop20 : melon80) and SM6 (soursop 0 : melon 100). The data were analyzed statistically using ANOVA and DNMRT at 5%. Thestudyshowed that ...

  4. Enhanced Virulence Gene Activity of Agrobacterium in Muskmelon (Cucumis melo L. cv. ‘Birdie’

    Directory of Open Access Journals (Sweden)

    Abul K.M. MOHIUDDIN

    2011-05-01

    Full Text Available Muskmelon (Cucumis melo L. cultivar ‘Birdie’, was evaluated for its response to the tumorigenic Agrobacterium tumefaciens and the oncogenic A. rhizogenes strains. Stem and petiole of three week-old in vitro-grown muskmelon plants were inoculated with five strains of A. tumefaciens and A. rhizogenes each and observed phenotypic expressions i.e. induction of crown galls and hairy roots. This phenotypic expression was efficaciously increased when virulence gene activity of different strains of two Agrobacterium species was enhanced. Intensive studies on enhancement of virulence gene activity of Agrobacterium found to be correlated to the appropriate light intensity (39.3 μmol m-2 s-1 with a specific concentration of monocyclic phenolic compound, acetosyringone (20 μM. The gene activity was also influenced by several other physical factors e.g. plant tissue type, Agrobacterium species and their strains, and plant tissue-Agrobacterium interaction. Among the different A. tumefaciens strains, LBA4404 showed the best virulence gene activity in both stem and petiole through the formation of higher rate of crown galls. On the other hand, strain 15834 of A. rhizogenes showed better gene activity in stem and 8196 in petiole through the formation of higher rate of hairy roots as well as higher average number of hairy roots. Among the two different types of explants, petiole was more susceptible to both Agrobacterium species. Thus it was concluded that future muskmelon transformation study can efficiently be carried out with LBA4404, 15834 and 8196 strains using petiole explants by adding 20 μM of acetosyringone in the medium.

  5. Heterologous Expression and Biochemical Characterization of Two Lipoxygenases in Oriental Melon, Cucumis melo var. makuwa Makino.

    Directory of Open Access Journals (Sweden)

    Songxiao Cao

    Full Text Available Lipoxygenases (LOXs are a class of non-heme iron-containing dioxygenases that catalyse oxidation of polyunsaturated fatty acids to produce hydroperoxidation that are in turn converted to oxylipins. Although multiple isoforms of LOXs have been detected in several plants, LOXs in oriental melon have not attracted much attention. Two full-length LOX cDNA clones, CmLOX10 and CmLOX13 which have been isolated from oriental melon (Cucumis melo var. makuwa Makino cultivar "Yumeiren", encode 902 and 906 amino acids, respectively. Bioinformatics analysis showed that CmLOX10 and CmLOX13 included all of the typical LOX domains and shared 58.11% identity at the amino acid level with each other. The phylogenetic analysis revealed that CmLOX10 and CmLOX13 were members of the type 2 13-LOX subgroup which are known to be involved in biotic and abiotic stress. Heterologous expression of the full-length CmLOX10 and truncated CmLOX13 in Escherichia coli revealed that the encoded exogenous proteins were identical to the predicted molecular weights and possessed the lipoxygenase activities. The purified CmLOX10 and CmLOX13 recombinant enzymes exhibited maximum activity at different temperature and pH and both had higher affinity for linoleic acid than linolenic acid. Chromatogram analysis of reaction products from the CmLOX10 and CmLOX13 enzyme reaction revealed that both enzymes produced 13S-hydroperoxides when linoleic acid was used as substrate. Furthermore, the subcellular localization analysis by transient expression of the two LOX fusion proteins in tobacco leaves showed that CmLOX10 and CmLOX13 proteins were located in plasma membrane and chloroplasts respectively. We propose that the two lipoxygenases may play different functions in oriental melon during plant growth and development.

  6. The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo

    KAUST Repository

    Latrasse, David

    2017-05-08

    BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.

  7. The quest for epigenetic regulation underlying unisexual flower development in Cucumis melo

    KAUST Repository

    Latrasse, David; Rodriguez-Granados, Natalia Y.; Veluchamy, Alaguraj; Mariappan, Kiruthiga Gayathri; Bevilacqua, Claudia; Crapart, Nicolas; Camps, Celine; Sommard, Vivien; Raynaud, Cé cile; Dogimont, Catherine; Boualem, Adnane; Benhamed, Moussa; Bendahmane, Abdelhafid

    2017-01-01

    BackgroundMelon (Cucumis melo) is an important vegetable crop from the Cucurbitaceae family and a reference model specie for sex determination, fruit ripening and vascular fluxes studies. Nevertheless, the nature and role of its epigenome in gene expression regulation and more specifically in sex determination remains largely unknown.ResultsWe have investigated genome wide H3K27me3 and H3K9ac histone modifications and gene expression dynamics, in five melon organs. H3K9ac and H3K27me3 were mainly distributed along gene-rich regions and constrained to gene bodies. H3K9ac was preferentially located at the TSS, whereas H3K27me3 distributed uniformly from TSS to TES. As observed in other species, H3K9ac and H3K27me3 correlated with high and low gene expression levels, respectively. Comparative analyses of unisexual flowers pointed out sex-specific epigenetic states of TFs involved in ethylene response and flower development. Chip-qPCR analysis of laser dissected carpel and stamina primordia, revealed sex-specific histone modification of MADS-box genes. Using sex transition mutants, we demonstrated that the female promoting gene, CmACS11, represses the expression of the male promoting gene CmWIP1 via deposition of H3K27me3.ConclusionsOur findings reveal the organ-specific landscapes of H3K9ac and H3K27me3 in melon. Our results also provide evidence that the sex determination genes recruit histone modifiers to orchestrate unisexual flower development in monoecious species.

  8. REQUERIMENTOS DE POLINIZAÇÃO DO MELOEIRO (Cucumis melo l. NO MUNICÍPIO DE ACARAÚ - CE - BRASIL

    Directory of Open Access Journals (Sweden)

    Raimundo Maciel Sousa

    2009-01-01

    Full Text Available This work was carried in commercial areas cultivate with muskmelon (Cucumis melo L., variety AF- 646, in the municipal district of Acaraú, state of Ceará, Brazil. The investigation was split in four treatments: hand cross pollination, open pollination in presence of the honey bee hives, open pollination and resricted pollination. The observed variables were: rate of fruit set, fruit weight and seed number of fruits. The hand cross pollination showed the best effect to number of fruit set, fruit weight and seed number of fruits, following to open pollination in presence of the honey bee hives, open pollination and resricted pollination, without fruit set. Considering the melon cultivated at open fields and during the dry season in NE Brazil, it is possible to conclude that it depends on biotic pollinators and that honeybees promote efficientily the pollination.

  9. Visita de abejas (Apis mellifera, Hymenoptera: Apoidea a flores de melón Cucumis melo (Cucurvitaceae en Panamá

    Directory of Open Access Journals (Sweden)

    Juan Carlos Di Trani de la Hoz

    2007-06-01

    Full Text Available Se observaron las visitas observadas a flores seleccionadas en un cultivo del Distrito de San Lorenzo, Chiriquí, del 6 de Enero y el 19 de Febrero del 2002, desde las 6:30 am hasta las 4:30 pm, y se anotaron características de las visita, como el tiempo de visita y el tipo de recurso colectado. Las visitas fueron mayormente para la recolección de néctar (casi 3/4. La recolección de polen se concentró hacia las primeras horas de la mañana, cesando definitivamente a las 11:00 am. El tiempo medio de recolección fue similar para ambos recursos, pero fue marcadamente distinto para cada sexo floral. Las visitas a flores femeninas fueron significativamente (Prueba t Student, pBee (Apis mellifera, Hymenoptera: Apoidea visitation to cantaloupe Cucumis melo (Cucurvitaceae flowers in Panama. Flower visits by bees were observed in a melon cultivated field of San Lorenzo district, in Chiriquí, Panama, from January 6 to February 19, 2002, from 6:30 am to 4:30 pm We recorded the duration of each foraging event and the type of resource collected. Flower visits were mostly for nectar collection (∼75 %. Pollen foraging was concentrated in the first hours of the morning and ended by 11:00 am The mean collection time was similar for both food resources, but was different between flower sexes. Flower visits to female flowers took longer (Student's t test, p<0.0001, with a mean time duration of 8.4±4.4 s, whereas in male flowers mean visitation time was of 4.0±1.5 s. Finally, the mean time for each floral sex remained practically constant through the evolution of the crop. Our results were similar to the found ones in temperate zone crops, so apparently tropical conditions of Panama do not change the bee visit patterns on melon flowers. Rev. Biol. Trop. 55 (2: 677-680. Epub 2007 June, 29.

  10. Desarrollo del cultivo de melón (Cucumis melo con vermicompost bajo condiciones de invernadero / Development of muskmelon (Cucumis melo with vermicompost under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Alejandro Moreno-Reséndez

    2014-04-01

    Full Text Available Se determinó el efecto del vermicompost (VC sobre el desarrollo del melón en invernadero utilizando como sustratos cuatro tipos de VC mezclados con arena de río (AR, con relaciones 25 : 75, 30 : 70, 35 : 65 y 40 : 60 (% en volumen. Los VC se prepararon a partir de estiércoles de caballo, cabra, conejo y bovino. Los sustratos se colocaron en bolsas de polietileno negro, de 20 kg de capacidad, en donde se sembraron semillas del melón Cantaloupe. Las plantas se condujeron a un solo tallo, tutorando con rafia y la demanda hídrica se cubrió con riego por goteo. Las bolsas, utilizadas como macetas, se colocaron en fila a doble hilera, con arreglo a tresbolillo. Se utilizó un diseño de bloques completos al azar en arreglo factorial 4x4 con cuatro repeticiones. El factor A fueron las mezclas VC : AR y el B los diferentes VC. El análisis de varianza mostró que con 40 % de VC, independientemente del VC usado, se registraron diferencias altamente significativas (P ≤ 0.01 para rendimiento, peso de fruto, diámetros ecuatorial y polar, espesor de pulpa, cavidad de la placenta y días a cosecha, con 96.386 t ha-1, 1.688 kg fruto-1, 14.55 cm, 16.73 cm, 3.77 cm, 5.57 cm y 89 d respectivamente, sin importar el tipo de estiércol utilizado en las mezclas con VC. El contenido promedio de sólidos solubles en los frutos resultó estadísticamente igual en cualquier nivel y tipo de VC empleado.

  11. Qualidade de melão rendilhado (Cucumis melo L. em função do sistema de cultivo Quality of net melon (Cucumis melo L. in function of the culture system

    Directory of Open Access Journals (Sweden)

    Pablo Forlan Vargas

    2008-02-01

    Full Text Available Objetivou-se com este trabalho avaliar a qualidade de frutos de cinco cultivares de melão rendilhado (Cucumis melo L., cultivados em casa de vegetação, em função do sistema de produção. O experimento foi instalado em casa de vegetação na UNESP-FCAV, Jaboticabal-SP, no período de novembro de 2005 à fevereiro de 2006. O experimento foi delineado em esquema fatorial 5 X 2, em blocos casualizados com quatro repetições. Os tratamentos resultaram da combinação de cinco híbridos de melão rendilhado: Maxim, Bônus 2, Shinju 200, Fantasy e Louis e dois sistemas de cultivo: no solo e em substrato de fibra da casca de coco. As características avaliadas foram: massa fresca do fruto, espessura de mesocarpo, intensidade de rendilhamento da casca, pH, sólidos solúveis totais, acidez titulável, índice de maturação (RATIO, e vitamina C. Não houve interação significativa entre os sistemas de cultivo e cultivares para nenhuma das características avaliadas. O cultivo de melão em substrato resultou em frutos com qualidade superior ao cultivo em solo. Os híbridos Louis e Fantasy foram os que apresentaram melhor desempenho qualitativo de frutos.The aim of this study was to evaluate the fruit quality of five net melon (Cucumis melo L. cultivars, grown in a greenhouse, in function of production system. The study was carried out in a greenhouse at UNESP-FCAV, Jaboticabal-SP, Brazil, during the period of November, 2005 to February, 2006. The study was carried out using a 5 x 2 factorial scheme, in randomized complete block design with four repetitions. The treatments resulted the combination of five net melon hybrids: Maxim, Bônus 2, Shinju 200, Fantasy and Louis and two cultivations systems: in soil and in coconut fiber substrate. The characters evaluated were: fresh weight of fruit, mesocarp thickness, fruit shape index, pH, total soluble solids, titratable acidity, maturation index (RATIO; and vitamin C. No interactions were observed

  12. Pengaruh Pemberian Mikoriza Vesikula Arbuskula (MVA Campuran terhadap Kemunculan Penyakit Layu Fusarium pada Tanaman Melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Najmah Farhati

    2017-09-01

    Full Text Available Melon (Cucumis melo L. has economic potential to be cultivated because the fruit contains protein, fat, carbohydrate, calcium, phosphor, fiber, iron, vitamin A, vitamin B1, vitamin B2, vitamin C, and niacin. Fusarium wilt caused by Fusarium oxysporum will decrease melon crop production. One of controlling method to Fusarium wilt diseases on melon plants which safe for environtmental by using biological control. One of microorganisms which can be biological control agent is Vesicular Arbuscular Mycorrhiza (VAM. This research use experimental method with a Completely Randomized Design (CRD. The experimental treatment consists of two types of treatment which combine 5 doses of VAM mixture ( 0 g/plant, 10 g/plant, 12,5 g/plant, 15 g/plant, 17,5 g/plant and two inoculation method VAM is inoculated when seeds are planted and inoculation when the seedlings are replanted. Each treatment was repeated 3 times and each unit consist of three plant, so there are 30 units of experiments or 90 plants. The main variabels are observed consist of the incubation periode of the disease and the intensity of fusarium wilt and the supporting variabels consist of pH, temperature, humidity, and the scale of infection. The mixed MVA 15 g/plant dosage inoculated when seeds are planted and 15 g/plant dosage inoculated when the seedlings are replanted is the most effective to suppress incubation period of Fusarium wilt disease.

  13. Plantas hospederas de los virus más importantes que infectan el melón, Cucumis melo (Cucurbitaceae) en Costa Rica

    OpenAIRE

    Sánchez, M.V.; Agüero, R.; Rivera, C.

    1998-01-01

    Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV) que infectan el cultivo de melón (Cucumis melo L.) para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, ...

  14. Estimativa do plastocrono em meloeiro (Cucumis melo L. cultivado em estufa plástica em diferentes épocas do ano

    Directory of Open Access Journals (Sweden)

    Streck Nereu Augusto

    2005-01-01

    Full Text Available O meloeiro (Cucumis melo L. é uma hortaliça de alto valor econômico. A emissão de nós é um componente importante em modelos matemáticos de simulação do crescimento e desenvolvimento de culturas de hábito de crescimento decumbente como o meloeiro e outras cucurbitáceas. A emissão de nós pode ser calculada utilizando-se o conceito do plastocrono, que é o intervalo de tempo entre o aparecimento de nós sucessivos em uma haste de dicotiledôneas. Quando a soma térmica é usada como medida de tempo fisiológico em plantas, o plastocrono tem como unidades degreesC dia nó-1. Estudos anteriores mostraram que o plastocrono em meloeiro varia com o genótipo e a época de cultivo. Este trabalho teve por objetivo estimar o plastocrono em meloeiro transplantado em diferentes épocas de cultivo no interior de estufa plástica. Foram realizadas 12 épocas de semeadura e transplante no interior de uma estufa plástica de 10m X 25m, coberta com polietileno transparente de baixa densidade, localizada no Campo Experimental do Departamento de Fitotecnia da Universidade Federal de Santa Maria, RS. O híbrido utilizado foi o HY-MARK (grupo Cantaloupe. Em 12 plantas etiquetadas por época de transplante, contou-se o número de nós visíveis (NN na haste principal da planta duas vezes por semana. A soma térmica diária (STd, degreesC dia foi calculada levando-se em conta as temperaturas cardinais de aparecimento de nós em meloeiro (10, 34 e 45degreesC. A soma térmica acumulada (STa, degreesC dia, a partir da data de transplante das plântulas, foi calculada somando-se a STd. O plastocrono foi calculado como sendo o inverso do coeficiente angular da regressão linear entre NN e STa para cada época. O plastocrono calculado variou entre as épocas de cultivo de 13,4 a 21,8degreesC dia nó-1, com um valor médio de 18,6 (?2,3degreesC dia nó-1. Esta diferença de plastocrono entre as épocas de cultivo pode representar vários dias do calendário civil

  15. Physiological effects of ozone on cultivars of watermelon (Citrullus lanatus) and muskmelon (Cucumis melo) widely grown in Spain.

    Science.gov (United States)

    Fernandez-Bayon, J M; Barnes, J D; Ollerenshaw, J H; Davison, A W

    1993-01-01

    Two cultivars of watermelon (Citrullus lanatus) and muskmelon (Cucumis melo), which are widely grown in Spain, were exposed to ozone (70 nl litre(-1), 6 h d(-1)) for 21 days. Ozone sensitivity was assessed by recording the extent of visible injury, changes in fast-fluorescence kinetics, the relative-growth rate (R) of root (RR) and shoot (RS), and effects on the number of flowers produced per plant. Leaf gas exchange was measured in order to provide some indication of the factors underlying differential response to ozone. After 9-10 days of fumigation, all the cultivars developed typical visible symptoms of zone injury on the older leaves. However, significant (P watermelon, there was a marked reduction in the rate of CO(2) assimilation as a result of exposure to ozone, and this was accompanied by a parallel decrease in stomatal conductance. Mean plant-relative-growth rate (R) was markedly (P watermelon, but there were no significant effects on R in muskmelon. Ozone reduced root growth relative to the shoot in three out of four cultivars-an effect that may be of considerable ecological significance. Moreover, exposure to ozone reduced flower production in both muskmelon and watermelon, which indicated effects on yield. There was no correlation between a variety of methods used to assess ozone sensitivity and visible injury, and reasons for this are discussed. This observation draws clear attention to the dangers in ranking plants for ozone sensitivity purely on the basis of visible symptoms. It is concluded from this study that ozone-insensitive genotypes should be identified and considered for planting in the major areas of melon production concentrated on the Mediterranean coast of Spain.

  16. The Alcohol Dehydrogenase Gene Family in Melon (Cucumis melo L.: Bioinformatic Analysis and Expression Patterns

    Directory of Open Access Journals (Sweden)

    Yazhong eJin

    2016-05-01

    Full Text Available Alcohol dehydrogenases (ADH, encoded by multigene family in plants, play a critical role in plant growth, development, adaptation, fruit ripening and aroma production. Thirteen ADH genes were identified in melon genome, including 12 ADHs and one formaldehyde dehydrogenease (FDH, designated CmADH1-12 and CmFDH1, in which CmADH1 and CmADH2 have been isolated in Cantaloupe. ADH genes shared a lower identity with each other at the protein level and had different intron-exon structure at nucleotide level. No typical signal peptides were found in all CmADHs, and CmADH proteins might locate in the cytoplasm. The phylogenetic tree revealed that 13 ADH genes were divided into 3 groups respectively, namely long-, medium- and short-chain ADH subfamily, and CmADH1,3-11, which belongs to the medium-chain ADH subfamily, fell into 6 medium-chain ADH subgroups. CmADH12 may belong to the long-chain ADH subfamily, while CmFDH1 may be a Class III ADH and serve as an ancestral ADH in melon. Expression profiling revealed that CmADH1, CmADH2, CmADH10 and CmFDH1 were moderately or strongly expressed in different vegetative tissues and fruit at medium and late developmental stages, while CmADH8 and CmADH12 were highly expressed in fruit after 20 days. CmADH3 showed preferential expression in young tissues. CmADH4 only had slight expression in root. Promoter analysis revealed several motifs of CmADH genes involved in the gene expression modulated by various hormones, and the response pattern of CmADH genes to ABA, IAA and ethylene were different. These CmADHs were divided into ethylene-sensitive and –insensitive groups, and the functions of CmADHs were discussed.

  17. Cucumis melo ssp. Agrestis var. Agrestis Ameliorates High Fat Diet Induced Dyslipidemia in Syrian Golden Hamsters and Inhibits Adipogenesis in 3T3-L1 Adipocytes.

    Science.gov (United States)

    Shankar, Kripa; Singh, Sumit K; Kumar, Durgesh; Varshney, Salil; Gupta, Abhishek; Rajan, Sujith; Srivastava, Ankita; Beg, Muheeb; Srivastava, Anurag Kumar; Kanojiya, Sanjeev; Mishra, Dipak K; Gaikwad, Anil N

    2015-10-01

    Cucumis melo ssp. agrestis var. agrestis (CMA) is a wild variety of C. melo. This study aimed to explore anti-dyslipidemic and anti-adipogenic potential of CMA. For initial anti-dyslipidemic and antihyperglycemic potential of CMA fruit extract (CMFE), male Syrian golden hamsters were fed a chow or high-fat diet with or without CMFE (100 mg/kg). Further, we did fractionation of this CMFE into two fractions namely; CMA water fraction (CMWF) and CMA hexane fraction (CMHF). Phytochemical screening was done with liquid chromatography-mass spectrometry LC- (MS)/MS and direct analysis in real time-MS to detect active compounds in the fractions. Further, high-fat diet fed dyslipidemic hamsters were treated with CMWF and CMHF at 50 mg/kg for 7 days. Oral administration of CMFE and both fractions (CMWF and CMHF) reduced the total cholesterol, triglycerides, low-density lipoprotein cholesterol, and very low-density lipoprotein-cholesterol levels in high fat diet-fed dyslipidemic hamsters. CMHF also modulated expression of genes involved in lipogenesis, lipid metabolism, and reverse cholesterol transport. Standard biochemical diagnostic tests suggested that neither of fractions causes any toxicity to hamster liver or kidneys. CMFE and CMHF also decreased oil-red-O accumulation in 3T3-L1 adipocytes. Based on these results, it is concluded that CMA possesses anti-dyslipidemic and anti-hyperglycemic activity along with the anti-adipogenic activity. The oral administration of Cucumis melo agrestis fruit extract (CMFE) and its fractions (CMWF and CMHF) improved serum lipid profile in HFD fed dyslipidemic hamsters.CMFE, CMWF and CMHF significantly attenuated body weight gain and eWAT hypertrophy.The CMHF decreased lipogenesis in both liver and adipose tissue.CMFE and CMHF also inhibited adipogenesis in 3T3-L1 adipocytes. Abbreviation used: CMA: Cucumis melo ssp. agrestis var. agrestis, CMFE: CMA fruit extract, CMWF: CMA water fraction, CMHF: CMA hexane fraction, FAS: Fatty acid

  18. Construction of a genome-anchored, high-density genetic map for melon (Cucumis melo L.) and identification of Fusarium oxysporum f. sp. melonis race 1 resistance QTL.

    Science.gov (United States)

    Branham, Sandra E; Levi, Amnon; Katawczik, Melanie; Fei, Zhangjun; Wechter, W Patrick

    2018-04-01

    Four QTLs and an epistatic interaction were associated with disease severity in response to inoculation with Fusarium oxysporum f. sp. melonis race 1 in a recombinant inbred line population of melon. The USDA Cucumis melo inbred line, MR-1, harbors a wealth of alleles associated with resistance to several major diseases of melon, including powdery mildew, downy mildew, Alternaria leaf blight, and Fusarium wilt. MR-1 was crossed to an Israeli cultivar, Ananas Yok'neam, which is susceptible to all of these diseases, to generate a recombinant inbred line (RIL) population of 172 lines. In this study, the RIL population was genotyped to construct an ultra-dense genetic linkage map with 5663 binned SNPs anchored to the C. melo genome and exhibits the overall high quality of the assembly. The utility of the densely genotyped population was demonstrated through QTL mapping of a well-studied trait, resistance to Fusarium wilt caused by Fusarium oxysporum f. sp. melonis (Fom) race 1. A major QTL co-located with the previously validated resistance gene Fom-2. In addition, three minor QTLs and an epistatic interaction contributing to Fom race 1 resistance were identified. The MR-1 × AY RIL population provides a valuable resource for future QTL mapping studies and marker-assisted selection of disease resistance in melon.

  19. Functional method implementation of post-crop conservation of melon cantaloupe, using ionizing radiation as quality control technique in productive chain; Implantacao de metodo funcional de conservacao pos-colheita de meloes cantaloupe, utilizando as radiacoes ionizantes como tecnica de controle de qualidade na cadeia produtiva

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Alessandra A.Z. Cozzo de; Matraia, Clarice; Walder, Julio Marcos M. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Dept. de Irradiacao de Alimentos e Radioentomologia]. E-mail: aazcozzo@cena.usp.br; Spoto, Marta H.F.; Silva, Paula P.M. da; Maretti, Marina S. [Escola Superior de Agricultura Luiz de Queiroz, Piracicaba, SP (Brazil). Dept. de Agroindustria, Alimentos e Nutricao

    2005-07-01

    The Brazilian fruit culture is an alternative to minimize the lack-of-food problem using management and post harvest appropriate techniques. Gamma radiation technology is a possible technique used for food, enlarging its shelf-life, eliminating pathogenic microorganisms and in the quarantine treatment. The irradiation with seven doses (150,300,450,600,750 and 900 Gy) was used in Cantaloupe melon (Cucumis melon var. Cantaloupensis) aiming to establish the minimum, maximum and ideal doses, according to Brazilian laws, analyzing weight, color, firmness, pulp and juice quantity and sensory aspects, using the Difference Control Test. The results indicate that storage influenced significantly the weight, color and pulp quantity parameters. Doses higher than 450 Gy however influenced the firmness, juice quantity and sensory aspects characteristics. These results are indicating that the minimum dose was 150 Gy, the maximum dose was 900 Gy and the ideal dose for the quarantine treatment and to increase shelf-life of the Cantaloupe melon was 450 Gy. The data obtained allowed us to conclude that the ionizing radiation can increase the shelf-life of the Cantaloupe melon using doses up to 450 Gy making it proper to exportation. (author)

  20. Recovery of surface bacteria from and surface sanitization of cantaloupes.

    Science.gov (United States)

    Barak, Jeri D; Chue, Bryan; Mills, Daniel C

    2003-10-01

    Practical, effective methods that could be implemented in a food service establishment (restaurant or delicatessen) for the surface sanitization of cantaloupes were microbiologically evaluated. Cantaloupes (Cucumis melo L. var. reticulates) were immersed in an inoculum containing Salmonella enterica serovar Poona or Pantoea agglomerans at ca. 10(4) to 10(5) CFU/ml. An efficient method for the recovery of bacteria from the cantaloupe surface was developed and validated. The method consisted of washing the entire melon with Butterfield's buffer containing 1% Tween 80 in a plastic bag placed inside a plastic pail affixed to an orbital shaker. Levels of S. enterica Poona recovered by washing the entire melon were significantly higher than those recovered by the more common laboratory method of blending the rind. P. agglomerans can be used as a non-pathogenic proxy for S. enterica Poona. A three-compartment surface sanitization method consisting of washing with an antimicrobial soap solution, scrubbing with a brush in tap water, and immersion in 150 ppm of sodium hypochlorite reduced the initial level of recoverable viable bacteria by 99.8%. When examined separately, scrubbing with a vegetable brush in tap water, washing with soap, and dipping in chlorine were found to reduce the bacterial load by 70, 80, and 90%, respectively.

  1. Identification and Molecular Characterization of the cDNA Encoding Cucumis melo Allergen, Cuc m 3, a Plant Pathogenesis-Related Protein

    Directory of Open Access Journals (Sweden)

    Mojtaba Sankian

    2014-05-01

    Full Text Available Background: Melon (Cucumis melo allergy is one of the most common food allergies, characterized by oral allergy syndrome. To date, two allergen molecules, Cuc m 1 and Cuc m 2, have been fully characterized in melon pulp, but there are few reports about the molecular characteristics of Cuc m 3. Methods:The Cuc m 3 cDNA has been characterized by rapid amplification of cDNA ends (RACE, which revealed a 456 base-pair (bp fragment encoding a 151-amino acid polypeptide with a predicted molecular mass of 16.97 kDa, and identified 79 and 178 bp untranslated sequences at the 5′ and 3´ ends, respectively. Results: In silico analysis showed strong similarities between Cuc m 3 and other plant pathogen-related protein 1s from cucumber, grape, bell pepper, and tomato. Conclusion: Here we report the identification and characterization of the Cuc m 3 cDNA, which will be utilized for further analyses of structural and allergenic features of this allergen

  2. Impact of Listeria Inoculation and Aerated Steam Sanitization on Volatile Emissions of Whole Fresh Cantaloupes.

    Science.gov (United States)

    Forney, Charles F; Fan, Lihua; Bezanson, Gregory S; Ells, Timothy C; LeBlanc, Denyse I; Fillmore, Sherry

    2018-04-01

    Rapid methods to detect bacterial pathogens on food and strategies to control them are needed to mitigate consumer risk. This study assessed volatile emissions from whole cantaloupe melons (Cucumis melo) as an indicator of Listeria contamination and in response to steam vapor decontamination. Cantaloupe were inoculated with Listeria innocua, a nonpathogenic surrogate for L. monocytogenes, then exposed to 85 °C steam for 240 s (4 min) followed by rapid chilling and storage for 0, 7, 10, or 14 days at 4, 7, or 10 °C. Volatile emissions from whole melons were collected on Carbopack B/Carboxen 1000 headspace collection tubes and analyzed by gas chromatography-mass spectroscopy following thermal desorption. Introduction of L. innocua to cantaloupe rind resulted in a reduction of aromatic compound emission. However, this response was not unique to Listeria contamination in that steam vapor treatment also reduced emission of these compounds. As well, steam vapor treatment diminished the number of viable Listeria and indigenous microflora while causing physiological injury to melon rind. Heat treatment had no significant effects on flesh firmness, color, titratable acidity, or soluble solids, but the production of typical aroma volatiles during postharvest ripening was inhibited. No unique volatile compounds were detected in Listeria contaminated melons. While changes in volatile emissions were associated with Listeria inoculation, they could not be differentiated from heat treatment effects. Results indicate that volatile emissions cannot be used as a diagnostic tool to identify Listeria contamination in whole cantaloupe melons. The detection of pathogen contamination on fresh produce is a continuing challenge. Using a nondestructive screening method, the presence of surrogate Listeria innocua on fresh whole cantaloupes was shown to alter the emissions of aromatic volatiles from whole cantaloupes. However, these altered emissions were not found to be unique to Listeria

  3. Fungos isolados da rizosfera de plantios de melão (Cucumis melo L. ev. Gold Mine) adubados com compostos orgânicos, destacando os solubilizadores de fósforo

    OpenAIRE

    Paiva Coutinho, Flavia

    2007-01-01

    A rizosfera é a região do solo influenciada pelas raízes, as quais disponibilizam nutrientes através dos exsudados, afetando intensamente a atividade e o desenvolvimento dos microrganismos. Dentre esses, destacam-se os solubilizadores de P, considerados de grande importância na rizosfera por possuírem habilidade para disponibilizar, para as plantas, o fosfato insolúvel presente nos compostos. Foram coletadas amostras de solo rizosférico em áreas cultivadas com melão (Cucumis melo cv. Gold Min...

  4. Effect of CRC::etr1-1 transgene expression on ethylene production, sex expression, fruit set and fruit ripening in transgenic melon (Cucumis melo L.).

    Science.gov (United States)

    Switzenberg, Jessica A; Beaudry, Randy M; Grumet, Rebecca

    2015-06-01

    Ethylene is a key factor regulating sex expression in cucurbits. Commercial melons (Cucumis melo L.) are typically andromonoecious, producing male and bisexual flowers. Our prior greenhouse studies of transgenic melon plants expressing the dominant negative ethylene perception mutant gene, etr1-1, under control of the carpel- and nectary-primordia targeted CRAB'S CLAW (CRC) promoter showed increased number and earlier appearance of carpel-bearing flowers. To further investigate this phenomenon which could be potentially useful for earlier fruit production, we observed CRC::etr1-1 plants in the field for sex expression, fruit set, fruit development, and ripening. CRC::etr1-1 melon plants showed increased number of carpel-bearing open flowers on the main stem and earlier onset by 7-10 nodes. Additional phenotypes observed in the greenhouse and field were conversion of approximately 50% of bisexual buds to female, and elongated ovaries and fruits. Earlier and greater fruit set occurred on the transgenic plants. However, CRC::etr1-1 plants had greater abscission of young fruit, and smaller fruit, so that final yield (kg/plot) was equivalent to wild type. Earlier fruit set in line M5 was accompanied by earlier appearance of ripe fruit. Fruit from line M15 frequently did not exhibit external ripening processes of rind color change and abscission, but when cut open, the majority showed a ripe or overripe interior accompanied by elevated internal ethylene. The non-ripening external phenotype in M15 fruit corresponded with elevated etr1-1 transgene expression in the exocarp. These results provide insight into the role of ethylene perception in carpel-bearing flower production, fruit set, and ripening.

  5. Study of Bokashi’s Type and Dosages to Growth and Harvest Yield Honey Dews (Cucumis Melo L. In Low Land

    Directory of Open Access Journals (Sweden)

    Ana Amiroh

    2016-12-01

    Full Text Available Recently, most cultivation and planting of Melon (Cucumis melo L. by farmers using inorganic fertilizers with an excessive dosage, and this causes the lowland productivity decrease with consequent. The soil organic matter decreased as low as time increasing. Application and using of mature organic matter are an alternative to solve these problems in order the lowland become more conducive and productive for growth of melon. But increasing pests and diseases attaching to the plants may caused by adding immature organic matters into soil. Sources to make bokashi like as paddy straw and water hyacinth is immense but it’s not yet used. This research was aimed to study, know and usage of paddy straw and water hyacinth bokashi’s on melon growing at lowland. Experiment was conducted at Lowland Experiment Station of Agricultural Faculty, Brawijaya, in Jatikerto Village, Kromengan Distric, Malang, from April-June 2015. Experiment was applied in a Randomized Block Design (RBD with double factors Types and Dosages of Bokashis. There is seven combinations of treatment with three replications, each treatment consisted four individual plants. Result showed there is significant difference between types and dosages of bokashi on plant length at 28, 35, 42 dan 49 days after planting (d,a,p respectively. The significant difference between treatment also shown by leaf area at 28 - 49 (d.a.p.. Application of paddy straw bokashi was better than hyacinth bokashi on melon growth. The best yield shows that by using paddy straw bokashi with 5 ton/ha of dosage gives melon with 2,56 kg /plant fresh weight.

  6. Effect of different sources of fertilizers on the phosphorus absorption and the yield of the under irrigation melon (Cucumis melo L) sowing

    International Nuclear Information System (INIS)

    Villegas Ocampo, A.

    2002-01-01

    The fertilizer injection through irrigation system is a common practice in second melon sowings. Nevertheless, the application of some phosphoric sources by that way can have problems due to the absorption reactions and precipitation in the ground, which reduces its mobility and assimilation by the plants. Phosphoric sources of fertirrigation to diverse doses, were evaluated in melon (Cucusmis melo L.) Cantaloupe cv Hy Mark in second sowings, about the phosphoric absorption and the fruit commercial production , (b) the content of soluble P in the solution of the ground, to correlate this with the optimal production and thus obtain the external requirement of P and (c) to quantify the economic costs of the application of the different sources. The experiment took place in the ground of the Inceptisol order, sub-group Vertic Haplustepts in Carrillo, Guanacaste, in the property Melones de Sardinal S.A. The used sources of P2O5 were: Map(12-60-0) in doses of 36 and 54 kg/ha, H3PO4 to 36kg/ha and Fertg (8-24-0) in doses of 18 and 36 kg/ha. Besides, establishing in absolute witness 0 kg/ha. The melon redeeming was evaluated in number of cajas/ha, sizes 9, 12, 15 and 18. According to the dry weight and the nourishment concentration of the aerial biomass of each sample, the absorption of nourishment in the cultivation in kg/ha and g/ha was calculated, for a sowing density of 12940 plantas/ha. The external efficiency of phosphorus for melon with the different sources was determined, for getting this were made applications of progressively increasing doses of P. The dose of phosphorus to reach that requirement (concentration of P in the solution of the ground that is necessary for an optimal yield), in the balance point it's obtained by means of interpolation of the dose of P through the isotherm and the correlation of the optimal yield of the cultivation. The greater absorption of P took place in the stage of previous growth to the flowering and in the beginning and arrival

  7. A consensus linkage map for molecular markers and Quantitative Trait Loci associated with economically important traits in melon (Cucumis melo L.)

    Science.gov (United States)

    2011-01-01

    Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L.) over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL) analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS). Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org), an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits) with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD) were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability observed for this trait in

  8. A consensus linkage map for molecular markers and Quantitative Trait Loci associated with economically important traits in melon (Cucumis melo L.

    Directory of Open Access Journals (Sweden)

    Schaffer Arthur

    2011-07-01

    Full Text Available Abstract Background A number of molecular marker linkage maps have been developed for melon (Cucumis melo L. over the last two decades. However, these maps were constructed using different marker sets, thus, making comparative analysis among maps difficult. In order to solve this problem, a consensus genetic map in melon was constructed using primarily highly transferable anchor markers that have broad potential use for mapping, synteny, and comparative quantitative trait loci (QTL analysis, increasing breeding effectiveness and efficiency via marker-assisted selection (MAS. Results Under the framework of the International Cucurbit Genomics Initiative (ICuGI, http://www.icugi.org, an integrated genetic map has been constructed by merging data from eight independent mapping experiments using a genetically diverse array of parental lines. The consensus map spans 1150 cM across the 12 melon linkage groups and is composed of 1592 markers (640 SSRs, 330 SNPs, 252 AFLPs, 239 RFLPs, 89 RAPDs, 15 IMAs, 16 indels and 11 morphological traits with a mean marker density of 0.72 cM/marker. One hundred and ninety-six of these markers (157 SSRs, 32 SNPs, 6 indels and 1 RAPD were newly developed, mapped or provided by industry representatives as released markers, including 27 SNPs and 5 indels from genes involved in the organic acid metabolism and transport, and 58 EST-SSRs. Additionally, 85 of 822 SSR markers contributed by Syngenta Seeds were included in the integrated map. In addition, 370 QTL controlling 62 traits from 18 previously reported mapping experiments using genetically diverse parental genotypes were also integrated into the consensus map. Some QTL associated with economically important traits detected in separate studies mapped to similar genomic positions. For example, independently identified QTL controlling fruit shape were mapped on similar genomic positions, suggesting that such QTL are possibly responsible for the phenotypic variability

  9. Qualidade de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos em hidroponia e armazenados em embalagens de polietileno Quality of Torreon hybrid melon fruits (Cucumis melo L. var. cantalupensis Naud. grown in hydroponic system and stored in polyethylene packaging

    Directory of Open Access Journals (Sweden)

    Auri Brackmann

    2006-08-01

    Full Text Available Este experimento teve por objetivos avaliar a permeabilidade de filmes de polietileno de diferentes espessuras e densidades ao O2 e ao CO2, a composição gasosa (O2, CO2 e etileno formada no interior das embalagens e a qualidade físico-química de melões (Cucumis melo L. var. cantalupensis Naud., híbrido Torreon, produzidos no sistema hidropônico "Nutrient Film Technique" (NFT e armazenados em embalagens de polietileno. Os tratamentos avaliados foram: (1 armazenamento refrigerado (sem uso de filme; (2 polietileno de baixa densidade (PEBD de 40µm; (3 PEBD de 60µm; (4 PEBD de 90µm; (5 polietileno de média densidade (PEMD de 40µm; (6 PEMD de 60µm. Os frutos permaneceram armazenados durante 25 dias a 3,8±0,2°C e por mais dois dias a 20°C. Os filmes de PEBD de 60 e 90µm e o PEMD de 60µm apresentaram menor permeabilidade ao CO2, mantendo as maiores concentrações de CO2 nas embalagens. O filme de PEBD de 90µm apresentou menor permeabilidade ao O2. A menor concentração de etileno foi obtida com o uso de PEBD de 40µm. O uso de filmes reduziu drasticamente a perda de massa dos frutos, quando comparados aos frutos não embalados. Os frutos acondicionados na embalagem de PEBD de 40µm mantiveram uma maior firmeza da polpa após o período de armazenamento, não diferindo estatisticamente dos frutos armazenados em PEMD de 40µm. Já a incidência de podridões foi significativamente menor nos frutos armazenados em PEMD de 60µm. De modo geral, os filmes avaliados mantêm semelhante a qualidade físico-química de melões híbrido Torreon produzidos hidroponicamente no sistema NFT.This study was carried out to evaluate the permeability to O2 and CO2, and gas composition (O2, CO2 and ethylene inside packages of different thickness and density polyethylene films. Moreover, the physical and chemical quality of Torreon hybrid melon fruit (Cucumis melo L. var. cantalupensis Naud. grown in a Nutrient Film Technique hydroponic system and stored

  10. Crescimento e mudanças físico-químicas durante a maturação de frutos de meloeiro (Cucumis melo var. cantalupensis Naud. híbrido Torreon Growth and physicochemical changes during the ripening of hybrid Torreon muskmelon fruits (Cucumis melo var. cantalupensis Naud.

    Directory of Open Access Journals (Sweden)

    Ricardo Fabiano Hettwer Giehl

    2008-04-01

    Full Text Available Objetivou-se neste trabalho avaliar o crescimento e as mudanças físico-químicos durante a maturação de melões (Cucumis melo var. cantalupensis Naud., híbrido Torreon. As plantas foram cultivadas no sistema hidropônico NFT ("Nutrient Film Technique", em Santa Maria, RS, durante o período de janeiro a abril. Diariamente, foram marcadas as flores pistiladas em antese, anotando-se a data desse evento. Foram efetuadas as medidas lineares do diâmetro longitudinal e transversal dos frutos a cada três dias, iniciando-se após a antese. A partir dos 25 dias após a antese (DAA, realizou-se, a cada três dias, a colheita de 10 frutos, aleatoriamente. Foram analisados os parâmetros: síntese de etileno, respiração, firmeza da polpa, teor de sólidos solúveis totais, acidez total titulável e coloração da polpa. O aumento no diâmetro longitudinal e transversal dos frutos ocorreu até aproximadamente os 26-29 DAA. A partir desse momento, iniciou-se o processo de maturação dos frutos. Nessa fase, verificou-se intenso incremento na síntese de etileno, com pico aos 37 DAA (44 ± 4,6mL kg-1 h-1, o que culminou no aumento da respiração e na diminuição da acidez total titulável e da firmeza de polpa. Além disso, a cor da polpa dos frutos tornou-se gradativamente mais vermelha. Os frutos desprenderam da planta aproximadamente aos 37 DAA, quando apresentaram uma média de 10,5°Brix de sólidos solúveis totais.This research had the aim of evaluating the physicochemical growth and changes during maturation of hybrid Torreon melons (Cucumis melo var. cantalupensis Naud.. Melon plants were cultivated in the NFT (Nutrient Film Technique hidroponic system from January to April 2004 in Santa Maria, RS, Brazil. Flowers in anthesis were daily tagged and linear measures of longitudinal and transverse diameter were made at a 3-day interval, beginning at anthesis. Starting from 25 days after anthesis (DAA, 10 fruits were randomly harvested each 3

  11. Filamentous fungi isolated from the rhizosphere of melon plants (Cucumis melo L. cv. Gold Mine cultivated in soil with organic amendments Fungos filamentosos isolados da rizosfera de meloeiros (Cucumis melo L. cv. Gold Mine cultivados em solo com compostos orgânicos

    Directory of Open Access Journals (Sweden)

    Flavia Paiva Coutinho

    2010-03-01

    Full Text Available Rhizosphere soil samples were collected in a semiarid area, in the region of the São Francisco River valley, Petrolina, Pernambuco state, Brazil, to study the diversity of filamentous fungi in a soil cultivated with melon (Cucumis melo L. cv. Gold Mine and receiving different organic amendments: Treatment 1 (control, without organic compost; T2 (77% coconut fiber, 20% goat manure and 3% K2SO4; T3 (10% Ricinus communis leaves and stems, 50% Pennisetum purpureum leaves and 40% goat manure; T4 (77% coconut fiber, 20% goat manure and 3% termophosphate; T5 (47% Pennisetum purpureum leaves, 50% goat manure and 3% K2SO4; and T6 (57% Pennisetum purpureum leaves, 40% goat manure and 3% termophosphate. Fungal isolation was carried out by the serial dilution technique to 1:1000. The Sorensen index of similarity, frequency and distribution of the fungi were evaluated. Seventy-eight species of filamentous fungi were isolated and identified, plus several Basidiomycota (04 and Mycelia sterilia (02. The predominant genera were Aspergillus and Penicillium, with 15 and 13 species, respectively. A greater number of species was found in the sowing period (49, and in relation to the organic fertilization, treatment 6 provided the greatest species diversity (43 species. Most of the species are saprobes and only a few are considered to be potential pathogens on melon plants, such as Fusarium oxysporum, F. solani and Myrothecium roridum.Foram coletadas amostras de solo rizosférico em uma área semiárida, na região do Vale do São Francisco, Petrolina, Pernambuco, Brasil, com o objetivo de conhecer a diversidade dos fungos filamentosos presentes em solo cultivado com melão (Cucumis melo cv. Gold Mine e adubado com diferentes compostos orgânicos: Tratamento 1 (controle, sem adição de compostos orgânicos; T2 (77% de bagaço de côco, 20% de esterco de caprino e 3% de K2SO4; T3 (10% de torta de mamona, 50% de capim elefante e 40% de esterco de caprino; T4 (77% de

  12. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-12-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  13. Caracterización química y sensorial de vino artesanal de melón (Cucumis melo L. var. reticulatus Naud., cv. Ovation

    Directory of Open Access Journals (Sweden)

    C. Padín

    2012-01-01

    Full Text Available En los últimos años la producción de melón (Cucumis melo L. ha experimentado un notable aumento generando excedentes en el mercado y no siempre se consigue vender a los mejores precios, por lo que los porcentajes de pérdidas poscosecha son altos (Martínez, 2007. El objetivo de esta investigación fue caracterizar química y sensorialmente vino de melón. La intención fue generar una tecnología sencilla para la producción de una bebida alcohólica de alta calidad a partir de este fruto y con ello aportar una alternativa de comercialización en la región Falconiana y otras regiones productoras del país. Los ensayos se condujeron, para las variables químicas, en un diseño completamente aleatorizado con 3 tratamientos. Los vinos se elaboraron a partir de 8 L de jugo puro de melón de concentración inicial de sólidos solubles totales 16, 20 y 25 ºBx, acidez total (5,5 g/L y pH (3,8 ajustados, respectivamente denominados tratamientos V1, V2, V3 (3 repeticiones. Colocados en fermentadores de 9 L de capacidad, estériles. Inoculados con 1 g/L de Saccharomyces cerevisiae, e incubados a 28 ºC por 10 días; seguido de trasiego, embotellado, encorchado y almacenamiento por 2 meses. El jugo de melón mostró, sólidos solubles totales 8,00 ºBx, acidez total titulable 0,15 % y pH 5,20. Los vinos, respectivamente V1, V2 y V3, presentaron las siguientes características: grado alcohólico 7, 8, 10 ºGL; alcohol metílico 0,008; 0,002; 0,004 g/L; acetato de etilo 0,02; 0,04; 0,08 mg/L; azúcares totales 20, 40, 58 g/L; acidez volátil 0,814; 0,854; 0,815 g/L; acidez total 6,26; 6,08; 6,00 g/L; acidez iónica 4,00; 3,91; 3,93. Se evidenciaron diferencias estadísticamente significativas (p ≤ 0,05 entre los tratamientos. Los 3 vinos de melón cumplieron con los requisitos: grado alcohólico, alcohol metílico, acetato de etilo, acidez volátil y acidez total establecidos en la norma venezolana COVENIN 3342-1997. V1 y V2 presentaron caracter

  14. A SURVEY OF SIZES AND WEIGHTS OF BEMISIA TABACI(HOMOPTERA: ALEYRODIDAE)B BIOTYPE LIFE STAGES FROM FIELD GROWN COTTON AND CANTALOUPES

    Institute of Scientific and Technical Information of China (English)

    Chang-chiChu; JamesS.Buckner; KamilKarut; ThomasP.Freeman; DennisR.Nelson; ThomasJ.Henneberryl

    2003-01-01

    Size and weight measurements were made for all the life stages of Bemisia tabaci (Gennadius) B biotype from field grown cotton ( Gossypium hirsutum L. ) and cantaloupe ( Cucumis melo L., var. cantalupensis )in Phoenix, AZ and Fargo, ND, USA in 2000 and 2001. Nymphal volumes were derived from the measurements.The average nymphal volume increase for settled 1 st to the late 4th instar was exponential. The greatest increase in body volume occurred during development from the 3rd to early 4th instar. Nymphs on cotton leaves were wider,but not longer compared with those on cantaloupe. Ventral and dorsal depth ratios of nymphal bodies from 1st tolate 4th instars from cantaloupe leaves were significantly greater compared with those from cotton leaves. During nymphal development from 1st to 4th instar, the average (from the two host species) ventral body half volume in-creased by nearly 51 times compared with an increase of 28 times for the dorsal body half volume. Adult female and male average lengths, from heads to wing tips, were 1 126 μm and 953 μm, respectively. Average adult fe-male and male weights were 39 and 17 μg, respectively. Average widths, lengths, and weights of eggs from cottonand cantaloupe were, 99 μm, 197 μm, and 0.8 μg, respectively. Average widths, lengths, and weights for exu-viae of non-parasitized nymphs from both cotton and cantaloupe were 492 μm, 673 μm, and 1.20 μg, respective-ly; and widths, lengths, and weights of parasitized nymph exuviae were 452 μm, 665 μm, and 3.62 μg, respec-tively. Both exuviae from non-parasitized and parasitized nymphs from cotton leaves were wider, longer, and heavier than those from cantaloupe leaves.

  15. Plantas hospederas de los virus más importantes que infectan el melón, Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    1998-03-01

    Full Text Available Las especies hospederas naturales de los virus (PRSV, WMV-2, CMV y ZYMV que infectan el cultivo de melón (Cucumis melo L. para la exportación en Costa Rica se identificaron en plantaciones comerciales de dos fincas ubicadas, una en la provincia de Guanacaste, y la otra en la provincia de Puntarenas. En ambas fincas se cultiva el melon con irrigación durante la época seca, pero su manejo cultural es diferente. La finca A con una larga trayectoria en el cultivo de melón en rotación con maíz, sorgo y arroz, y con poco control de malezas; mientras que la finca B con una corta trayectoria en la producción del melón y un mayor control de malezas. La diversidad de especies vegetales fue estudiada en cuadrantes de 100 m2 en cinco diferentes comunidades de plantas previamente seleccionadas en la finca A (cultivo, canal de drenaje, charral, potrero mejorado, y semi-bosque y tres en la finca B (cultivo, charral, pastizal natural, semi-bosque. El número de cuadrantes estudiados dependió del área total cultivada en cada una de las fincas. Todas las especies de plantas representadas en cada cuadrante se recolectaron e identificaron pero solo aquellas especies que presentaron síntomas virales en el campo fueron analizadas por ELISA para determinar la presencia de los cuatro virus estudiados. La diversidad de especies, porcentaje de cobertura y época de aparición de las especies hospederas fue monitoreada durante un año calendario en cinco fechas diferentes. Un total de 86 y 72 especies de plantas fueron identificadas en las fincas A y B respectivamente. Catorce encontradas positivas por lo menos para uno de los cuatro virus. Los cuatro virus fueron encontrados en cada finca en cada fecha de muestreo indicando que la permanencia y abundancia de algunas especies hospederas garantiza la permanencia de los cuatro virus en el campo como fuente de inóculo primario para la próxima siembra. Varias especies de plantas hospederas silvestres previamente

  16. Kinetic study on adsorption of Cr(VI), Ni(II), Cd(II) and Pb(II) ions from aqueous solutions using activated carbon prepared from Cucumis melo peel

    Science.gov (United States)

    Manjuladevi, M.; Anitha, R.; Manonmani, S.

    2018-03-01

    The adsorption of Cr(VI), Ni(II), Cd(II) and Pb(II), ions from aqueous solutions by Cucumis melo peel-activated carbon was investigated under laboratory conditions to assess its potential in removing metal ions. The adsorption behavior of metal ions onto CMAC was analyzed with Elovich, intra-particle diffusion rate equations and pseudo-first-order model. The rate constant of Elovich and intra-particle diffusion on CMAC increased in the sequence of Cr(VI) > Ni(II) > Cd(II) > Pb(II). According to the regression coefficients, it was observed that the kinetic adsorption data can fit better by the pseudo-first-order model compared to the second-order Lagergren's model with R 2 > 0.957. The maximum adsorption of metal ions onto the CMAC was found to be 97.95% for Chromium(VI), 98.78% for Ni(II), 98.55% for Pb(II) and 97.96% for Cd(II) at CMAC dose of 250 mg. The adsorption capacities followed the sequence Ni(II) ≈ Pb(II) > Cr(VI) ≈ Cd(II) and Ni(II) > Pb(II) > Cd(II) > Cr(VI). The optimum adsorption conditions selected were adsorbent dosage of 250 mg, pH of 3.0 for Cr(VI) and 6.0 for Ni(II), Cd(II) and Pb(II), adsorption concentration of 250 mg/L and contact time of 180.

  17. Response of cotton, alfalfa, and cantaloupe to foliar-deposited salt in an arid environment

    International Nuclear Information System (INIS)

    Hofmann, W.C.; Karpiscak, M.M.; Bartels, P.G.

    1987-01-01

    The cooling towers at the Palo Verde Nuclear Generating Station (PVNGS), located 80 km west of Phoenix, AZ, will release as estimated 2.1 Mg/d of particulates (primarily salts) into the atmosphere when the station is in full operation. The saline drift will disperse and settle onto agricultural fields surrounding the station. Field studies were conducted in 1983 to investigate the influence of foliar-applied saline aerosol on crop growth, foliar injury, and tissue elemental concentration on cotton (Gossypium hirsutum L.), alfalfa (medicago sativa L.), and cantaloupe (Cucumis melo L.) in an arid environment. The treatment aerosol solutions simulated treated wastewater effluent and included all essential plant nutrients and other elements, including trace concentrations of heavy metals. The treatments included unsprayed plots, and plots sprayed with salt solutions at 0 (distilled water), 8, 83, and 415 kg/(ha yr). The alfalfa received an additional 829 kg/(ha yr) treatment. The species were evaluated in separate experiments on Mohave clay loam and Sonoita sandy loam soils (Typic Haplargid) near Marana, AZ. Cotton treated with 415 kg/(ha yr) had significantly less chlorosis and tended to be slightly taller than the cotton in the unsprayed plots. The alfalfa treated at a rate of 829 kg/(ha yr) showed significantly more leaf margin necrosis than did the unsprayed alfalfa. In the cantaloupe, there were no visually apparent differences among salt treatments. Hand-harvested cotton plots had a significant reduction is seed cotton yield at the 415 kg/(ha yr) treatment. A similar though nonsignificant, trend towards reduced yield with increased salt treatment was observed in machine-harvested cotton plots

  18. Effect of gamma radiation on the content {beta}-carotene and volatile compounds of cantaloupe melon

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Stefania P. de; Cardozo, Monique; Lima, Keila dos S.C.; Lima, Antonio L. dos S., E-mail: keila@ime.eb.br, E-mail: santoslima@ime.eb.br [Departamento de Quimica - IME - Instituto Militar de Engenharia, RJ (Brazil)

    2011-07-01

    The Japanese melon or cantaloupe (Cucumis melo L.) is characterized by fruits with almost 1.0 Kg, pulp usually salmon and musky scent. The fruits when ripe are sensitive to post harvest handling. This low transport resistance and reduced shelf-life makes it necessary to delay the ripening of fruit. In this way the use of irradiation technique is a good choice. Irradiation is the process of exposing food to high doses of gamma rays. The processing of fruits and vegetables with ionizing radiation has as main purpose to ensure its preservation. However, like other forms of food processing, irradiation may cause changes in chemical composition and nutritional value. This study aims to assess possible changes in carotene content and volatile compounds caused by exposure of cantaloupe melon fruit to gamma irradiation. Irradiation of the samples occurred in Centro Tecnologico do Exercito (Guaratiba-RJ), using Gamma irradiator (Cs{sub 137} source, dose rate 1.8 kGy/h), being applied 0.5 and 1.0 kGy doses and separated a control group not irradiated. Carotenoids were extracted with acetone and then suffered partition to petroleum ether, solvent was removed under nitrogen flow and the remainder dissolved in acetone again. The chromatographic analysis was performed using a Shimadzu gas chromatograph, with C30 column. For volatile compounds, we used gas chromatography (GC) associated with mass (MS). As a result, it was verified in analysis of carotenoids that cantaloupe melon is rich in {beta}-carotene. Both total content of carotenoids and specific {beta}-carotene amount wasn't suffer significant reduction in irradiated fruits at two doses, demonstrating that the irradiation process under these conditions implies a small loss of nutrients. The major volatile compounds were: 2-methyl-1-butyl acetate, ethyl hexanoate, n-hexyl acetate, benzyl acetate, 6-nonenyl acetate and {alpha} -terpinyl acetate. For all compounds we observed an increase in the volatile content in 0.5 k

  19. Effect of gamma radiation on the content β-carotene and volatile compounds of cantaloupe melon

    International Nuclear Information System (INIS)

    Souza, Stefania P. de; Cardozo, Monique; Lima, Keila dos S.C.; Lima, Antonio L. dos S.

    2011-01-01

    The Japanese melon or cantaloupe (Cucumis melo L.) is characterized by fruits with almost 1.0 Kg, pulp usually salmon and musky scent. The fruits when ripe are sensitive to post harvest handling. This low transport resistance and reduced shelf-life makes it necessary to delay the ripening of fruit. In this way the use of irradiation technique is a good choice. Irradiation is the process of exposing food to high doses of gamma rays. The processing of fruits and vegetables with ionizing radiation has as main purpose to ensure its preservation. However, like other forms of food processing, irradiation may cause changes in chemical composition and nutritional value. This study aims to assess possible changes in carotene content and volatile compounds caused by exposure of cantaloupe melon fruit to gamma irradiation. Irradiation of the samples occurred in Centro Tecnologico do Exercito (Guaratiba-RJ), using Gamma irradiator (Cs 137 source, dose rate 1.8 kGy/h), being applied 0.5 and 1.0 kGy doses and separated a control group not irradiated. Carotenoids were extracted with acetone and then suffered partition to petroleum ether, solvent was removed under nitrogen flow and the remainder dissolved in acetone again. The chromatographic analysis was performed using a Shimadzu gas chromatograph, with C30 column. For volatile compounds, we used gas chromatography (GC) associated with mass (MS). As a result, it was verified in analysis of carotenoids that cantaloupe melon is rich in β-carotene. Both total content of carotenoids and specific β-carotene amount wasn't suffer significant reduction in irradiated fruits at two doses, demonstrating that the irradiation process under these conditions implies a small loss of nutrients. The major volatile compounds were: 2-methyl-1-butyl acetate, ethyl hexanoate, n-hexyl acetate, benzyl acetate, 6-nonenyl acetate and α -terpinyl acetate. For all compounds we observed an increase in the volatile content in 0.5 kGy ranging from 0.8 to 9

  20. Symptoms and Sensitivity to Chilling Injury of Cantaloupe Melons during Postharvest Síntomas y Sensibilidad a Daño por Enfriamiento de Melones Reticulados durante Poscosecha

    Directory of Open Access Journals (Sweden)

    Christian Krarup

    2009-06-01

    Full Text Available The nature and development of specific symptoms of chilling injury (CI and the variation in sensitivity to the disorder of different cultivars of cantaloupe melons (Cucumis melo L. subsp. melo var. cantalupensis Naudin was assessed during two seasons. Twenty-three cultivars of the Eastern Shipper (2, Western Shipper (13 and Galia (8 types were grown in a semiarid environment in Curacaví (33º27’ S, 70º38’ W, Chile, using common cultural practices. Fruits were harvested at the half-slip stage, except Galia (3/5 color, graded ,washed, and stored for 18 days at 0 ºC, with an additional 3 days at 20 ºC. Symptoms of CI appeared with varying intensity in almost all cultivars and were generally similar. Symptoms developed progressively: surface discoloration progressed from light pink to brownish to black, followed by large sunken areas, and eventually, discrete indentations and net whitening. Surface decay was not present in most fruits and should be considered a consequence rather than a symptom of CI. Cultivars had different sensitivities to the disorder; some cultivars were severely injured (Athena, Colima and Revigal whereas others developed almost no symptoms of CI (Hy-Mark, Gal 96, and Voyager I. The response variability to chilling showed the need for precise temperature recommendations for these cultivars, and signaled a potential for future long-term transport or storage of some cultivars.La naturaleza y el desarrollo de los síntomas de daño por enfriamiento (CI y la variación en sensibilidad de diversos cultivares de melones reticulados (Cucumis melo L. subsp. melo var. cantalupensis Naudin a este desorden fisiológico se evaluaron durante dos temporadas. Veintitrés cultivares de los tipos Eastern (1, Western (15 y Galia (8 se cultivaron en un ambiente semi-árido en Curacaví (33º27’ S, 70º38’ O, Chile, en cultivos realizados de manera convencional, y los frutos se cosecharon al estado de madurez de medio desprendimiento

  1. Melo carboniferous basin

    International Nuclear Information System (INIS)

    Flossdarf, A.

    1988-01-01

    This report is about of the Melo carboniferous basin which limits are: in the South the large and high Tupambae hill, in the west the Paraiso hill and the river mountains, in the North Yaguaron river basin to Candidata in Rio Grande del Sur in Brazil.

  2. Polyploidization facilitates biotechnological in vitro techniques in the genus Cucumis.

    Science.gov (United States)

    Skálová, Dagmar; Ondřej, Vladan; Doležalová, Ivana; Navrátilová, Božena; Lebeda, Aleš

    2010-01-01

    Prezygotic interspecific crossability barrier in the genus Cucumis is related to the ploidy level of the species (cucumber (C. sativus), x = 7; muskmelon (C. melo) and wild Cucumis species, x = 12). Polyploidization of maternal plants helps hybridization among other Cucumis species by overcoming prezygotic genetic barriers. The main objective of this paper is to compare the results of several methods supporting interspecific crosses in cucumber without and with polyploidization (comparison between diploid (2x) and mixoploid (2x/4x) cucumber maternal plants). Mixoploid plants were obtained after in vivo and in vitro polyploidization by colchicine and oryzalin. Ploidy level was estimated by flow cytometry. Embryo rescue, in vitro pollination, and isolation of mesophyll protoplast were tested and compared. Positive effect of polyploidization was observed during all experiments presented by higher regeneration capacity of cultivated mixoploid cucumber embryos, ovules, and protoplasts. Nevertheless, the hybrid character of putative hybrid accessions obtained after cross in vivo and in vitro pollination was not confirmed.

  3. Qualidade pós-colheita de melão tipo cantaloupe, colhido em dois estádios de maturação Postharvest quality of cantaloupe type melon, harvested in two maturation stages

    Directory of Open Access Journals (Sweden)

    Júlio Gomes Júnior

    2001-11-01

    Full Text Available Objetivou-se avaliar a conservação pós-colheita de frutos de melão tipo cantaloupe (Cucumis melo L var. Cantaloupensis , genótipo Nun 3984, colhido nos estádios de maturação II ( frutos imaturos em início de descoloração e pedúnculo totalmente preso e IV (frutos com pedúnculo totalmente rachado, em seis períodos de armazenamento: 0; 5; 10;15; 20 e 25 dias. Os frutos foram provenientes do Agropolo Mossoró-Assu (RN, cujo clima é caracterizado como quente e seco, com temperaturas máxima e mínima de 33ºC e 29ºC, respectivamente. O armazenamento foi realizado a 20ºC e 50% UR. Utilizou-se um fatorial 2 x 6 (dois estádios de maturação e seis períodos de armazenamento, em delineamento inteiramente casualizado, com três repetições, sendo utilizados dois frutos por parcela. Os frutos foram avaliados individualmente quanto à firmeza da polpa, perda de peso, teor de sólidos solúveis, aparências externa e interna. Houve efeito significativo da interação entre os fatores estudados apenas para variável firmeza da polpa. A firmeza da polpa foi de 30,07 N e 18,75 N por ocasião da colheita e 5,32 N e 3,50 N aos 25 dias de armazenamento, respectivamente, para os estádios II e IV de maturação. O teor de sólidos solúveis apresentado por esse genótipo (7% a 9%, nos estádios II e IV de maturação respectivamente, não estabelece um padrão mínimo para a aceitação no mercado externo. A perda de peso atingiu valores médios de 6,26% e 6,67% aos 20 e 25 dias de armazenamento, respectivamente. Os frutos chegaram aos 20 dias de armazenamento com nota média 3,1 (deterioração mediana e 4,0 (deterioração leve para as aparências interna e externa, respectivamente, nos dois estádios de maturação, sendo portanto, considerados próprios para o consumo, por terem notas acima de 3,0This work aimed to evaluate the postharvest shelf life of cantaloupe melons type (Cucumis melo L. var Cantaloupensis, genotype Nun 3984, harvested

  4. Cucurbits [Cucumber, melon, pumpkin and squash

    Science.gov (United States)

    The focus of this chapter is on the edible members of the Cucurbitaceae family. The three important food-grade cucurbit genera Citrullus, Cucumis, and Cucurbita include the species Citrullus lanatus watermelons), Cucumis melo (cantaloupes and other sweet melons), Cucumis sativa (cucumbers and pick...

  5. 7 CFR 319.56-26 - Melon and watermelon from certain countries in South America.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Melon and watermelon from certain countries in South... and Vegetables § 319.56-26 Melon and watermelon from certain countries in South America. (a) Cantaloupe and watermelon from Ecuador. Cantaloupe (Cucumis melo) and watermelon (fruit) (Citrullus lanatus...

  6. Chromosomal structures and repetitive sequences divergence in Cucumis species revealed by comparative cytogenetic mapping.

    Science.gov (United States)

    Zhang, Yunxia; Cheng, Chunyan; Li, Ji; Yang, Shuqiong; Wang, Yunzhu; Li, Ziang; Chen, Jinfeng; Lou, Qunfeng

    2015-09-25

    Differentiation and copy number of repetitive sequences affect directly chromosome structure which contributes to reproductive isolation and speciation. Comparative cytogenetic mapping has been verified an efficient tool to elucidate the differentiation and distribution of repetitive sequences in genome. In present study, the distinct chromosomal structures of five Cucumis species were revealed through genomic in situ hybridization (GISH) technique and comparative cytogenetic mapping of major satellite repeats. Chromosome structures of five Cucumis species were investigated using GISH and comparative mapping of specific satellites. Southern hybridization was employed to study the proliferation of satellites, whose structural characteristics were helpful for analyzing chromosome evolution. Preferential distribution of repetitive DNAs at the subtelomeric regions was found in C. sativus, C hystrix and C. metuliferus, while majority was positioned at the pericentromeric heterochromatin regions in C. melo and C. anguria. Further, comparative GISH (cGISH) through using genomic DNA of other species as probes revealed high homology of repeats between C. sativus and C. hystrix. Specific satellites including 45S rDNA, Type I/II, Type III, Type IV, CentM and telomeric repeat were then comparatively mapped in these species. Type I/II and Type IV produced bright signals at the subtelomeric regions of C. sativus and C. hystrix simultaneously, which might explain the significance of their amplification in the divergence of Cucumis subgenus from the ancient ancestor. Unique positioning of Type III and CentM only at the centromeric domains of C. sativus and C. melo, respectively, combining with unique southern bands, revealed rapid evolutionary patterns of centromeric DNA in Cucumis. Obvious interstitial telomeric repeats were observed in chromosomes 1 and 2 of C. sativus, which might provide evidence of the fusion hypothesis of chromosome evolution from x = 12 to x = 7 in

  7. Melo

    Directory of Open Access Journals (Sweden)

    José María Vargas Vila

    1965-05-01

    Full Text Available No fue una dictadura, fue una aventura. No fue un golpe de Estado, fue un golpe de cuartel, pero atrevido, generoso, brillante, no como aquel otro grotesco de la triste figura de Urdaneta, tumulto vergonzoso, en que surgió a una dictadura efímera, problamada por pretorianos extranjeros, aquel servidor incondicional, manchado todavía con la sangre de Padilla, el Nelson Colombiano.

  8. Genetic Characterization of Turkish Snake Melon (Cucumis melo L. subsp. melo flexuosus Group) Accessions Revealed by SSR Markers.

    Science.gov (United States)

    Solmaz, Ilknur; Kacar, Yildiz Aka; Simsek, Ozhan; Sari, Nebahat

    2016-08-01

    Snake melon is an important cucurbit crop especially in the Southeastern and the Mediterranean region of Turkey. It is consumed as fresh or pickled. The production is mainly done with the local landraces in the country. Turkey is one of the secondary diversification centers of melon and possesses valuable genetic resources which have different morphological characteristics in case of snake melon. Genetic diversity of snake melon genotypes collected from different regions of Turkey and reference genotypes obtained from World Melon Gene Bank in Avignon-France was examined using 13 simple sequence repeat (SSR) markers. A total of 69 alleles were detected, with an average of 5.31 alleles per locus. The polymorphism information content of SSR markers ranged from 0.19 to 0.57 (average 0.38). Based on cluster analysis, two major groups were defined. The first major group included only one accession (61), while the rest of all accessions grouped in the second major group and separated into different sub-clusters. Based on SSR markers, cluster analysis indicated that considerably high genetic variability exists among the examined accessions; however, Turkish snake melon accessions were grouped together with the reference snake melon accessions.

  9. Cucumis sativus L, Nasim variety

    African Journals Online (AJOL)

    ... practice for reducing water consumption and improving product quality. ... Since cucumbers (Cucumis sativus L, Nasim variety) is considered as the main and ... to a significant yield increase (P<0.001), while MAD of 50% had the least yield.

  10. Functional method implementation of post-crop conservation of melon cantaloupe, using ionizing radiation as quality control technique in productive chain

    International Nuclear Information System (INIS)

    Siqueira, Alessandra A.Z. Cozzo de; Matraia, Clarice; Walder, Julio Marcos M.; Spoto, Marta H.F.; Silva, Paula P.M. da; Maretti, Marina S.

    2005-01-01

    The Brazilian fruit culture is an alternative to minimize the lack-of-food problem using management and post harvest appropriate techniques. Gamma radiation technology is a possible technique used for food, enlarging its shelf-life, eliminating pathogenic microorganisms and in the quarantine treatment. The irradiation with seven doses (150,300,450,600,750 and 900 Gy) was used in Cantaloupe melon (Cucumis melon var. Cantaloupensis) aiming to establish the minimum, maximum and ideal doses, according to Brazilian laws, analyzing weight, color, firmness, pulp and juice quantity and sensory aspects, using the Difference Control Test. The results indicate that storage influenced significantly the weight, color and pulp quantity parameters. Doses higher than 450 Gy however influenced the firmness, juice quantity and sensory aspects characteristics. These results are indicating that the minimum dose was 150 Gy, the maximum dose was 900 Gy and the ideal dose for the quarantine treatment and to increase shelf-life of the Cantaloupe melon was 450 Gy. The data obtained allowed us to conclude that the ionizing radiation can increase the shelf-life of the Cantaloupe melon using doses up to 450 Gy making it proper to exportation. (author)

  11. Internalization of Listeria monocytogenes in cantaloupes during dump tank washing and hydrocooling

    Science.gov (United States)

    Recent listeriosis outbreaks and recalls associated with cantaloupes urge for studies to understand the mechanisms of cantaloupe contamination by Listeria monocytogenes. Postharvest practices such as washing and hydrocooling were suggested to facilitate the contamination of fresh fruits by human pat...

  12. Controlling fusarium wilt disease in melon(cucumis melo L.) using tilllered onion bulb extract

    International Nuclear Information System (INIS)

    Yushu, Z.; Guo, Q.; Xuezheng, W.; Yanan, Z.; Yuting, Li.

    2017-01-01

    Melon wilt disease is a soil-borne disease caused by Fusarium oxysporum f. sp. niveum. This disease incur of the heavy economic loss in melon crops. To decrease damage to melons, many control methods have been developed. However, many of the current control methods have limitations and disadvantages. For example, fungicides may cause health concerns for both humans and the environment due to high toxin content and the presence of residues. Therefore, biological control methods that reduce or eliminate the risk of environmental contamination and threats to human health are urgently needed to solve these issues and to protect melon crops from wilt disease.In this research, we assessed the efficacy of tillered onion bulb extract (TOE) for biocontrol of melon wilt disease in melon. Different concentrations of the TOE have been shown to have inhibitory effects on Fusariumspore germination and growth, pathogenic bacterial biomass, and fungal sporulation, with increased inhibitory effects at higher TOE concentrations. In melon wilt disease, concentrations of TOE greater than 250 mg/mL produced the highest protective effects in both susceptible and resistant melon cultivars. The disease index in resistant varieties was 18%, and the disease control effect was 63.51%, while the disease index in susceptible varieties was 21.41%, and the disease control effect reached 65.96%. These values indicate stronger control effects than those achieved using 40% Ning WP melon blight. High concentrations (over 500 mg/mL) of TOE had strong inhibitory effects on melon seed germination and the activity of protective enzymes in melon cultivars. (author)

  13. Molecular Cloning, Characterization, and Expression of Cuc m 2, a Major Allergen in Cucumis melo

    Directory of Open Access Journals (Sweden)

    Mojtaba Sankian

    2013-05-01

    Full Text Available Background: Several studies reported the clinical features of IgE-mediated hypersensitivity after ingestion of melon. Melon allergy is a common IgE-mediated fruit allergy in Iran. This prompted us to investigate immunochemical and molecular properties of the major allergen in melon fruit, to compare the IgE-binding capacity of the natural protein with the recombinant allergen, and to determine cross-reactivity of the major allergen with closely-related allergens from other plants displaying clinical cross-reactivity with melon. Methods: Identification and molecular characterization of the major melon allergen were performed using IgE immunoblotting, allergen-specific ELISA, affinity-based purifications, cross-inhibition assays, cloning, and expression of the allergen in Escherichia coli. Results: Melon profilin was identified and isolated as a major IgE-binding component and designated as Cuc m 2. Sequencing corresponding cDNA revealed an open reading frame of 363 bp coding for 131 amino acid residues and two fragments of 171 bp and 383 bps for the 5’and 3’ UTRs, respectively. Significant cross-reactivity was found between melon profilin and Cynodon dactylon, tomato, peach, and grape profilins in cross-inhibition assays. Although the highest degree of amino acid identity was revealed with watermelon profilin, there was no significant cross-reactivity between melon and watermelon profilins. Conclusion: Melon profilin is the major IgE-binding component in melon extract, and the recombinant and natural forms exhibited similar IgE-binding capacities. A part of the fruit-fruit and pollen-fruit cross-reactions could be explained by the presence of this conserved protein; however, sequence homology provides insufficient information to predict IgE cross-reactivity of profilins.

  14. High-quality total RNA isolation from melon (Cucumis melo L. fruits rich in polysaccharides

    Directory of Open Access Journals (Sweden)

    Gabrielle Silveira de Campos

    2017-08-01

    Full Text Available Melon, a member of the family Cucurbitaceae, is the fourth most important fruit in the world market and, on a volume basis, is Brazil’s main fresh fruit export. Many molecular techniques used to understand the maturation of these fruits require high concentrations of highly purified RNA. However, melons are rich in polyphenolic compounds and polysaccharides, which interfere with RNA extraction. This study aimed to determine the most appropriate method for total RNA extraction from melon fruits. Six extraction buffers were tested: T1 guanidine thiocyanate/phenol/chloroform; T2 sodium azide/?-mercaptoethanol; T3 phenol/guanidine thiocyanate; T4 CTAB/PVP/?-mercaptoethanol; T5 SDS/sodium perchlorate/PVP/?-mercaptoethanol, and T6 sarkosyl/PVP/guanidine thiocyanate, using the AxyPrepTM Multisource Total RNA Miniprep Kit. The best method for extracting RNA from both mature and green fruit was based on the SDS/PVP/?-mercaptoethanol buffer, because it rapidly generated a high quality and quantity of material. In general, higher amounts of RNA were obtained from green than mature fruits, probably due to the lower concentration of polysaccharides and water. The purified material can be used as a template in molecular techniques, such as microarrays, RT-PCR, and in the construction of cDNA and RNA-seq data.

  15. (Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran

    African Journals Online (AJOL)

    ajl11

    2012-10-30

    Oct 30, 2012 ... Melon is an important dessert fruit in the Sistan region of. Iran, but its cultivation is threatened by attacks of. Macrophomina phaseolina (Tassi), Monosporascus cannonballus (Pollack and Uecker) and Rhizoctonia solani (Kuhn) (Safarnezhad, 2004). Melon death induced by these soil-borne plant pathogenic ...

  16. Endogenous microbial contamination of melons (Cucumis melo) from international trade: an underestimated risk for the consumer?

    Science.gov (United States)

    Esteban-Cuesta, Irene; Drees, Nathalie; Ulrich, Sebastian; Stauch, Peter; Sperner, Brigitte; Schwaiger, Karin; Gareis, Manfred; Gottschalk, Christoph

    2018-03-31

    Fruits and vegetables have increasingly been related to foodborne outbreaks. Besides surface contamination, a possible internalization of microorganisms into edible parts of plants during growth has already been observed. To examine an actual risk for the consumer, microbial contamination of the rind and pulp of 147 muskmelons from international trade was assessed using cultural and biochemical methods, polymerase chain reaction and matrix-assisted laser desorption/ionization-time of flight mass spectrometry. One hundred percent of the rind samples [3.69-8.92 log colony forming units (CFU) g -1 ] and 89.8% of the pulp samples (maximum load 3.66 log CFU g -1 ) were microbiologically contaminated. Among the 432 pulp isolates, opportunistic and potentially pathogenic bacteria were identified, mainly Staphylococcus spp. (48.9%), Clostridium spp. (42.9%) and Enterobacteriaceae (27.9%). Salmonella spp., Escherichia coli and isolates of the Bacillus cereus group were found on the rind (1.4%, 0.7% and 42.9%, respectively) and in the pulp (0.7%, 1.4% and 4.7%). Clostridium perfringens was isolated from the rind of seven melons. The present study revealed a regularly occurring internal contamination of melons. Possible health risks for consumers because of an occurrence of microorganisms in melon pulp should be considered in future food safety assessments. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  17. Marker-assisted selection of Fusarium wilt-resistant and gynoecious melon (Cucumis melo L.).

    Science.gov (United States)

    Gao, P; Liu, S; Zhu, Q L; Luan, F S

    2015-12-08

    In this study, molecular markers were designed based on the sex determination genes ACS7 (A) and WIP1 (G) and the domain in the Fusarium oxysporum-resistant gene Fom-2 (F) in order to achieve selection of F. oxysporum-resistant gynoecious melon plants. Markers of A and F are cleaved amplified polymorphic sequences that distinguish alleles according to restriction analysis. Twenty F1 and 1863 F2 plants derived from the crosses between the gynoecious line WI998 and the Fusarium wilt-resistant line MR-1 were genotyped based on the markers. The results showed that the polymerase chain reaction and enzyme digestion results could be effectively used to identify plants with the AAggFF genotype in F2 populations. In the F2 population, 35 gynoecious wilt-resistant plants were selected by marker-assisted selection and were confirmed by disease infection assays, demonstrating that these markers can be used in breeding to select F. oxysporum-resistant gynoecious melon plants.

  18. Effects of gamma irradiation of pollen on parthenogenetic haploid production in muskmelon (Cucumis melo L.)

    International Nuclear Information System (INIS)

    Cuny, F.; Grotte, M.; Dumas de Vaulx, R.; Rieu, A.

    1993-01-01

    The effects of increasing gamma ray exposures on muskmelon pollen of the Védrantais genotype were evaluated after autofertilization and hybridization with the F1.G1 genotype. Regardless of doses of between 0.15 and 1.6 kGy, fruit set and number of seeds per fruit were comparable to those of the control. The pollen tube from pollen irradiated with up to 2.5 kGy grew in styles and reached the ovules. When pollen was cultivated in vitro, relatively high doses of irradiation (1.6 kGy) were needed to reduce the level of germination. Radiation-induced changes in the generative nucleus led to the formation of two chromosomally unbalanced sperm cells (as indicated by the appearance of morphological dimorphism) which induced parthenogenetic development of the egg to form a haploid embryo. Haploid embryo production by gamma-irradiated pollen was genotype dependent. For exposures of between 0.15 and 2.5 kGy, the production of embryos was the same, about 3.4%; a maximum of 70% of these embryos placed in a specific culture medium produced haploid plants. The ploidy of the plantlets in vitro was determined by flow cytometry. No aneuploidy was detected. All resulting plants exhibited normal phenotypes. (author) [fr

  19. (Cucumis melo L.) cultivars to soil-borne plant pathogenic fungi in Iran

    African Journals Online (AJOL)

    ajl11

    2012-10-30

    Oct 30, 2012 ... resistance of melon cultivars to three important soil-borne plant pathogens found worldwide. Key words: Melon ... use of cultivars resistant to plant diseases is one of the ..... emerging disease of melons worldwide. Plant Dis.

  20. Effects of the incorporation of cantaloupe pulp in yogurt: Physicochemical, phytochemical and rheological properties.

    Science.gov (United States)

    Kermiche, F; Boulekbache-Makhlouf, L; Félix, M; Harkat-Madouri, L; Remini, H; Madani, K; Romero, A

    2018-01-01

    The therapeutic effects of cantaloupe are of great interest for the development of functional foods such as yogurt. In this study a new dairy product has been formulated by enriching natural yogurt with fruit cantaloupe (yogurt with cantaloupe puree, yogurt with dry cantaloupe and yogurt with dry cantaloupe and cantaloupe puree). Thus, composition (moisture, ash, lipids, proteins), including amino acid contents, lactic flora as well as rheological (viscoelasticity, viscosity) property of cantaloupe yogurt and natural yogurt is assessed. In addition, pH value, water holding capacity and antioxidant activity (reducing power) are measured over refrigerated storage time. There are significant differences between natural yogurt and cantaloupe yogurt in almost all parameters. The results show that the pH decreases during the storage period and the antioxidant activity as well as the water holding capacity are more remarkable in the yogurt with dry cantaloupe at the 14th and the 28th day of storage, respectively. The addition of cantaloupe in natural yogurt ameliorates the load of lactic flora and modifies the rheological property of the new products. The results of the current study show that the addition of cantaloupe to yogurt significantly improved its quality.

  1. Internalization of Listeria monocytogenes in cantaloupes during dump tank washing and hydrocooling.

    Science.gov (United States)

    Macarisin, Dumitru; Wooten, Anna; De Jesus, Antonio; Hur, Minji; Bae, Seonjae; Patel, Jitendra; Evans, Peter; Brown, Eric; Hammack, Thomas; Chen, Yi

    2017-09-18

    Recent listeriosis outbreaks and recalls associated with cantaloupes urge for studies to understand the mechanisms of cantaloupe contamination by Listeria monocytogenes. Postharvest practices such as washing and hydrocooling were suggested to facilitate the contamination of fresh fruits by human pathogens. This study assessed the potential of L. monocytogenes internalization into cantaloupes during dump tank washing and immersion-type hydrocooling in water contaminated with L. monocytogenes. The effect of cantaloupe cultivar, water temperature, and harvesting technique on L. monocytogenes internalization was also evaluated. Full slip (cantaloupe without any residual stem) Western and Eastern cultivar cantaloupes were pre-warmed to 42°C (to imitate peak-high field temperatures of freshly harvested cantaloupes) and then immersed in water at 6°C and 18°C containing 4 and 6logCFU/ml of L. monocytogenes. Clipped (cantaloupe with short stem residues obtained by clipping the stem at harvest) Western and Eastern cantaloupes were pre-warmed to 42°C and then immersed in water at 6°C containing 6logCFU/ml of L. monocytogenes. Additionally, full slip and clipped Western cantaloupes were equilibrated to 18°C and then immersed in water at 18°C containing 6logCFU/ml of L. monocytogenes (isothermal immersion without temperature differential). Water containing L. monocytogenes infiltrated both full slip and clipped cantaloupes through the stems/stem scars and was then distributed along the vascular system in hypodermal mesocarp reaching the calyx area of the fruit. The current study demonstrated that, under experimental conditions, L. monocytogenes can internalize into cantaloupes during immersion in water contaminated by L. monocytogenes, both in the presence and absence of temperature differential, and that temperature differential moderately enhanced the internalization of L. monocytogenes. The incidence and levels of L. monocytogenes internalized in the middle

  2. Microbial safety and overall quality of cantaloupe fresh-cut pieces prepared from whole cantaloupe after wet steam treatment

    Science.gov (United States)

    Fresh-cut cantaloupes have been associated with outbreaks of Salmonelosis disease and the minimally processed fresh-cut fruits have a limited shelf life because of deterioration caused by spoilage microflora and physiological processes. In this study, we evaluated the effect of minimal wet steam t...

  3. Temas de Historia: El golpe de Melo

    Directory of Open Access Journals (Sweden)

    Fernando Serpa Flórez

    1965-07-01

    Full Text Available El 16 de abril de 1854, en las horas de la noche, el general José María Melo, comandante general del ejército, se apoderó de los cuarteles de Bogotá. Al día siguiente, por la mañana, envió una comisión ante el Presidente de la República, José María Obando, a ofrecerle la dictadura. El presidente rechazó tal propuesta y convocó al Consejo de Gobierno, al vicepresidente José de Obaldía, al Procurador General de la Nación y al designado, general Tomás Herrera, para estudiar la situación.

  4. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300-1458.

    Science.gov (United States)

    Paris, Harry S; Janick, Jules; Daunay, Marie-Christine

    2011-09-01

    The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word 'gherkin' back to languages of the geographical nativity of C. sativus, the Indian

  5. Medieval herbal iconography and lexicography of Cucumis (cucumber and melon, Cucurbitaceae) in the Occident, 1300–1458

    Science.gov (United States)

    Paris, Harry S.; Janick, Jules; Daunay, Marie-Christine

    2011-01-01

    Background The genus Cucumis contains two species of important vegetable crops, C. sativus, cucumber, and C. melo, melon. Melon has iconographical and textual records from lands of the Mediterranean Basin dating back to antiquity, but cucumber does not. The goal of this study was to obtain an improved understanding of the history of these crops in the Occident. Medieval images purportedly of Cucumis were examined, their specific identity was determined and they were compared for originality, accuracy and the lexicography of their captions. Findings The manuscripts having accurate, informative images are derived from Italy and France and were produced between 1300 and 1458. All have an illustration of cucumber but not all contain an image of melon. The cucumber fruits are green, unevenly cylindrical with an approx. 2:1 length-to-width ratio. Most of the images show the cucumbers marked by sparsely distributed, large dark dots, but images from northern France show them as having densely distributed, small black dots. The different size, colour and distribution reflect the different surface wartiness and spininess of modern American and French pickling cucumbers. The melon fruits are green, oval to serpentine, closely resembling the chate and snake vegetable melons, but not sweet melons. In nearly all manuscripts of Italian provenance, the cucumber image is labelled with the Latin caption citruli, or similar, plural diminuitive of citrus (citron, Citrus medica). However, in manuscripts of French provenance, the cucumber image is labelled cucumeres, which is derived from the classical Latin epithet cucumis for snake melon. The absence of melon in some manuscripts and the expropriation of the Latin cucumis/cucumer indicate replacement of vegetable melons by cucumbers during the medieval period in Europe. One image, from British Library ms. Sloane 4016, has a caption that allows tracing of the word ‘gherkin’ back to languages of the geographical nativity of C

  6. A conserved ethylene biosynthesis enzyme leads to andromonoecy in two cucumis species.

    Directory of Open Access Journals (Sweden)

    Adnane Boualem

    Cucumis sativus (cucumber and Cucumis melo (melon that have diverged over 40 My ago. The isolation of the genes for andromonoecy in Cucumis species provides a molecular basis for understanding how sexual systems arise and are maintained within and between species.

  7. An AFLP marker linked to the Pm-1 gene that confers resistance to Podosphaera xanthii race 1 in Cucumis melo

    Directory of Open Access Journals (Sweden)

    Ana Paula Matoso Teixeira

    2008-01-01

    Full Text Available Brazil produced 330,000 metric tons of melons in 2005, principally in the Northeast region where one of the most important melon pathogens is the powdery mildew fungus Podosphaera xanthii. The disease is controlled mainly by incorporating single dominant resistance genes into commercial hybrids. We report on linkage analysis of the Pm-1 resistance gene, introgressed from the AF125Pm-1 Cantalupensis Charentais-type breeding line into the yellow-fleshed melon (Group Inodorus breeding line AF426-S by backcrossing to produce the resistant line AF426-R, and the amplified fragment length polymorphism (AFLP marker M75/H35_155 reported to be polymorphic between AF426-S and AF426-R. Segregation analysis of M75/H35_155 using a backcross population of 143 plants derived from [AF426-R x AF426-S] x AF426-S and screened for resistance to P. xanthii race 1 produced a recombination frequency of 4.9%, indicating close linkage between M75/H35_155 and Pm-1. Using the same segregating population, the M75/H35_155 marker had previously been reported to be distantly linked to Prv¹, a gene conferring resistance to papaya ringspot virus-type W. Since M75/H35_155 is linked to Prv¹ at a distance of 40.9 cM it is possible that Pm-1 and Prv¹ are also linked.

  8. Linkage Map Construction and QTL Analysis of Fruit Traits in Melon (Cucumis melo L.) Based on CAPS Markers

    International Nuclear Information System (INIS)

    Baloch, A. M.; Liu, S.; Wang, X.; Luan, F.; Baloch, A. W.; Baloch, M. J.

    2016-01-01

    In the current experiment, the quantitative trait loci (QTL) analysis was done by composite interval mapping method to detect QTLs in edge, central parts and fruit shape of melon. In this context, 235 F/sub 2/ populations along with their parents were evaluated for fruit size, shape and color under replicated trail at Horticulture Experimental Station of Northeast Agricultural University, Harbin, China, during the growing year 2014. Moreover, 96 pairs of CAPS markers were used to construct a linkage map using F/sub 2/ population that was derived from the cross between two contrasting parents (MR-1 and Topmark). The total length of linkage map was found to be 4984.1cM with an average of 51.9177 cM between the markers. In a total, we detected ten QTLs, in which one was major, while others were minor. Five QTLs were detected in the edge part of melon fruit and three QTLs were detected in central parts of melon and all were considered as Brix content. Two QTLs were related with fruit shape. Our present genetic and QTLs mapping would be proved useful in plant breeding programs for the improvement of economically important horticultural traits. (author)

  9. Effect of Seed Pretreatment on Germination Parameters, Growth, and Fruit Yield of Muskmelon (Cucumis melo var reticulates L..

    Directory of Open Access Journals (Sweden)

    T. Moghbeli

    2015-03-01

    Full Text Available Seed pretreated with plant growth regulators can improve germination parameters, growth, and yield of crops. Thus, in two greenhouse and field experiments, effects of seed treatment with 0.1 mM salicylic acid (SA, 1µM methyl jasmonate (MJ, 1.5% humic acid (HA, and water (as Control on germination parameters, seedling growth, and also growth and fruit yield were studied. In the first experiment which was conducted on two cultivars (Semsuri and Shahpasandi, all the treatments improved most of parameters the recorded, and the response of two cultivars was rather similar for most parameters. In the second experiment which was conducted on one cultivar (Shahpasandi in the field, all the treatments improved most of parameters the recorded. Compared with the control, SA, MJ and HA increased total plant fresh weight (19, 41 and 19%, fruit number (30, 35 and 20% and fruit yield (31, 45 and 31, respectively. Significant correlations were found between fruit yield and relative water content (r = -0.95*, ion leakage (r = -0.93*, final plant shoot fresh weight (r = 0.99** and fruit number (r = 0.93*, indicating that treatments could increase fruit yield by improving ion leakage and relative water content.

  10. Plantas hospederas de Aphis gossypii (Aphididae), vector de virus del melón Cucumis melo (Cucurbitaceae) en Costa Rica

    OpenAIRE

    Sánchez, M.V.; Agüero, R.; Rivera, C.

    2001-01-01

    Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera) en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma ápter...

  11. [Host plants of Aphis gossypii (Aphididae), vector of virus of Cucumis melo melon (Cucurbitaceae) in Costa Rica].

    Science.gov (United States)

    Sánchez, M V; Agüero, R; Rivera, C

    2001-03-01

    Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families) and 72 plant species (40 families) were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families) were colonized by A. gossypii and 16 (10 families) are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  12. Plantas hospederas de Aphis gossypii (Aphididae, vector de virus del melón Cucumis melo (Cucurbitaceae en Costa Rica

    Directory of Open Access Journals (Sweden)

    M.V. Sánchez

    2001-03-01

    Full Text Available Se identificaron las especies hospederas naturales de Aphis gossypii Glover (Aphididae: Homoptera en plantaciones comerciales de melón para la exportación en Costa Rica. El estudio se realizó en dos fincas, ubicadas una en la provincia de Guanacaste y la otra en la provincia de Puntarenas, correspondientes a dos zonas de vida vegetal diferentes. Se identificaron como especies hospederas del áfido todas aquellas especies vegetales en las que se observó la presencia del áfido en su forma áptera. En ambas fincas el estudio se realizó en los alrededores y dentro del cultivo de melón. En la finca A en cinco diferentes comunidades vegetales (cultivo, canal de drenaje, charral, potrero mejorado y semi-bosque previamente seleccionadas y en la finca B en cuatro comunidades vegetales (cultivo, charral, pastizal natural y semi-bosque. Especímenes de las plantas colonizadas por áfidos y los áfidos colonizadores de cada especie fueron recolectadas para su identificación. Los áfidos se preservaron en alcohol al 70% v/v e identificaron utilizando las claves taxonómicas para áfidos, confirmándose como especie dominante a A. gossypii. La diversidad, cobertura y época de aparición de las especies de plantas hospederas fue monitoreada durante un año calendario en las diferentes comunidades vegetales presentes en ambas fincas, observándose diferencias entre las dos fincas estudiadas. En la finca A se observaron 86 diferentes especies vegetales, pertenecientes a 49 familias, asociadas al cultivo del melón, mientras que en la finca B se identificaron 72 especies de 40 familias. En conjunto para ambas fincas, un de 24 especies de plantas (16 familias estaban colonizadas por el áfido A. gossypii. De éstas, 16 especies de 10 familias, son reportes nuevos de plantas hospederas para este áfido: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia y Corchorus orinocensis.Plant species associated with commercial melon crops and surrounding areas were examined to identity the natural host plants of Aphis gossypii Glover. The study was conducted in two farms located in different melon production areas and plant life zones of Costa Rica. Plant species diversity, percent coverage and distribution over time were recorded during one year. Differences between locations were observed. A total of 86 plant species (49 families and 72 plant species (40 families were identified associated to the crop in farms A and B, respectively. In both farms a total of 24 species plants (16 families were colonized by A. gossypii and 16 (10 families are new reports of host plant species for this aphid. The new reports are: Justicia comata, Tetramerium nervosum, Alternanthera pubiflora, Cassia massoni, C. reticulata, Cleome viscosa, C. spinosa, Croton argenteus, Caperonia palustris, Chamaesyce gyssopilopia, Phyllantus amarus, Sida decumbens, Ludwigia erecta, Passiflora foetida, Guazuma ulmifolia and Corchorus orinocensis.

  13. A new strategy to protect Katsura-uri (Japan's heirloom pickling melon, Cucumis melo var. conomon from extinction

    Directory of Open Access Journals (Sweden)

    Azusa Sasaki

    2017-03-01

    Conclusion: This demonstrated a new strategy to protect this heirloom vegetable from extinction by adding a new function that could increase its demand as a low-calorie fruit in the present diet habit for human health.

  14. Evaluación agronómica de melón (cucumis melo l bajo condiciones de campo

    Directory of Open Access Journals (Sweden)

    Fernando Borrego

    2001-01-01

    Full Text Available Con el objetivo de determinar las variables más relacionadas con el rendimiento, así como los principales componentes de variación, se establecieron en campo, en Ramos Arizpe, Coahuila, 12 genotipos de melón, en un diseño de Bloques Completos al Azar, con cuatro repeticiones. La parcela experimental fue de dos surcos de cinco metros de largo sembrados a doble hilera. Los genotipos en estudio fueron: híbridos: Primo, Pronto, Challenger, Cheyenne, Hi-Line, Cruiser, Durango, Apache, Laguna, Caravelle y Main Pak, y la variedad Top Mark, testigo; las variables evaluadas fueron: rendimiento (11 variables: cuantitativas y cualitativas; fenológicas (tres variables; agroclimáticas (cinco Variables y fisiológicas (cuatro variables. Se encontraron correlaciones significativas (p<0,05 y negativas, entre rendimiento y precocidad, peso promedio de frutos y número de frutos, así como entre número de frutos y longitud de fruto. Las variables fisiológicas más relacionadas fueron fotosíntesis y uso eficiente del agua. En el análisis de componentes principales, se encontró que hasta el componente tres, se explica el 65% de la varianza. En el componente uno, se encuentra un alto valor en las características de rendimiento (producción, peso y tamaño, por lo que se llamaría “Características Cuantitativas del Rendimiento”. En el componente dos, la mayor variación es el de “Componente de Precocidad”. Los componentes tres al seis, explican en proporciones muy similares las otras variables, siendo en el seis donde se encuentra con mayor valor la fotosíntesis. El análisis de regresión lineal múltiple fue significativo (p<0,057 que, por las condiciones del estudio, se considera adecuado. El rendimiento en t/ha, se explica por una ecuación lineal múltiple (r2=0,99 de 10 variables

  15. Identifikasi berat, diameter, dan tebal daging buah melon (Cucumis melo L. kultivar action 434 tetraploid akibat perlakuan kolkisin

    Directory of Open Access Journals (Sweden)

    Y. Ulung Anggraito

    2012-02-01

    Full Text Available Indonesian farmers are very dependence on certificated seed from another countries. In the other side the natural resources andmen powers very abundance. For these reason it is properly developed the research in agriculture sector, especially on plants breeding.It can be hoped that in the future the dependence on certificated seed from another countries can be minimized. The objective of thisresearch were: (1 to find out the concentration and dipping period which is effective to induce polyploid in musk melon plant, (2identify the weight, diameter, dan flesh thickness of tetraploid musk melon as result of colchicines treatment. The sample of this researchwas Action 434 musk melon cultivar, product of Chia-Thai Seed, Thailand. The number of sample was 480 plants, which plants on fieldrandomly. There were four colchicines concentration as an independent variable: 0.0%, 0.05%, 0.10% and 0.2%. The dipping periodwere 12, 16, 20, and 24 hours for each concentration respectively. Completely Random Design was used in three replications. Datameasurement were analyzed with Two Way ANOVA, DMRT, and LSD. From this research can be concluded that: (1 0.2 % colchicinesis the most effective concentration to induce polyploid on musk melon, with dipping period effective varied from 16–24 hours, (2 thereare changes in weight, diameter, and flesh thickness characters, with the increased tendency of each character in definite norm.

  16. Hexanoic Acid Treatment Prevents Systemic MNSV Movement in Cucumis melo Plants by Priming Callose Deposition Correlating SA and OPDA Accumulation

    Directory of Open Access Journals (Sweden)

    Emma Fernández-Crespo

    2017-10-01

    Full Text Available Unlike fungal and bacterial diseases, no direct method is available to control viral diseases. The use of resistance-inducing compounds can be an alternative strategy for plant viruses. Here we studied the basal response of melon to Melon necrotic spot virus (MNSV and demonstrated the efficacy of hexanoic acid (Hx priming, which prevents the virus from systemically spreading. We analysed callose deposition and the hormonal profile and gene expression at the whole plant level. This allowed us to determine hormonal homeostasis in the melon roots, cotyledons, hypocotyls, stems and leaves involved in basal and hexanoic acid-induced resistance (Hx-IR to MNSV. Our data indicate important roles of salicylic acid (SA, 12-oxo-phytodienoic acid (OPDA, jasmonic-isoleucine, and ferulic acid in both responses to MNSV. The hormonal and metabolites balance, depending on the time and location associated with basal and Hx-IR, demonstrated the reprogramming of plant metabolism in MNSV-inoculated plants. The treatment with both SA and OPDA prior to virus infection significantly reduced MNSV systemic movement by inducing callose deposition. This demonstrates their relevance in Hx-IR against MNSV and a high correlation with callose deposition. Our data also provide valuable evidence to unravel priming mechanisms by natural compounds.

  17. Differential metabolism of L-phenylalanine in the formation of aromatic volatiles in melon (Cucumis melo L.) fruit.

    Science.gov (United States)

    Gonda, Itay; Davidovich-Rikanati, Rachel; Bar, Einat; Lev, Shery; Jhirad, Pliaa; Meshulam, Yuval; Wissotsky, Guy; Portnoy, Vitaly; Burger, Joseph; Schaffer, Arthur A; Tadmor, Yaakov; Giovannoni, James J; Fei, Zhangjun; Fait, Aaron; Katzir, Nurit; Lewinsohn, Efraim

    2018-04-01

    Studies on the active pathways and the genes involved in the biosynthesis of L-phenylalanine-derived volatiles in fleshy fruits are sparse. Melon fruit rinds converted stable-isotope labeled L-phe into more than 20 volatiles. Phenylpropanes, phenylpropenes and benzenoids are apparently produced via the well-known phenylpropanoid pathway involving phenylalanine ammonia lyase (PAL) and being (E)-cinnamic acid a key intermediate. Phenethyl derivatives seemed to be derived from L-phe via a separate biosynthetic route not involving (E)-cinnamic acid and PAL. To explore for a biosynthetic route to (E)-cinnamaldehyde in melon rinds, soluble protein cell-free extracts were assayed with (E)-cinnamic acid, CoA, ATP, NADPH and MgSO 4 , producing (E)-cinnamaldehyde in vitro. In this context, we characterized CmCNL, a gene encoding for (E)-cinnamic acid:coenzyme A ligase, inferred to be involved in the biosynthesis of (E)-cinnamaldehyde. Additionally we describe CmBAMT, a SABATH gene family member encoding a benzoic acid:S-adenosyl-L-methionine carboxyl methyltransferase having a role in the accumulation of methyl benzoate. Our approach leads to a more comprehensive understanding of L-phe metabolism into aromatic volatiles in melon fruit. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Listeria monocytogenes persistence and transfer to cantaloupes in the packing environment is affected by equipment surface type and cleanliness

    Science.gov (United States)

    Cantaloupes have frequently been contaminated with bacterial pathogens and caused several high profile outbreaks over the years. In 2011, Rocky Ford cantaloupes contaminated with Listeria monocytogenes sickened 147 people and resulted in 33 fatalities, making it the deadliest foodborne outbreak in t...

  19. Inactivation of Salmonella enterica and Listeria monocytogenes in cantaloupe puree by high hydrostatic pressure with/without added ascorbic acid

    Science.gov (United States)

    The objective of this research was to evaluate and develop a method for inactivation of Salmonella enterica and Listeria monocytogenes in cantaloupe puree (CP) by high hydrostatic pressure (HHP). Cantaloupe being the most netted varieties of melons presents a greater risk of pathogen transmission. ...

  20. ECHR Melo Tadeu: A Tax Case Which Should Bring on More Carefully Selected Criminal Procedures

    NARCIS (Netherlands)

    Poelmann, E.

    2016-01-01

    The European Court of Human Rights (ECHR) judged in the Melo Tadeu case that the refusal of the authorities to undo the seizure of assets after a criminal acquittal, is disproportional, regardless whether the appeal was too late. The Melo Tadeu judgment implies mainly that the presumption of

  1. Geological map of Uruguay Esc 1,100,000. Melo Sheet D-15

    International Nuclear Information System (INIS)

    Ferrando, L.; Andreis, R.

    1990-01-01

    This work is about the geological map of Uruguay Esc.1.100.000 (Melo) and the explanatory memoranda which describes the geological , lithological and sedimentological characteristics soils belong to the pre devonian period in Melo, Buena Vista Yaguari and Tres islas formations. These metamorphic rocks would be compared with the orogenic cycle of the east and southeast groups

  2. Melos: a Rhetoric Proof in Songs in Semiotic Perspective

    Directory of Open Access Journals (Sweden)

    Adriano Dantas de Oliveira

    2016-12-01

    Full Text Available We will have, in this work, the exposure of an approach to cancional text as a specific rhetorical situation. We assimilated the melos as all musical aspects of the song as a rhetorical proof that articulates the traditional trilogy: ethos, logos and pathos. We will use an interdisciplinary theoretical framework, articulating the classical rhetoric to semiotics applied to the song, exploring, from this model, discursive aspects of cancional text. As corpus, we have the analysis of a buarquiana song sample sociopolitical theme composed and recorded during the period of dictatorship.

  3. (cucumis sativus l.) in spent engine oil contaminated soil amended

    African Journals Online (AJOL)

    compost treatment recorded the highest number of leaves while the number of leaves for 0% ... KEYWORDS: Growth, Cucumis sativus, Urena lobata, spent engine oil, contamination, .... sawdust, peat, waste cotton and organic manures are.

  4. Nature’s packaging and organization of carotenoids in watermelon and cantaloupe chromoplasts

    Science.gov (United States)

    As a means to better understand factors influencing the bioavailability of carotenoids from natural sources, the properties of plant-derived precipitates of watermelon lycopene and cantaloupe B-carotene were examined in an aqueous environment. Electron microscopy and chemical analyses revealed that...

  5. Effect of high hydrostatic pressure processing on the background microbial loads and quality of cantaloupe puree

    Science.gov (United States)

    The objective of this study was to investigate and evaluate the effects of high hydrostatic pressure (HHP) applied to cantaloupe puree (CP) on microbial loads and product quality during storage for 10 days at 4 degrees C. Freshly prepared, double sealed and double bagged CP (ca. 5 g) was pressure tr...

  6. Hidrogeologic and geophysical studies into Agro school Melo UTU Cerro Largo province

    International Nuclear Information System (INIS)

    Heinzen, W.; Santana, I.; Mari, C.

    1986-01-01

    The technical University UTU of Uruguay requested and Hidrogeologic study with the aim to analyze the factibility to discover underground stream waters which supply groundwaters into agro school Ing Agr. Alcides E Pintos Melo, Cerro Largo province.

  7. Cold Plasma-activated hydrogen peroxide aerosol inactivates Escherichia coli 0157:H7, Salmonella Typhimurium, and Listeria innocua and maintains quality of grape tomato, spinach and cantaloupe

    Science.gov (United States)

    The purpose of this study was to investigate the efficacy of aerosolized hydrogen peroxide in inactivating bacteria and maintaining quality of grape tomato, baby spinach leaves and cantaloupe. Stem scar and smooth surfaces of tomatoes, spinach leaves, and cantaloupe rinds, inoculated with Escherich...

  8. The genome of the cucumber, Cucumis sativus L.

    NARCIS (Netherlands)

    Huang, S.W.; Li, R.Q.; Vossen, van der E.A.G.

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA

  9. Genetic identification of a dwarf mutant in cucumber ( Cucumis ...

    African Journals Online (AJOL)

    The dwarf (compact) plant architecture is an important trait in cucumber (Cucumis sativus L.) breeding. A dwarf type mutant was selected from the cucumbers. The morphological and reproductive characteristics of the dwarf were compared with the vine plants. The dwarf type of cucumbers is characterized by its short ...

  10. The genome of the cucumber, Cucumis sativus L

    DEFF Research Database (Denmark)

    Huang, Sanwen; Li, Ruiqiang; Zhang, Zhonghua

    2009-01-01

    Cucumber is an economically important crop as well as a model system for sex determination studies and plant vascular biology. Here we report the draft genome sequence of Cucumis sativus var. sativus L., assembled using a novel combination of traditional Sanger and next-generation Illumina GA seq...

  11. A single recessive gene controls fragrance in cucumber (Cucumis ...

    Indian Academy of Sciences (India)

    2013-04-10

    Apr 10, 2013 ... Genetic studies in rice (Sood and Siddiq 1978), soybean. (AVRDC .... difficulty, marker-assisted selection (MAS) is an alternative for breeding ... 31, 823–826. de Wilde W. J. J. O and Duyfjes B. E. E. 2010 Cucumis sativus.

  12. Survival and growth populations of Salmonella transferred from melon rind surfaces to cantaloupe, honeydew, and watermelon pulps during preparation

    Science.gov (United States)

    Consumers are eating more fresh vegetable and fruit due to nutritional and health-related benefits. Whole melons (cantaloupes, honeydew and watermelons) are of particular interest because of their nutrient contents. However, they are frequently contaminated with foodborne pathogens. Conditions neces...

  13. Microbial safety and overall quality of cantaloupe fresh-cut pieces prepared from whole fruit after wet steam treatment

    Science.gov (United States)

    Fresh-cut cantaloupes have been associated with outbreaks of Salmonellosis. Minimally processed fresh-cut fruits have a limited shelf life because of deterioration caused by spoilage microflora and physiological processes. The objectives of this study were to use a wet steam process to 1) reduce ind...

  14. Practices and conditions which promote persistence of Listeria monocytogenes on equipment surfaces and transfer to cantaloupes in the packing environment

    Science.gov (United States)

    Introduction: Investigation of the 2011 U.S. listeriosis outbreak associated withcontaminated cantaloupes revealed that transfer of L. monocytogenes(Lm) from equipment surfaces to melons in the packing facility was a potential route of contamination. Purpose:This study examined the persistence of Lm...

  15. Mapping the Flavor Contributing Traits on "Fengwei Melon" (Cucumis melo L. Chromosomes Using Parent Resequencing and Super Bulked-Segregant Analysis.

    Directory of Open Access Journals (Sweden)

    Hong Zhang

    Full Text Available We used a next-generation high-throughput sequencing platform to resequence the Xinguowei and Shouxing melon cultivars, the parents of Fengwei melon. We found 84% of the reads (under a coverage rate of "13×" placed on the reference genome DHL92. There were 2,550,000 single-nucleotide polymorphisms and 140,000 structural variations in the two genomes. We also identified 1,290 polymorphic genes between Xinguowei and Shouxing. We combined specific length amplified fragment sequencing (SLAF-seq and bulked-segregant analysis (super-BSA to analyze the two parents and the F2 extreme phenotypes. This combined method yielded 12,438,270 reads, 46,087 SLAF tags, and 4,480 polymorphic markers (average depth of 161.81×. There were six sweet trait-related regions containing 13 differential SLAF markers, and 23 sour trait-related regions containing 48 differential SLAF markers. We further fine-mapped the sweet trait to the genomic regions on chromosomes 6, 10, 11, and 12. Correspondingly, we mapped the sour trait-related genomic regions to chromosomes 2, 3, 4, 5, 9, and 12. Finally, we positioned nine of the 61 differential markers in the sweet and sour trait candidate regions on the parental genome. These markers corresponded to one sweet and eight sour trait-related genes. Our study provides a basis for marker-assisted breeding of desirable sweet and sour traits in Fengwei melons.

  16. Comparison of Different Methods for Separation of Haploid Embryo Induced through Irradiated Pollen and Their Economic Analysis in Melon (Cucumis melo var. inodorus

    Directory of Open Access Journals (Sweden)

    Gökhan Baktemur

    2013-01-01

    Full Text Available Irradiated pollen technique is the most successful haploidization technique within Cucurbitaceae. After harvesting of fruits pollinated with irradiated pollen, classical method called as “inspecting the seeds one by one” is used to find haploid embryos in the seeds. In this study, different methods were used to extract the embryos more easily, quickly, economically, and effectively. “Inspecting the seeds one by one” was used as control treatment. Other four methods tested were “sowing seeds direct nutrient media,” “inspecting seeds in the light source,” “floating seeds on liquid media,” and “floating seeds on liquid media after surface sterilization.” Y2 and Y3 melon genotypes selected from the third backcross population of Yuva were used as plant material. Results of this study show that there is no statistically significant difference among methods “inspecting the seeds one by one,” “sowing seeds direct CP nutrient media,” and “inspecting seeds in the light source,” although the average number of embryos per fruit is slightly different. No embryo production was obtained from liquid culture because of infection. When considered together with labor costs and time required for embryo rescue, the best methods were “sowing seeds directly in the CP nutrient media“ and ”inspecting seeds in the light source.”

  17. Pewarisan Karakter Fenotip Melon (Cucumis melo L. ‘Hikapel Aromatis’ Hasil Persilangan ♀ ‘Hikapel’ dengan ♂ ‘Hikadi Aromatik’

    Directory of Open Access Journals (Sweden)

    Budi Setiadi Daryono

    2018-01-01

    Full Text Available This research aims to develop cultivars with superior phenotypes of melon and high level of productivity. This research used the individual results of crossing between melon  ♀ ‘Hikapel' with ♂ 'Hikadi Aromatik'. The research included qualitative and quantitative phenotype characterization test. The research was conducted in Center of Agrotechnology Innovation University of Gadjah Mada (PIAT-UGM, Kalitirto, Berbah, Sleman, Yogyakarta and Laboratory of Genetics Faculty of Biology UGM on December 2016 until March 2017. Quantitative data analysis used ANOVA testing through PKBT-STAT 2.02 software with Random Complete Block Design (RCBD method at significance level of 1% and 5%. Melon 'Hikapel Aromatik' has several advantages including oval shape, without net, without lobes, crispy texture, skin-collored yellow RHS (6A, has a 7-14 brix, has volatile aromatic compound and transposon influenced. Based on the results of recapitulation of variance, the characters of 'Hikapel Aromatik' was not uniform.

  18. Effect of bio activators’ application and manual fruit thinning on yield and quality of melon (Cucumis melo L.) grown under protected cultivation in Costa Rica

    OpenAIRE

    Alvarado-Sánchez, Tania; Monge-Pérez, José Eladio

    2015-01-01

    Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el nú...

  19. Controlling the Sex of Flowers in Different Stages of Growth and Development of Melon (Cucumis melo var. reticualus L. with Ethephon Application

    Directory of Open Access Journals (Sweden)

    K. Arabsalmani

    2013-06-01

    Full Text Available To investigate the effect of ethephon on control of male flowers in melon, a split plot experiment, with randomized complete blocks design and three replications, was conducted in Agricultural and Natural Resources Research Center of Varamin, Iran, during 2005-2006. The main factor included three levels of plant growth stage (3-leaf, 6-leaf and early reproductive stage and sub-plots included four ethephon levels (0, 100, 200 and 300 mg/L. The appearance time of female flowers, number of male and female flowers (7 and 14 days after application of ethephon, total yield and female/male flowers ratio were evaluated. Results showed that plant response to increasing concentration of ethephon depends on plant growth stage. By using the ethephon concentrations of 100, 200 and 300 mg/L, the emergence of female flowers was delayed 6, 13 and 15 days, respectively, in comparison to control. The highest yield (26430 kg/ha was obtained with spraying of 200 mg/L ethephon in trifoliate plants. In this case, the ratio of female to male flowers was highest (81.5%. A high dose of ethephon (over 200 mg/L was associated with reduced yield and ratio of female to male flowers, at all stages of plant growth, especially in reproductive growth stage. The results this research showed that the beneficial effects of ethephon application is possible only if the right time is chosen with respect to plant growth.

  20. Changes in evapotranspiration of summer and winter crops of netted melon [Cucumis melo] grown under glass in relation to meteorological and plant-related factors

    International Nuclear Information System (INIS)

    Asakura, T.

    1998-01-01

    Measurements of evapotranspiration taken in the summer and winter on netted melon crops grown under glass were taken to characterize seasonal and daily changes. The data were compared to meteorological and plant-related factors to seek some relationships. Evapotranspiration followed a sigmoid curve until one week after pollination, and then decreased gradually during fruit growth. Cumulative evapotranspirations after transplanting were about 116 kg and 60 kg, respectively, for the summer and winter crops, whereas the peak evapotranspirations were 3.O kg plant(-1) day(-1) and 1.3 kg plant(-1) day(-1). The rapid increase h the evapotranspiration during the early stage was associated with the increase in leaf area; its gradual decrease during fruit growth was associated with a decrease in the transpiration potential of leaves. Therefore, irrigation amounts should be increased with leaf development and decreased with fruit growth. The curve of solar radiation in sunny summer days peaked at noon, whereas vapor pressure deficit usually peaked in early or mid afternoon; evapotranspirations in the afternoon had higher values than had those in the morning. In winter, vapor pressure deficit was relatively high during late afternoon and early morning because of heating, whereas it was low during the remainder of the day on account of low ventilation. These fluctuations led to a weak correlation between evapotranspiration and vapor pressure deficit. Regression analyses indicated that solar radiation was a main meteorological factor affecting evapotranspiration

  1. Analytical traceability of melon (Cucumis melo var reticulatus): proximate composition, bioactive compounds, and antioxidant capacity in relation to cultivar, plant physiology state, and seasonal variability.

    Science.gov (United States)

    Maietti, Annalisa; Tedeschi, Paola; Stagno, Caterina; Bordiga, Matteo; Travaglia, Fabiano; Locatelli, Monica; Arlorio, Marco; Brandolini, Vincenzo

    2012-06-01

    Two morphologically different cultivars of Italian melons (Baggio and Giusto) were characterized considering samples harvested in different times, at the beginning (BPP) and at the end of the physiological plant production period (EPP). Proximate composition, protein, minerals, pH, phenolic content, antioxidant capacity, ascorbic acid, carotenoids, condensed tannins, and flavonoids were measured, showing a significant decrease in EPP samples (phenolics, antioxidant capacity, condensed tannins, and flavonoids); ascorbic acid decreased in Giusto cv, carotenoids in Baggio cv. Mineral content increased in either the cultivars (EPP samples). Year-to-year difference was significantly highlighted; the plant growing cycle significantly affected the chemotype. Despite these effects, the Principal Component Analysis (PCA) permitted the discrimination of Baggio from Giusto cv, and the discrimination of BPP from EPP samples as well. © 2012 Institute of Food Technologists®

  2. Oxidative stability, chemical composition and organoleptic properties of seinat (Cucumis melo var. tibish) seed oil blends with peanut oil from China.

    Science.gov (United States)

    Siddeeg, Azhari; Xia, Wenshui

    2015-12-01

    Seinat seed oil was blended with peanut oil for the enhancement of stability and chemical characteristics of the blend. The physicochemical properties (relative density, refractive index, free fatty acids, saponification value, iodine value and peroxide value) of seinat seed and peanut oil blends in ratios 95:5, 85:15, 30:70 and 50:50 proportions were evaluated, as well as oxidative stability index, deferential scanning calorimetric (DSC) characteristics and tocopherols content. Results of oil blend showed that there was no negative effect by the addition of seinat seed oil to peanut oil and also had decreased percentages of all saturated fatty acids except stearic acid, conversely, increased the levels of unsaturated fatty acids. As for the sensory evaluation, the panelist results showed that seinat seed oil blends had no significant differences (p blending of seinat seed oil with peanut oil had also increased the stability and tocopherols content. As Sudan is the first producer of seinat oil, blending of seinat seed oil with traditional oil like quality, and may decrease the consumption of other expensive edible oils.

  3. Identification of QTLs for resistance to powdery mildew and SSR markers diagnostic for powdery mildew resistance genes in melon (Cucumis melo L.).

    Science.gov (United States)

    Fukino, Nobuko; Ohara, Takayoshi; Monforte, Antonio J; Sugiyama, Mitsuhiro; Sakata, Yoshiteru; Kunihisa, Miyuki; Matsumoto, Satoru

    2008-12-01

    Powdery mildew caused by Podosphaera xanthii is an important foliar disease in melon. To find molecular markers for marker-assisted selection, we constructed a genetic linkage map of melon based on a population of 93 recombinant inbred lines derived from crosses between highly resistant AR 5 and susceptible 'Earl's Favourite (Harukei 3)'. The map spans 877 cM and consists of 167 markers, comprising 157 simple sequence repeats (SSRs), 7 sequence characterized amplified region/cleavage amplified polymorphic sequence markers and 3 phenotypic markers segregating into 20 linkage groups. Among them, 37 SSRs and 6 other markers were common to previous maps. Quantitative trait locus (QTL) analysis identified two loci for resistance to powdery mildew. The effects of these QTLs varied depending on strain and plant stage. The percentage of phenotypic variance explained for resistance to the pxA strain was similar between QTLs (R (2) = 22-28%). For resistance to pxB strain, the QTL on linkage group (LG) XII was responsible for much more of the variance (41-46%) than that on LG IIA (12-13%). The QTL on LG IIA was located between two SSR markers. Using an independent population, we demonstrated the effectiveness of these markers. This is the first report of universal and effective markers linked to a gene for powdery mildew resistance in melon.

  4. Modulation of aroma volatiles and phytochemical quality of fresh-cut melon (Cucumis melo L.) by oxygen levels, 1-methylcyclopropene and lysophosphatidylethanolameine

    OpenAIRE

    Amaro, Ana Luísa Leite Fernandes

    2012-01-01

    Current fresh-cut technologies are effective in the effort of maintaining visual quality during the fresh-cut fruit supply chain. However, studies on extended shelf life based on appearance attributes or microbial stability have neglected the understanding of the effect of processing technologies and conservation techniques in the aromatic, nutritional, and functional properties of processed fruit. Three technologies were evaluated for their effects on quality of fresh-cut melon, with emphasi...

  5. Effect of Digestate and Biochar Amendments on Photosynthesis Rate, Growth Parameters, Water Use Efficiency and Yield of Chinese Melon (Cucumis melo L. under Saline Irrigation

    Directory of Open Access Journals (Sweden)

    Mohammed M. A. Elbashier

    2018-02-01

    Full Text Available Despite the recent interest in biochar and digestate as soil amendments for improving soil quality and increasing crop production, there is inadequate knowledge of the effect of the combination of biochar and digestate, particularly under saline irrigation conditions. A pot experiment with Chinese melon was conducted in a greenhouse, biochar (5% and digestate (500 mL/pot were used with and without the recommended mineral NPK (Nitrogen, Phosphorus and Potassium fertilizer dose (120-150-150 Kg ha−1. The plants were irrigated with tap water (SL0 and 2 dS/m (SL1 NaCl solution. The growth, photosynthesis rate, water use efficiency (WUE and yield of Chinese melon were affected positively when biochar was combined with digestate amendment, particularly under saline irrigation water with and without mineral NPK fertilizer. The maximum yield under normal water was obtained by digestate (SL0: 218.87 t ha−1 and biochar amendment combined with digestate (SL1: 118.8 t ha−1 under saline water. The maximum WUE values were noticed with the biochar and digestate combination under all water treatments (SL0: 32.2 t ha−1 mm−1 and SL1: 19.6 t ha−1 mm−1. It was concluded that digestate alone was more effective than the use of biochar, particularly with normal water. The combination of biochar with digestate had a significant effect on the Chinese melon growth, photosynthesis rate, water use efficiency and yield under saline irrigation, and it can be used as an alternative fertilizer for mineral NPK fertilizer.

  6. Storage and irradiation of Cucumis pollen and their influence on pollen vitality

    International Nuclear Information System (INIS)

    Oost, E.H.; Nijs, A.P.M. den

    1979-01-01

    In connection with an interspecific hybridization programme and a mentor pollen experiment in Cucumis, the optimal storage conditions and in vitro germination medium for both fresh and irradiated pollen of the cultivated cucumber and two wild African Cucumis species have been searched for. (Auth.)

  7. Last instar larva of Microstigmus nigrophthalmus Melo (Hymenoptera, Crabronidae, Pemphredoninae, with notes on biology

    Directory of Open Access Journals (Sweden)

    Sandor Christiano Buys

    2002-09-01

    Full Text Available The last instar larva of Microstigmus nigrophthalmus Melo, 1992 is described. It markedly differs from that of M. comes Krombein, 1967 the only other species in the genus whose mature larva have been described, for features as follows: presence of spinnerets; setae on the labrum, maxillae and labium; mandibles with tridentate apex and a bidentate lateral projection; lack of the conical supranal processo Notes on habitat, structure, and content of nests are also presented.

  8. O "desenho de arquiteto" de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Rafaela Cardeal

    2015-12-01

    Full Text Available Tomando como ponto de partida a metáfora “desenho de arquiteto”, este ensaio aborda os aspectos arquitetônicos da poesia de João Cabral de Melo Neto. Para tal, propõe uma leitura retrospectiva da obra até o livro A educação pela pedra (1966, considerado pela crítica o mais arquitetônico da produção cabralina.

  9. Ancient Greek Legend in Modern Japanese Literature: “Run, Melos!” by Dazai Osamu

    Directory of Open Access Journals (Sweden)

    Lija GANTAR

    2017-12-01

    Full Text Available Dazai Osamu (1909-1948, a modern Japanese writer, wrote “Run, Melos!” in 1940. The short story is a rework of an Ancient Greek legend of Damon and Pythias from the 4th century B.C., which was introduced to Dazai through Schiller’s version of the legend, “The Hostage”. The legend, based on a true event, represents the perfect friendship and was reworked a number of times by different antique writers. After having been forgotten for a while, it reappeared in the Middle Ages as a fictional story and has gotten many new adaptations from then on. One of them was Schiller’s ballad in 1798, which – alongside an anecdote from Dazai’s own life – represented the basis for Dazai’s story. Even though “Run, Melos!” is not an autobiographical work, Dazai managed to pass his own feelings onto the characters, add some biblical elements, and included a never-before-employed dark twist in the story, thus making his version more realistic than the preceding ones. Despite the distance in time and place between him and the legend, with “Run, Melos!”, Dazai managed to retell a Western literature story, making it a part of the Japanese literature as well, adding motifs and themes influenced by his own life, time, and place.

  10. Sterilization of DACUS CUCUMIS FRENCH (DIPTERA: TEPHRITDAE) by gamma radiation

    International Nuclear Information System (INIS)

    Hooper, G.H.S.

    1976-01-01

    When newly emerged adult Dacus cucumis French were irradiated in nitrogen, following a 15 min exposure to an atmosphere of pure nitrogen, the degree of sterility induced by a given dose was less than that obtained with the same dose in air. To achieve sterility in males of approximately 98 per cent doses of 7 krad in air and 13 krad in nitrogen were required. With females, total sterility through infecundity was achieved by 6 krad in air and 13 krad in nitrogen. Based on the hatch of eggs from competitive mating tests, males receiving 14 krad in nitrogen were significantly more competitive than males given 9 krad in air. The optimal light intensity for mating of D. cucumis under artificial conditions was 16.2, 1x. With this light intensity the mating propensity of males irradiated with 9 and 11 krad in air was significantly less than that of untreated males. The mating propensity of males given 14 krad in nitrogen approximated that of untreated males. (author)

  11. Effect of high hydrostatic pressure processing on the background microbial loads and quality of cantaloupe puree.

    Science.gov (United States)

    Mukhopadhyay, Sudarsan; Sokorai, Kimberly; Ukuku, Dike; Fan, Xuetong; Juneja, Vijay

    2017-01-01

    The objective of this study was to investigate and evaluate the effects of high hydrostatic pressure (HHP) applied to cantaloupe puree (CP) on microbial loads and product quality during storage for 10days at 4°C. Freshly prepared, double sealed and double bagged CP (ca. 5g) was pressure treated at 300, 400 and 500MPa at 8°C and 15°C for 5min. Microflora populations, soluble solid content, pH, color, antioxidant activity, appearance and aroma were measured at 1, 6, and 10d of storage. Results showed that high pressure treatment of 300MPa (8°C and 15°C) resulted in reduction of total aerobic plate count from 3.3 to 1.8logCFU/g. The treatment reduced the populations of native aerobic plate count to non-detectable levels (detection limit 1logCFU/g) at 400MPa and 500MPa pressures at 15°C. Pressure treatment completely inactivated mold and yeast in puree below the limits of detection at day 1 and no regrowth was observed during 10days of storage at 4°C while mold and yeast in untreated puree survived during the storage. High pressure treatment did not show any adverse impact on physical properties as soluble solid content (SSC, 11.2°Brix) and acidity (pH, 6.9). The instrumental color parameters (L*, a*, b*) were affected due to HHP treatment creating a slightly lighter product, compared to control, as indicated by higher L.* and lower a* values. However the change was not detected by the sensory panel while evaluating appearance scores. Pressure treatment did not affect the antioxidant capacity of puree product compared to control. Visual appearance and sniffing aroma test by panel revealed no adverse changes in the sensory parameters as a result of HHP treatment. HHP method described in this study appears to be a promising way to inactivate spoilage microorganisms in the cantaloupe puree and maintain quality. This study provides a viable option for preservation and marketing this product. Published by Elsevier Ltd.

  12. Phosphate-solubilizing fungi isolated from a semiarid area cultivated with melon (Cucumis melo L. cv. gold mine Fungos solubilizadores de fosfato isolados de área semiárida cultivada com melão (Cucumis melo L. cv. gold mine

    Directory of Open Access Journals (Sweden)

    Flavia Paiva Coutinho

    2011-12-01

    Full Text Available Considering that little is known about the occurrence of phosphate-solubilizing fungi from areas cultivated with melon, the phosphate solubilization ability of filamentous fungi isolated in these areas was evaluated. Three hundred and eighteen filamentous fungal isolates belonging to 23 genera were evaluated, besides Aphyllophorales and Mycelia sterilia. From those, 52 were able to solubilize P: Aphyllophorales (2, Aspergillus (34, Penicillium (10 and Rhizopus (6. These results will contribute to subsidizing further research regarding the capacity of these fungi to solubilize other sources of phosphate applied to the melon crop, as well as indicate the need for a screening program to select those with higher capacity and potential for solubilization.Considerando que pouco se conhece sobre a ocorrência de fungos solubilizadores de fosfato de áreas cultivadas com melão, foi avaliada a habilidade de solubilização desse nutriente por fungos filamentosos isolados dessas áreas. Foram avaliadas 318 amostras de fungos filamentosos pertencentes a 23 gêneros, além de Aphyllophorales e Mycelia sterilia. Dessas amostras, 52 apresentaram habilidade para solubilizar o fosfato: Aphyllophorales (2, Aspergillus (34, Penicillium (10 e Rhizopus (6. Esses resultados contribuem para subsidiar pesquisas que testem a capacidade desses fungos em solubilizar outras fontes fosfatadas aplicadas na cultura do melão, assim como indicam a necessidade de selecionar isolados com maior capacidade e potencial para solubilização.

  13. Cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch).

    Science.gov (United States)

    Nanasato, Yoshihiko; Tabei, Yutaka

    2015-01-01

    We established improved methods for Agrobacterium-mediated transformation of cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch). Vacuum infiltration of cotyledonary explants with Agrobacterium suspension enhanced the Agrobacterium infection efficiency in the proximal regions of explants. Wounding treatment was also essential for kabocha squash. Cocultivation on filter paper wicks suppressed necrosis of explants, keeping regeneration efficacy. Putative transgenic plants were screened by kanamycin resistance and green fluorescent protein (GFP) fluorescence. These putative transgenic plants grew normally and T1 seeds were obtained, and stable integration and transmission of the transgene in T1 generations were confirmed by Southern hybridization and PCR. The average transgenic efficiency for cucumber and kabocha squash was 11.9 ± 3.5 and 9.2 ± 2.9 %, respectively.

  14. Evaluation of Single or Double Hurdle Sanitizer Applications in Simulated Field or Packing Shed Operations for Cantaloupes Contaminated with Listeria monocytogenes

    Directory of Open Access Journals (Sweden)

    Cathy C. Webb

    2015-04-01

    Full Text Available Listeria monocytogenes contamination of cantaloupes has become a serious concern as contaminated cantaloupes led to a deadly outbreak in the United States in 2011. To reduce cross-contamination between cantaloupes and to reduce resident populations on contaminated melons, application of sanitizers in packing shed wash water is recommended. The sanitizing agent of 5% levulinic acid and 2% sodium dodecyl sulfate (SDS applied as a single hurdle in either a simulated dump or dip treatment significantly reduced L. monocytogenes to lower levels at the stem scar compared to a simulated dump treatment employing 200 ppm chlorine; however pathogen reductions on the rind tissue were not significantly different. Double hurdle approaches employing two sequential packing plant treatments with different sanitizers revealed decreased reduction of L. monocytogenes at the stem scar. In contrast, application of sanitizers both in the field and at the packing plant led to greater L. monocytogenes population reductions than if sanitizers were only applied at the packing plant.

  15. Qualidade do melão cantaloupe cv. Hy-Mark minimamente processado e armazenado sob refrigeração Quality of cantaloupe melon cv. Hy-Mark minimally processed and refrigerated

    Directory of Open Access Journals (Sweden)

    Raimundo Wilane de Figueiredo

    2007-03-01

    Full Text Available A maioria das pesquisas em melão minimamente processado é concentrada no tipo 'cantaloupe', devido à sua importância no mercado internacional. O objetivo deste trabalho foi avaliar a qualidade do melão cantaloupe cv. Hy-Mark minimamente processado. Os frutos foram lavados e sanitizados, sendo em seguida cortados na forma de cubos, imersos em solução de CaCl2, acondicionados em embalagens flexíveis PET (tereftalato de polietileno e armazenados a 4ºC por 9 dias. O delineamento foi conduzido inteiramente casualizado, com três repetições. A intervalos de três dias, amostras foram coletadas e analisadas quanto a coliformes totais e fecais, e contagem de bactérias aeróbias mesófilas e bolores e leveduras, pH, sólidos solúveis totais, acidez, vitamina C, açúcares redutores totais, atividade de água, firmeza e análise sensorial através do atributo de aceitação global. O melão minimamente processado apresentou boa estabilidade física, físico-química, microbiológica e sensorial, estimando-se em 9 dias a vida útil deste produto a 4ºC.Most of the research into minimally processed melon is focused on cantaloupe melon, due to its importance in the international market. The objective of this work was to evaluate the quality of cantaloupe melon cv. Hy-Mark, minimally processed and refrigerated. Fruits were washed, sanitized, cut and imbedded in a calcium chloride solution and packed in PET and stored at 4ºC during 9 days. At three-day intervals samples were collected and analyzed for total and fecal coliforms, counting of aerobic mesophilic bacterias, molds and yeast, SS (soluble solids, TTA (total titrable acidity, firmness, pH, TRS (total reducing sugar, Aw, vitamin C, color and acceptability. The minimally processed melon showed good overall physical, pyisico-chemical, microbiological and sensorial stability during the storage period.

  16. Thermal tolerance of acid-adapted and unadapted Salmonella, Escherichia coli O157:H7, and Listeria monocytogenes in cantaloupe juice and watermelon juice.

    Science.gov (United States)

    Sharma, M; Adler, B B; Harrison, M D; Beuchat, L R

    2005-01-01

    A study was performed to determine D values of acid-adapted and unadapted cells of Salmonella, Escherichia coli O157:H7, and Listeria monocytogenes in cantaloupe juice and watermelon juice. Salmonella enterica serotype Poona, S. enterica serotype Saphra, two strains of E. coli O157:H7, and two strains of L. monocytogenes were grown in tryptic soy broth (TSB) and TSB supplemented with 1% glucose for 24 h at 37 degrees C. Decimal reduction times (D values) of cells suspended in unpasteurized cantaloupe juice and watermelon juice were determined. Acid-adapted cells of Salmonella and E. coli O157:H7, but not L. monocytogenes, had increased thermal tolerance compared with cells that were not acid-adapted. There was no correlation between soluble solids content of the two types of juice and thermal resistance. Growth of Salmonella and E. coli O157:H7 in cantaloupe juice, watermelon juice, or other acidic milieu, either in preharvest or postharvest environments, may result in cross protection to heat. The pasteurization conditions necessary to achieve elimination of pathogens from these juices would consequently have to be more severe if cells are habituated to acidic environments. Insights from this study provide guidance to developing pasteurization processes to eliminate Salmonella, E. coli O157:H7, and L. monocytogenes in cantaloupe juice and watermelon juice.

  17. Injury and recovery of salmonella, Escherichia coli 0157:H7 and Listeria Monocytogenes on cantaloupe rind surfaces after hyrdogren peroxide and minimal thermal treatment

    Science.gov (United States)

    Introduction: Produce surface structures vary and complicate decontamination treatments for reducing attached bacteria. Purpose: The objective of this study on survival and recovery of injured population of Salmonella, Escherichia coli O157:H7 and Listeria monocytogenes on cantaloupe rind surfaces...

  18. Arsenic speciation in xylem sap of cucumber (Cucumis sativus L.)

    Energy Technology Data Exchange (ETDEWEB)

    Mihucz, Victor G. [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); Tatar, Eniko [Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Virag, Istvan [L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary); Cseh, Edit; Fodor, Ferenc [L. Eoetvoes University, Department of Plant Physiology, Budapest (Hungary); Zaray, Gyula [Joint Research Group of Environmental Chemistry of the Hungarian Academy of Sciences and L. Eoetvoes University, Budapest (Hungary); Hungarian Satellite Centre of Trace Elements Institute to UNESCO, Budapest (Hungary); L. Eoetvoes University, Department of Inorganic and Analytical Chemistry, Budapest (Hungary)

    2005-10-01

    Flow injection analysis (FIA) and high-performance liquid chromatography double-focusing sector field inductively coupled plasma mass spectrometry (HPLC-DF-ICP-MS) were used for total arsenic determination and arsenic speciation of xylem sap of cucumber plants (Cucumis sativus L.) grown in hydroponics containing 2 {mu}mol dm{sup -3} arsenate or arsenite, respectively. Arsenite [As(III)], arsenate [As(V)] and dimethylarsinic acid (DMA) were identified in the sap of the plants. Arsenite was the predominant arsenic species in the xylem saps regardless of the type of arsenic treatment, and the following concentration order was determined: As(III) > As(V) > DMA. The amount of total As, calculated taking into consideration the mass of xylem sap collected, was almost equal for both treatments. Arsenite was taken up more easily by cucumber than arsenate. Partial oxidation of arsenite to arsenate (<10% in 48 h) was observed in the case of arsenite-containing nutrient solutions, which may explain the detection of arsenate in the saps of plants treated with arsenite. (orig.)

  19. Inactivation of Salmonella enterica and Listeria monocytogenes in cantaloupe puree by high hydrostatic pressure with/without added ascorbic acid.

    Science.gov (United States)

    Mukhopadhyay, Sudarsan; Sokorai, Kimberly; Ukuku, Dike; Fan, Xuetong; Juneja, Vijay; Sites, Joseph; Cassidy, Jennifer

    2016-10-17

    The objective of this research was to evaluate and develop a method for inactivation of Salmonella enterica and Listeria monocytogenes in cantaloupe puree (CP) by high hydrostatic pressure (HHP). Cantaloupe being the most netted varieties of melons presents a greater risk of pathogen transmission. Freshly prepared CP with or without 0.1% ascorbic acid (AA) was inoculated with a bacterial cocktail composed of a three serotype mixture of S. enterica (S. Poona, S. Newport H1275 and S. Stanley H0558) and a mixture of three strains of L. monocytogenes (Scott A, 43256 and 51742) to a population of ca. 10(8)CFU/g. Double sealed and double bagged inoculated CP (ca. 5g) were pressure treated at 300, 400 and 500MPa at 8°C and 15°C for 5min. Data indicated increased inactivation of both Salmonella and Listeria spp. with higher pressure. Log reduction for CP at 300MPa, 8°C for 5min was 2.4±0.2 and 1.6±0.5logCFU/g for Salmonella and Listeria, respectively. Survivability of the pathogens was significantly compromised at 400MPa and 8°C, inactivating 4.5±0.3logCFU/g of Salmonella and 3.0±0.4logCFU/g of Listeria spp. Complete inactivation of the pathogens in the puree (log reduction >6.7logCFU/g), with or without AA, was achieved when the pressure was further increased to 500MPa, except that for Listeria containing no AA at 8°C. Listeria presented higher resistance to pressure treatment compared to Salmonella spp. Initial temperatures (8 and 15°C) had no significant influence on Salmonella log reductions. Log reduction of pathogens increased but not significantly with increase of temperature. AA did not show any significant antimicrobial activity. Viable counts were about 0.2-0.4logCFU/g less in presence of 0.1% AA. These data validate that HHP can be used as an effective method for decontamination of cantaloupe puree. Published by Elsevier B.V.

  20. Asynchronous meiosis in Cucumis hystrix-cucumber synthetic tetraploids resulting in low male fertility

    Science.gov (United States)

    Wide hybridization is an important tool for crop improvement. Recently, we successfully developed a synthetic allotetraploid from interspecific cross between cucumber and its relative Cucumis hystrix-(2n = 2x =24) followed by chemical induction of chromosome doubling. The resulting allotetraploid wa...

  1. Cucumber (Cucumis sativus L.) seed performance as influenced by ovary and ovule position

    NARCIS (Netherlands)

    Jing, H.C.; Jalink, H.; Bergervoet, J.W.; Klooster, M.; Du, S.L.; Bino, R.J.; Hilhorst, H.W.M.; Groot, S.P.C.

    2000-01-01

    The performance of cucumber (Cucumis sativus L.) seeds in relation to ovary and ovule position was monitored during seed production. Seeds from three (first, seventh and tenth nodes) fruit positions and three (stylar, intermediate and peduncular) ovule positions were harvested serially during

  2. Infraspecific variation of C-banded karyotype and chiasma frequency in Cucumis sativus (Cucurbitaceae)

    NARCIS (Netherlands)

    Ramachandran, C.; Brandenburg, W.A.; Nijs, de S.A.P.M.

    1985-01-01

    Infraspecific cytogenetical variation was studied in a diverse collection of five non-cultivated and cultivatedCucumis sativus accessions. The individual chromosomes of different accessions could be identified by the C-banding pattern and chromosome measurements. About 40–50% of the genomic area are

  3. Multispectral fluorescence imaging technique for discrimination of cucumber (Cucumis Sativus) seed viability

    Science.gov (United States)

    In this study, we developed a nondestructive method for discriminating viable cucumber (Cucumis sativus) seeds based on hyperspectral fluorescence imaging. The fluorescence spectra of cucumber seeds in the 420–700 nm range were extracted from hyperspectral fluorescence images obtained using 365 nm u...

  4. Comparison of the effect of saturated and superheated steam on the inactivation of Escherichia coli O157:H7, Salmonella Typhimurium and Listeria monocytogenes on cantaloupe and watermelon surfaces.

    Science.gov (United States)

    Kwon, Sun-Ah; Song, Won-Jae; Kang, Dong-Hyun

    2018-06-01

    The purpose of this study was evaluation of the effectiveness of superheated steam (SHS) on inactivation of foodborne pathogens on cantaloupes and watermelons. Saturated steam (SS) treatment was performed at 100 °C and that of SHS at 150 and 200 °C. Escherichia coli O157:H7, Salmonella Typhimurium and Listeria monocytogenes-inoculated cantaloupes and watermelons were exposed for a maximum of 30 s and 10 s, respectively. Populations of the three pathogens on cantaloupes and watermelons were reduced by more than 5 log after 200 °C steam treatment for 30 s and 10 s, respectively. After SHS treatment of cantaloupes and watermelons for each maximum treatment time, color and maximum load values were not significantly different from those of untreated controls. By using a noncontact 3D surface profiler, we found that surface characteristics, especially surface roughness, is the main reason for differences in microbial inactivation between cantaloupes and watermelons. The results of this study suggest that SHS treatment can be used as an antimicrobial intervention for cantaloupes and watermelons without inducing quality deterioration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. The Effect of Different Cucurbit Rootstocks on Some Morphological and Physiological Traits of Cucumber (Cucumis sativus cv. Super Dominus

    Directory of Open Access Journals (Sweden)

    reihane Mesgari

    2017-02-01

    Full Text Available Introduction: Cucumber is one of the most important vegetable crops for the local consumption and exportation. The use of grafted vegetable seedlings has been popular in many countries during recent years. Growing fruit-bearing vegetables, chiefly tomato, cucumber and watermelon through grafted seedlings become a widespread practice worldwide. Grafting is a valuable technique to avoid soil-borne diseases, provide biotic and abiotic stress tolerance, enhance nutrient uptake, optimize water use, and increase fruit yield and quality. Vegetable grafting is a new topic in Iran and there are a limited number of studies on grafted vegetable production. However, attention to grafting by researchers has recently increased. Suitable rootstocks should be identified and characterized for the effective utilization of grafting. The rootstock's vigorous root system increases the efficiency of water and nutrient absorption, and may also serve as a source of endogenous plant hormones, thus leading to increased growth and yield in addition to disease control. In the present study, we investigated the response of two Cucurbita sp. and an Iranian melon as rootstocks for cucumber. Materials and methods: In order to study the effect of cucurbit rootstocks and grafting method on growth, yield and fruit quality of cucumber (Cucumis sativus cv. Super Dominus, an experiment was conducted as a factorial design in the base of RCBD with three replications in the greenhouse and research farm, University of Zanjan. Treatments were included three rootstocks (Cucurbita moschata L., Lagenaria siceraria and Cucumis melo L. and ungrafted plants (control and two grafting method (hole insertion and splice grafting. Seeds were sown simultaneously in plastic pots. For obtaining the same stem diameter of scion and rootstocks, cucumber seeds were planted four days earlier than rootstocks seeds. The seedlings were grown in an environment-controlled greenhouse with 25/20 day

  6. Surface survival and internalization of salmonella through natural cracks on developing cantaloupe fruits, alone or in the presence of the melon wilt pathogen Erwinia tracheiphila.

    Directory of Open Access Journals (Sweden)

    Dhiraj Gautam

    Full Text Available Outbreaks of foodborne illness attributed to the consumption of Salmonella-tainted cantaloupe have occurred repeatedly, but understanding of the ecology of Salmonella on cantaloupe fruit surfaces is limited. We investigated the interactions between Salmonella enterica Poona, the plant pathogenic bacterium Erwinia tracheiphila, and cantaloupe fruit. Fruit surfaces were inoculated at the natural cracking stage by spreading S. enterica and E. tracheiphila, 20 µl at 107 cfu/ml, independently or together, over a 2×2 cm rind area containing a crack. Microbial and microscopic analyses were performed at 0, 9 and 24 days post inoculation (DPI. Even at 24 DPI (fruit maturity S. enterica was detected on 14% and 40% of the fruit inoculated with S. enterica alone and the two-pathogen mixture, respectively. However, the population of S. enterica declined gradually after initial inoculation. E. tracheiphila, inoculated alone or together with Salmonella, caused watersoaked lesions on cantaloupe fruit; but we could not conclude in this study that S. enterica survival on the fruit surface was enhanced by the presence of those lesions. Of fruit inoculated with E. tracheiphila alone and sampled at 24 DPI, 61% had watersoaked lesions on the surface. In nearly half of those symptomatic fruits the watersoaking extended into the sub-rind mesocarp, and E. tracheiphila was recovered from that tissue in 50% of the symptomatic fruit. In this work, E. tracheiphila internalized through natural cracks on developing fruits. S. enterica was never detected in the fruit interior (ca. 2-3 mm below rind surface under the limited conditions of our experiments, but the possibility that it, or other human pathogens that contaminate fresh produce, might also do so should be investigated under a wider range of conditions and produce types.

  7. Screening of Furanone in Cucurbita melo and Evaluation of its Bioactive Potential Using In Silico Studies.

    Science.gov (United States)

    Singh, Nidhi; Sudandiradoss, C; Abraham, Jayanthi

    2016-12-01

    The work presented here attempts to screen for the presence of 4-Hydroxy-2,5-dimethyl-3(2H)-furanone in fruits and also any bioactive potential present in the fruit extracts. Curcurbita melo was selected for the study, and the fruit was crushed, filtered and extracted with ethyl acetate as the solvent. The resulting extract was subjected to disk diffusion test using Kirby Bauer method for checking its antimicrobial potential. Melon extract showed promising results against different clinical pathogens, 19-mm zone being the largest against Klebsiella pneumoniae and 17 mm against Shigella dysenteriae. GC-MS data of the melon extract confirmed the existence of furanone derivative in the extract. To evaluate the antimicrobial activity, in silico studies were performed using AutoDock 4.0 software, and topoisomerase was used as the target protein molecule for the isolated compound and 3-methyl-2-(2-oxopropyl)furan as the ligand. Further, the results were interpreted using PyMol and Ligplot plus softwares. The results confirmed the presence of molecular interactions between the protein molecule and the ligand. It can be envisaged that these interactions are responsible for the inhibitory effects of the extract .

  8. O Sol Laranja e Negro de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Luciana Tiscoski

    2011-12-01

    Full Text Available O poeta pernambucano João Cabral de Melo Neto publica Sevilha andando em 1990, já aposentado da carreira diplomática que lhe possibilitou o contato com a cidade e o povo sevilhano, desde 1956, quando trabalha em pesquisas históricas no Arquivo das Índias de Sevilha. Após ter morado em cidades como Londres, Marselha e Barcelona, é transferido para a andaluza Cadiz, e novamente reside em Sevilha em 1962. Tendo ainda passado no decorrer de sua carreira diplomática por Berna, Senegal e Honduras, é a Andaluzia que se estabelece como lugar da linguagem poética e concreta, eleita Sevilha a cidade onde os elementos de sua poesia se realizam em lâmina, pedra, o sol laranja e negro, a mulher que anda. Sevilha andando e Andando Sevilha finalizam sua produção poética e reproduzem em serena e bruta semelhança o homem da terra que lhe remete ao sertanejo, a Pernambuco, a Recife.

  9. Chemical signature of two Permian volcanic ash deposits within a bentonite bed from Melo, Uruguay

    Directory of Open Access Journals (Sweden)

    Liane M. Calarge

    2006-09-01

    Full Text Available A Permian bentonite deposit at Melo, Uruguay is composed of a calcite-cemented sandstone containing clay pseudomorphs of glass shards (0-0.50 m overlying a pink massive clay deposit (0.50-2.10m. The massive bed is composed of two layers containing quartz and smectite or pure smectite respectively. The smectite is remarkably homogeneous throughout the profile: it is a complex mixed layer composed of three layer types whose expandability with ethylene glycol (2EG 1EG or 0EG sheets in the interlayer zone which correspond to low-, medium- and high-charge layers respectively varies with the cation saturating the interlayer zone. The smectite homogeneity through the profile is the signature of an early alteration process in a lagoonal water which was over saturated with respect to calcite. Compaction during burial has made the bentonite bed a K-depleted closed system in which diagenetic illitization was inhibited. Variations in major, REE and minor element abundances throughout the massive clay deposit suggest that it originated from two successive ash falls. The incompatible element abundances are consistent with that of a volcanic glass fractionated from a rhyolite magma formed in a subduction/collision geological context.Um depósito Permiano de bentonita em Melo, Uruguai,é composto por um arenito com cimento calcítico contendo pseudomorfos de argila sobre detritos vítreos(0-0.50 m superpostos a um deposito maciço de argila rosado (0.50-2.10 m. A camada maciça é composta por dois níveis contendo quartzo e esmectita ou esmectita pura, respectivamente. A homogeneidade de esmectita ao longo do perfil é notável: trata-se de um interestratificado composto de três tipos de camadas, cuja expansibilidade com etileno-glicol (folhas 2EG, 1EG ou 0EG na zona interfoliar correspondentes a camadas com baixa, média e alta carga, respectivamente variam com o tipo de cátion que satura a zona interfoliar. A homogeneidade da esmectita ao longo do perfil

  10. Marcas da violência e jogos do poder no romance urbano de Patrícia Melo

    Directory of Open Access Journals (Sweden)

    Cláudia Castanheira

    2010-01-01

    Full Text Available This work analyzes the romance O Matador (The Killer by Patrícia Melo. Its thematic universe and discursive strategies break not only with the prospects of the more contemporary feminist literary criticism, but also with the bourgeois ideological system, more broadly. The object is to highlight how the use of the male voice and masculine cultural experiences, taken to its ultimate consequences, may be converted into a subliminal criticism regarding the ways of how the discriminating speeches are built, through sexual, economic and social criteria in our society.

  11. Fatty acid composition and antioxidant activity of oils from two cultivars of Cantaloupe extracted by supercritical fluid extraction

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, M.; Mariod, A.; Bagalkotkar, G.; Ling, H. S

    2010-07-01

    The effect of supercritical fluid extraction (SFE) fractionation of three oil fractions (1st, 2nd, 3rd fraction) on the fatty acid composition and antioxidant activity of oils from two cultivars of cantaloupe were investigated. Rock melon oil (RMO) and Golden Langkawi oil (GLO) were extracted using SFE and the major fatty acids for both cultivars were linoleic, oleic, palmitic, and stearic acid. The SFA decreased from 15.78 to 14.14% in RMO 1st fraction, and MUFA decreased from 18.30 to 16.56% in RMO 2nd fraction, while PUFA increased from 65.9 to 69.30% in RMO 3rd fraction. On the other hand SFA decreased from 16.35 to 13.91% in GLO 1{sup s}t fraction, and MUFA decreased from 17.50 to 15.57% in GLO 2nd fraction, while PUFA increased from 66.15 to 70.52% in GLO 3rd fraction. The different fractions of the two oils showed high antioxidant activity in reducing the oxidation of {beta}-carotene in beta-carotene bleaching assay (BCB) and the quenching of 1,1-diphenyl-2-picrylhydrazyl (DPPH). (Author) 41 refs.

  12. Abatement of Cr (Ⅵ) from wastewater using a new adsorbent, cantaloupe peel: Taguchi L{sub 16} orthogonal array optimization

    Energy Technology Data Exchange (ETDEWEB)

    Ramavandi, Bahman [Bushehr University of Medical Sciences, Bushehr (Iran, Islamic Republic of); Asgari, Ghorban; Faradmal, Javad [Hamadan University of Medical Sciences, Hamadan (Iran, Islamic Republic of); Sahebi, Soleyman [University of Technology, Sydney (UTS), Sydney (Australia); Roshani, Babak [DelcoWater, Saskatoon (Canada)

    2014-12-15

    Taguchi orthogonal design was applied for multivariate optimization of Cr (Ⅵ) abatement by cantaloupe peel powder (CPP), as a novel adsorbent, from industrial wastewater in a batch mode. Effective factors in the adsorption process, such as temperature, CPP dose, Cr (Ⅵ) concentration, wastewater pH, and contact time, were considered using an L{sub 16} orthogonal array design. The best conditions for adsorbing of Cr (Ⅵ) were determined by the Taguchi method and desirability approach as pH of 2, chromium concentration of 100mg/L, contact time of 5min, CPP dosage of 0.5 g/L, and wastewater temperature of 25 .deg. C. Analysis of variance results indicated that the pH was the most important variable influencing the chromium removal percentage, and its contribution value was obtained 45.01%. The Langmuir model proved best fit for the experimental data and maximum adsorption capacity of Cr (Ⅵ) onto CPP was obtained 166.25mg/g. The final part of the study includes an examination of the CPP through an analysis of the removal of chromium from real industrial wastewater. It can be concluded that the CPP presents a promising and efficient alternative for eliminating of Cr (Ⅵ) from industrial wastewaters.

  13. Effect of Dipping and Vacuum Impregnation Coating Techniques with Alginate Based Coating on Physical Quality Parameters of Cantaloupe Melon.

    Science.gov (United States)

    Senturk Parreidt, Tugce; Schmid, Markus; Müller, Kajetan

    2018-04-01

    Edible coating based on sodium alginate solution was applied to fresh-cut cantaloupe melon by dipping and vacuum impregnation coating methods. One aim of this work is to produce more technical information concerning these conventional and novel coating processes. For this purpose, the effect of various coating parameters (dipping time, draining time, time length of the vacuum period, vacuum pressure, atmospheric restoration time) with several levels on physical quality parameters (percentage of weight gain, color, and texture) of noncoated and coated samples were determined in order to define adequate coating process parameters to achieve a successful coating application. Additionally, the effects of dipping and vacuum impregnation processes were compared. Both processes improved the firmness of the melon pieces. However, vacuum impregnation application had higher firmness and weight gain results, and had significant effect (P coating technique and the parameters used significantly affect the physical quality characteristics of coated food products. The work presented produced more technical information concerning dipping and vacuum impregnation coating techniques, along with evaluating the effects of various coating parameters with several levels. The results revealed that vacuum impregnation technique is a successful coating method; however the effects should be carefully assessed for each product. © 2018 Institute of Food Technologists®.

  14. Efecto de la aplicación de bioactivadores y del raleo manual de frutos sobre el rendimiento y la calidad de melón (Cucumis melo L. bajo cultivo protegido en Costa Rica

    Directory of Open Access Journals (Sweden)

    Tania Alvarado-Sánchez

    2015-12-01

    Full Text Available Se evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobre el rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para el número de frutos por planta; las plantas tratadas con solo Engordone y solo Algamix presentaron mayor número de frutos por planta con respecto a otros tratamientos, pero estos resultados no fueron distintos de los del Testigo. Se encontraron diferencias significativas al distribuir la producción según distintas categorías de peso; el rendimiento de frutos de melón con un peso de entre 601-800 gramos fue superior en plantas tratadas con solo Algamix respecto a los demás tratamientos; el rendimiento de frutos de melón con un peso de entre 801-1000 gramos fue superior en plantas tratadas con solo Engordone respecto a los demás tratamientos.

  15. Efecto de la aplicación de bioactivadores y del raleo manual de frutos sobre el rendimiento y la calidad de melón (Cucumis melo L .) bajo cultivo protegido en Costa Rica

    OpenAIRE

    Alvarado-Sánchez, Tania; Monge-Pérez, José Eladio

    2015-01-01

    ResumenSe evaluó el efecto del raleo manual de frutos y de la aplicación de los bioactivadores Algamix y Engordone sobreel rendimiento y la calidad del melón amarillo var. JMX-902. No se encontraron diferencias significativas con respecto a la firmeza del fruto, concentración de sólidos solubles totales, peso del fruto, rendimiento total, peso del fruto comercializable, rendimiento comercializable, y rendimiento por planta. Se encontraron diferencias significativas entre los tratamientos para...

  16. Identificação de marcadores moleculares ligados a gene de resistência ao vírus do mosaico (PRSV-W) em melão (Cucumis melo L.).

    OpenAIRE

    Ana Paula Matoso Teixeira

    2004-01-01

    A importância da cultura do meloeiro é crescente no Brasil, sobretudo na região Nordeste, tanto pelo volume comercializado como por ser estabelecida geralmente em pequenas propriedades. Diversas enfermidades acometem esta cultura, destacando-se as viroses. Dentre estas, o mosaico, causado pelo Papaya ringspot virus - estirpe melancia (PRSV-W) é das mais importantes. Dentre as estratégias de controle desta doença, o emprego de cultivares resistentes apresenta-se como um método prático e ...

  17. Protein (Viridiplantae): 832567 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available NYNSMNASIEIKQQESCQTNINHESCMFSKCMGGMQRFAIPPLPSFEVEQLNVVQGSRHCLSPHFQNSLVTFISYQKEKES... ... 1003877:124 ... 3655:124 ... 3656:1142 ... PREDICTED: transcription factor bHLH143-like Cucumis melo MVGTDTWQLH

  18. Protein (Viridiplantae): 128519 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 9:7 3650:7 ... 1003877:7 ... 3655:7 ... 3656:1095 ... PREDICTED: pectinesterase inhibitor-like Cucumis melo MANNSCLV...IVSLIGVLLFTIILNVASSNYVISTICSKSSNPPFCSSVLKSSGTTYLKGLAVYTLNLAHTNASKSLTLARSLATTTTNPQ

  19. Una nueva especie de Meloe Linnaeus, 1758 del suroeste de Marruecos incluida en el grupo de M. (Eurymeloe rugosus Marsham, 1802 (Coleoptera: Meloidae

    Directory of Open Access Journals (Sweden)

    Ruiz, José L.

    2015-06-01

    Full Text Available The scientific collections of the Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid hold an extense set of entomological materials collected in Morocco along the first decades of the XXth century by the preeminent naturalist M. Martínez de la Escalera. Morphological studies of the specimens of the genus Meloe Linnaeus, 1758 (Coleoptera: Meloidae reveals the existence of populations morphologically differentiated along the coastal regions of Essaouira and Ifni. These populations are included within the Meloe rugosus Marsham, 1802 species group in the subgenus Eurymeloe Reitter, 1911. Their differential traits with respect to all other North African and European species of the Meloe rugosus species group are constant, and permit considering these populations as a taxonomic independent unit described herein, Meloe baamarani n. sp. This new species is characterized by having a black, opaque, general coloration all over the body and appendages; black short vestiture; broad head with broadly rounded temples, without median longitudinal groove; long antennae, with segments III to VIII subcylindrical and longer than wide; pronotum transverse, with convergent sides toward the base, without median groove; head and pronotum punctuation dense; aedeagus narrow, median lobe wide and strong, dorsally sinuous, with ventral hooks close to the apex. Meloe baamarani can be only confused on the western regions of northern Africa with Meloe mediterraneus Müller, 1925. This species shares a general appearance with M. baamarani, but differs in many morphological traits. Among those, tegument micro-reticulation, absence of median groove along the head, pronotum morphology and macrosculpture, and configuration of the male genitalia, are included.Las colecciones científicas del Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid albergan un extenso material entomológico recogido en Marruecos a principios del siglo XX por el insigne naturalista M. Mart

  20. Cytoprotection mediated antiulcer effect of aqueous fruit pulp extract of Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Swapnil Sharma

    2012-05-01

    Full Text Available Objective: The study was aimed to evaluate the gastroprotective potential of Cucumis Sativus fruit pulp aqueous extract (CSE in gastric ulcerated rats. Methods: Cytoprotective potential was evaluated via oral administration of CSE at the doses of 250, 500 &1000 mg/kg three times in a day, for 5 days before the induction of ulcers in indomethacin and pyloric ligation induced ulcer model. Further, its effects were studied on various parameters volume of gastric juice, pH, free and total acidity, protein concentration, acid output in gastric juice, lipid peroxide (LPO, and activities of enzymic antioxidants-super oxide dismutase (SOD and catalase (CAT in gastric mucosa. The levels of hexose, hexosamine, sialic acid, fucose in gastric mucosa and gastric juice were also examined. The extent of healing was also determined with post administration of CSE at the same doses & dosage schedule in acetic acid induced model. Results: In indomethacin and pyloric ligation model, the pretreatment with CSE and ranitidine significantly reduced the lesion index, in comparison with control treated group (P< 0.05. The percentages of protection of ulcers were 25.8, 65.7, 80.6 & 93.8 for the treated groups of CSE and ranitidine whereas in pyloric ligation it was 31.26, 55.18, 93.26 & 95.51 respectively. In pyloric ligation model, CSE resulted in significant increase in pH, enzymic antioxidants i.e. SOD & CAT, with a significant decrease in volume of gastric juice, free and total acidity, protein & carbohydrate concentration and LPO levels. In acetic acid inducer model, treatment with Cucumis sativus (CSE caused significant reduction in lesion index in when compared to control treated group, providing evidence for ulcer healing capacity of it. The presence of the flavonoids and polyphenols may be responsible for the gastroprotective effect of CSE. Conclusions: The aqueous fruit pulp extract of Cucumis sativus (CSE has a gastroprotective property.

  1. Sterilization of DACUS CUCUMIS FRENCH (DIPTERA:TEPHRITIDAE) by gamma radiation

    International Nuclear Information System (INIS)

    Hooper, G.H.S.

    1975-01-01

    The effect of gamma radiation administered to newly emerged adults of Dacus cucumis French on sterility and competitiveness was evaluated. A dose of 11 krad caused almost complete sterility in males while females given 6 krad were totally sterile, through infecundity. Sterilized males showed reduced competitiveness. In competitive mating tests a dose of 7 krad gave the lowest egg hatch and this hatch was significantly lower than that given by 9 and 11 krad. In a paired comparison mating test, 7 and 9 krad treated males mated significantly less frequently than untreated males, but the ability of 6 krad treated males was unimpared. (author)

  2. PRODUÇÃO E QUALIDADE DE MELÃO CANTALOUPE CULTIVADO COM Á-GUA DE DIFERENES NÍVEIS DE SALINIDADE

    Directory of Open Access Journals (Sweden)

    DAMIANA CLEUMA DE MEDEIROS

    2011-01-01

    Full Text Available In recent years an increase of 15 to 20% occurred in market share melons like Cantaloupes group, which present more attractive organoleptic characteristics and higher commercial value. However it needs more care in production due its higher sensitivity to soil salinity. Effects of soil and water salinity are among the main limiting factors to melon yield and quality at Rio Grande do Norte Sate, Brazil. This work was carried out with the objective of studying the effect of different irrigation water salinity levels on yield and quality of cantaloupe hybrid 'Sedna'. Experimental design was a randomized complete blocks with four replications. Treatments consisted of five salt concentrations in irrigation water (0.54; 1.48; 2.02; 3.03 and 3.9 dS m-1. Yield and quality characteristics evaluated were: number of marketable fruits per plant, yield of marketable fruits, mean weight of fruits, soluble solids content (SS and pulp firmness. An increase on irrigation water salinity level negatively influenced yield of melon hybrid 'Sedna'. Yield loss in response to salinity was due to decrease in number of fruits per plant. Mean values of soluble solids and pulp firmness were not influenced by irrigation water salinity.

  3. Purification and MIC analysis of antimicrobial proteins from Cucumis sativus L. seeds.

    Science.gov (United States)

    Al Akeel, Raid; Mateen, Ayesha; Alharbi, Khalid K; Alyousef, Abdullah A; Al-Mandeel, Hazem M; Syed, Rabbani

    2018-04-03

    Cucumis sativus L. (cucumber), from the family Cucurbitaceae, is a therapeutic plant with various pharmacological benefits, broadly utilized as a part of complementary medicine (e.g., Unani, Ayurveda, Siddha, and Traditional Chinese). In light of past research discoveries, this plant had been chosen to consider its potential antibacterial action. Extracts were purified by dialysis and ion exchange chromatography strategy and then assayed for antibacterial activity against four standard pathogenic bacterial strains known to cause foodborne infections and spoilage of food and herbal drugs. Antimicrobial peptides were extracted from seeds using a sodium phosphate citrate (pH 7.2) - CTAB cradle (pH 6.0). The highest protein concentration was seen with elute fractions 1 and 3 (370 mg/mL) compared with elute fractions 2 and 4 (340 mg/mL). Among the bacteria utilized, E. coli was clearly the most sensitive out of selected four strains. Our results suggest that Cucumis sativus L seeds extracts have significant potentials as new antimicrobial agents.

  4. Use of molecular markers aids in the development of diverse inbred backcross lines in Beit Alpha cucumber (Cucumis sativus L.)

    Science.gov (United States)

    Beit Alpha cucumber (Cucumis sativus L.) is a Mediterranean fresh-market type with a relatively narrow genetic base. To broaden its base for plant improvement, 42 diverse accessions were compared employing a previously defined standard marker array to choose wide-based parental lines for use in bac...

  5. Genome-wide characterization of microsatellites in Cucumis hystrix and in silico identification of polymorphic SSR markers

    Science.gov (United States)

    Cucumis hystrix (2n = 2x = 24, genome HH) is a wild relative of cucumber (C. sativus L., 2n = 2x = 14) that possesses multiple disease resistances and has a great potential for cucumber improvement. Despite its importance, there is no genomic resource currently available for C. hystrix. To expedite ...

  6. First report of powdery mildew on cucumis zambianus, cucurbita digitata and zehneria scabraCaused by podosphaera xanthii

    Science.gov (United States)

    Powdery mildew is a serious disease of cucurbit crops worldwide. In the fall of 2016, symptoms of powdery mildew were observed on 2-month old plants of Cucumis zambianus, Cucurbita digitata and Zehneria scabra in research plots in Charleston, SC. Incidence on 28 plants of C. zambianus was 64.3%. On ...

  7. Investigation of the Use of "Cucumis Sativus" for Remediation of Chromium from Contaminated Environmental Matrices: An Interdisciplinary Instrumental Analysis Project

    Science.gov (United States)

    Butler, Lynsey R.; Edwards, Michael R.; Farmer, Russell; Greenly, Kathryn J.; Hensler, Sherri; Jenkins, Scott E.; Joyce, J. Michael; Mann, Jason A.; Prentice, Boone M.; Puckette, Andrew E.; Shuford, Christopher M.; Porter, Sarah E. G.; Rhoten, Melissa C.

    2009-01-01

    An interdisciplinary, semester-long project is presented in which students grow Cucumis sativus (cucumber) plants from seeds and study the ability of the plants to remediate a heavy metal from contaminated soil or water or both. Phytoremediation strategies for environmental cleanup are presented as possible alternatives to chemical based clean-up…

  8. The Effect of Microwave Radiation on Prickly Paddy Melon (Cucumis myriocarpus

    Directory of Open Access Journals (Sweden)

    Graham Brodie

    2012-01-01

    Full Text Available The growing list of herbicide-resistant biotypes and environmental concerns about chemical use has prompted interest in alternative methods of managing weeds. This study explored the effect of microwave energy on paddy melon (Cucumis myriocarpus plants, fruits, and seeds. Microwave treatment killed paddy melon plants and seeds. Stem rupture due to internal steam explosions often occurred after the first few seconds of microwave treatment when a small aperture antenna was used to apply the microwave energy. The half lethal microwave energy dose for plants was 145 J/cm2; however, a dose of at least 422 J/cm2 was needed to kill seeds. This study demonstrated that a strategic burst of intense microwave energy, focused onto the stem of the plant is as effective as applying microwave energy to the whole plant, but uses much less energy.

  9. Effects of UV-B irradiation on photomovement in the desmid, Cosmarium cucumis

    International Nuclear Information System (INIS)

    Haeder, D.-P.

    1987-01-01

    Monochromatic UV-B irradiation affects neither the absorption nor the fluorescence of the bulk pigments in the desmid Cosmarium cucumis but it impairs photomovement of these organisms at fluence rates which are not higher than the ambient level of solar UV-B irradiation. Photoaccumulations and phototaxis are strongly inhibited especially at wavelengths <= 300 nm while photodispersal at higher white light fluence rates is hardly affected by supplementary UV-B. This effect has important consequences for the growth and survival of populations in their natural environment: these photosynthetic organisms utilize photomovement to find and stay in areas of suitable visible light fluence rates. The UV-B component of solar irradiation both impairs the strategy of the organisms to find a suitable position and the escape mechanism by which the cells move out of areas with too strong white illuminances which photooxidize the bulk pigments and bleach the population within a few days. (author)

  10. Assessment of Salicylic Acid Impacts on Seedling Characteristic of Cucumber (Cucumis sativus L. under Water Stress

    Directory of Open Access Journals (Sweden)

    Hossein MARDANI

    2012-02-01

    Full Text Available Impacts of various concentrations of salicylic acid (SA on cucumber (Cucumis sativus L. seedling characteristic were evaluated under different water stress levels by using a factorial arrangement based on completely randomized design with three replications at experimental greenhouse of Ferdowsi University of Mashhad, Iran. The studied factors included three water deficit levels (100% FC, 80% FC, and 60% FC considered as first factor and five levels of SA concentrations (0, 0.25, 0.5, 0.75, and 1 mM as second factor. Results showed that foliar application of SA at the highest concentration enhanced leaf area, leaf and dry weight while decreased stomatal conductance under high level of water deficit stress. Though, severe water deficit stress sharply raised the SPAD reading values. In general, exogenous SA application could develop cucumber seedling characteristic and improve water stress tolerance.

  11. Cucurbita spp. and Cucumis sativus enhance the dissipation of polychlorinated biphenyl congeners by stimulating soil microbial community development.

    Science.gov (United States)

    Qin, Hua; Brookes, Philip C; Xu, Jianming

    2014-01-01

    A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%-42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G(-)) bacteria were significantly correlated with PCB degradation rates (R(2) = 0.719, p Cucurbita related soil microorganisms could play an important role in remediation of PCB contaminated soils. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. A Dual Filtration-Based Multiplex PCR Method for Simultaneous Detection of Viable Escherichia coli O157:H7, Listeria monocytogenes, and Staphylococcus aureus on Fresh-Cut Cantaloupe.

    Directory of Open Access Journals (Sweden)

    Ke Feng

    Full Text Available Fresh-cut cantaloupe is particularly susceptible to contamination with pathogenic bacteria, such as Escherichia coli O157:H7, Listeria monocytogenes, and Staphylococcus aureus. Therefore, development of rapid, yet accurate detection techniques is necessary to ensure food safety. In this study, a multiplex PCR system and propidium monoazide (PMA concentration were optimized to detect all viable pathogens in a single tube. A dual filtration system utilized a filtration membrane with different pore sizes to enrich pathogens found on fresh-cut cantaloupe. The results revealed that an optimized multiplex PCR system has the ability to effectively detect three pathogens in the same tube. The viable pathogens were simultaneously detected for PMA concentrations above 10 μg/ml. The combination of a nylon membrane (15 μm and a micro pore filtration membrane (0.22 μm formed the dual filtration system used to enrich pathogens. The achieved sensitivity of PMA-mPCR based on this dual filtration system was 2.6 × 103 cfu/g for L. monocytogenes, 4.3 × 10 cfu/g for E. coli O157:H7, and 3.1 × 102 cfu/g for S. aureus. Fresh-cut cantaloupe was inoculated with the three target pathogens using concentrations of 103, 102, 10, and 1 cfu/g. After 6-h of enrichment culture, assay sensitivity increased to 1 cfu/g for each of these pathogens. Thus, this technique represents an efficient and rapid detection tool for implementation on fresh-cut cantaloupe.

  13. The preface by João Cabral de Melo Neto to Em Va Fer Joan Brossa: Theory and practice of realism in two poets from the post-war.

    Directory of Open Access Journals (Sweden)

    Melcion Mateu

    2009-12-01

    Full Text Available In 1951, the book Em va fer Joan Brossa [Joan Brossa  Made me] was published in Barcelona, with a preface by João Cabral de Melo Neto. It is a useful text to better understand Brossa as well as Cabral; it is a significant text in order to grasp the individual response of these poets to the problem of returning to realism for the early post-war period. A translation of João Cabral de Melo Neto's preface, previously unpublished in Portuguese, is presented here.

  14. Raman Imaging of Plant Cell Walls in Sections of Cucumis sativus.

    Science.gov (United States)

    Zeise, Ingrid; Heiner, Zsuzsanna; Holz, Sabine; Joester, Maike; Büttner, Carmen; Kneipp, Janina

    2018-01-25

    Raman microspectra combine information on chemical composition of plant tissues with spatial information. The contributions from the building blocks of the cell walls in the Raman spectra of plant tissues can vary in the microscopic sub-structures of the tissue. Here, we discuss the analysis of 55 Raman maps of root, stem, and leaf tissues of Cucumis sativus , using different spectral contributions from cellulose and lignin in both univariate and multivariate imaging methods. Imaging based on hierarchical cluster analysis (HCA) and principal component analysis (PCA) indicates different substructures in the xylem cell walls of the different tissues. Using specific signals from the cell wall spectra, analysis of the whole set of different tissue sections based on the Raman images reveals differences in xylem tissue morphology. Due to the specifics of excitation of the Raman spectra in the visible wavelength range (532 nm), which is, e.g., in resonance with carotenoid species, effects of photobleaching and the possibility of exploiting depletion difference spectra for molecular characterization in Raman imaging of plants are discussed. The reported results provide both, specific information on the molecular composition of cucumber tissue Raman spectra, and general directions for future imaging studies in plant tissues.

  15. Somatic embryogenesis and plant regeneration from cell suspension cultures of Cucumis sativus L.

    Science.gov (United States)

    Chee, P P; Tricoli, D M

    1988-06-01

    A procedure for the regeneration of whole cucumber plants (Cucumis sativus L. cv. Poinsett 76) by embryogenesis from cell suspension cultures is described. Embryogenic callus was initiated from the primary leaves of 14-17 day old plants. Suspension cultures of embryogenic cells were grown in liquid Murashige and Skoog basal medium containing 5 uM 2,4,5-trichlorophenoxyacetic acid and 4 uM 6-benzylaminopurine. Suspension cultures were composed of a population of cells that were densely cytoplasmic and potentially embryogenic. Differentiation of embryos was enhanced by washing the suspension culture cells with MS basal medium containing 0.5% activated charcoal and twice with MS basal medium followed by liquid shake cultures in MS basal medium. Sixty to 70 percent of the embryos prewashed with activated charcoal germinated into plantlets with normal morphology. Embryos obtained from suspension cultured cells without prewashing with activated charcoal organized into plantlets with abnormal primary leaves. Morphologically normal plantlets were obtained by excising the shoot tips and transferring them to fresh medium.

  16. INFLUENCIA DE LA DENSIDAD DE SIEMBRA Y LA PODA EN EL CULTIVO DEL PEPINO (Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Paublo Javier Bravo Bravo

    2011-12-01

    Full Text Available El objetivo de la investigación fue determinar la influencia de la densidad de siembra y el número de poda de ejes en el cultivo de pepino (Cucumis sativus. Se estudiaron tres distancias de siembra 1.0x0.2, 1.0x0.4 y 1.0x 0.6 m y la poda de ejes productivos dejando 1, 2 y 3 ejes por planta. La poda se realizó a los 30 días después del trasplante. Se evaluaron las características del fruto de diámetro (cm, longitud (cm, peso (g, fruto por planta y rendimiento por hectárea. Los tratamientos se distribuyeron en un diseño de bloques al azar y los datos se analizaron mediante análisis de varianza. Se obtuvo diferencias para la variable rendimiento/hectárea con respecto al resto de las variables evaluadas.

  17. MENTIMUN(Cucumis Sativus L DI DESA TIRTA MULYA KECAMATAN MAKARTI JAYA KABUPATEN BANYUASIN II

    Directory of Open Access Journals (Sweden)

    Irham Falahudin

    2015-08-01

    Full Text Available Cucumber plants (Cucumis sativus L. that includes or creeping vines and is one type of vegetable-fruit of the gourd family labuan (Cucurbitaceae that has been popular throughout the world and favored from Asia. Cucumber cultivation in Indonesia, found almost in every region, ranging from lowland to highland hot climate (tropical and moderate. One animal that has an abundant amount in cucumber plants are insects. This study aims to know the different types of species that exist on the Order Coleoptera cucumber farm in the village of Tirta Mulya District of makarti Jaya Banyuasin II and determine the role of the Order Coleoptera insects on cucumber plantations in the village of Tirta Mulya District of makarti Jaya Banyuasin II. This is a qualitative study conducted in October-November 2014 held in Cucumber Plants in the village of Tirta Mulya District of makarti Jaya Banyuasin II. Catching insects done using transect method and pitfall traps such as sweeping the net, pit fall traps and light traps, results in identification in the laboratory penelitanya UIN Raden Fatah Palembang. The results of this study indicate that insects are caught in a cucumber plantation obtained as many as 113 individual 3 families and 7 species. Insects which dominates in the village of Tirta Mulya District of makarti Jaya Banyuasin II is Cocinella repanda, Curinus coeruleus, Coelophora inaequalis, and Aulacophora similis, and insects that have the fewest number is Micraspis discolor, Micraspis vincta and Oryctes rhinoceros. The role of the Order Coleoptera Insects in general predators of the family Coccinellidae to eradicate mites while the family Chrysomelidae Scarabacidae and are pests that attack on cucumber plants that can cause death.

  18. Cucumis sativus Aqueous Fraction Inhibits Angiotensin II-Induced Inflammation and Oxidative Stress In Vitro

    Directory of Open Access Journals (Sweden)

    Celeste Trejo-Moreno

    2018-02-01

    Full Text Available Inflammation and oxidative stress play major roles in endothelial dysfunction, and are key factors in the progression of cardiovascular diseases. The aim of this study was to evaluate in vitro the effect of three subfractions (SFs from the Cucumis sativus aqueous fraction to reduce inflammatory factors and oxidative stress induced by angiotensin II (Ang II in human microvascular endothelial cells-1 (HMEC-1 cells. The cells were cultured with different concentrations of Ang II and 0.08 or 10 μg/mL of SF1, SF2, or SF3, or 10 μmol of losartan as a control. IL-6 (Interleukin 6 concentration was quantified. To identify the most effective SF combinations, HMEC-1 cells were cultured as described above in the presence of four combinations of SF1 and SF3. Then, the effects of the most effective combination on the expression of adhesion molecules, the production of reactive oxygen species (ROS, and the bioavailability of nitric oxide (NO were evaluated. Finally, a mass spectrometry analysis was performed. Both SF1 and SF3 subfractions decreased the induction of IL-6 by Ang II, and C4 (SF1 and SF3, 10 μg/mL each was the most effective combination to inhibit the production of IL-6. Additionally, C4 prevented the expression of adhesion molecules, reduced the production of ROS, and increased the bioavailability of NO. Glycine, arginine, asparagine, lysine, and aspartic acid were the main components of both subfractions. These results demonstrate that C4 has anti-inflammatory and antioxidant effects.

  19. Boron toxicity is alleviated by hydrogen sulfide in cucumber (Cucumis sativus L.) seedlings.

    Science.gov (United States)

    Wang, Bao-Lan; Shi, Lei; Li, Yin-Xing; Zhang, Wen-Hao

    2010-05-01

    Boron (B) is an essential micronutrient for plants, which when occurs in excess in the growth medium, becomes toxic to plants. Rapid inhibition of root elongation is one of the most distinct symptoms of B toxicity. Hydrogen sulfide (H(2)S) is emerging as a potential messenger molecule involved in modulation of physiological processes in plants. In the present study, we investigated the role of H(2)S in B toxicity in cucumber (Cucumis sativus) seedlings. Root elongation was significantly inhibited by exposure of cucumber seedlings to solutions containing 5 mM B. The inhibitory effect of B on root elongation was substantially alleviated by treatment with H(2)S donor sodium hydrosulfide (NaHS). There was an increase in the activity of pectin methylesterase (PME) and up-regulated expression of genes encoding PME (CsPME) and expansin (CsExp) on exposure to high B concentration. The increase in PME activity and up-regulation of expression of CsPME and CsExp induced by high B concentration were markedly reduced in the presence of H(2)S donor. There was a rapid increase in soluble B concentrations in roots on exposure to high concentration B solutions. Treatment with H(2)S donor led to a transient reduction in soluble B concentration in roots such that no differences in soluble B concentrations in roots in the absence and presence of NaHS were found after 8 h exposure to the high concentration B solutions. These findings suggest that increases in activities of PME and expansin may underlie the inhibition of root elongation by toxic B, and that H(2)S plays an ameliorative role in protection of plants from B toxicity by counteracting B-induced up-regulation of cell wall-associated proteins of PME and expansins.

  20. Boron excess affects photosynthesis and antioxidant apparatus of greenhouse Cucurbita pepo and Cucumis sativus.

    Science.gov (United States)

    Landi, Marco; Remorini, Damiano; Pardossi, Alberto; Guidi, Lucia

    2013-11-01

    This study aimed to evaluate the behavior of zucchini (Cucurbita pepo L.) and cucumber (Cucumis sativus L.) under boron (B) excess. Plants were grown under greenhouse conditions in a sandy soil-peat mixture using a nutrient solution containing 0.2 (control), 10 and 20 mg L(-1) B. Visible symptoms were quantified and leaf B accumulation, gas exchanges, chlorophyll (Chl) a fluorescence, malondialdehyde by-products and antioxidants were investigated 20 days after the beginning of the treatments. Boron toxicity induced oxidative load and leaf necrotic burns coupled with the reduction of leaf growth and biomass accumulation in both species. Boron excess resulted in a decrease of Chl a/b ratio, potential (Fv/Fm) and actual (ΦPSII) PSII quantum efficiency, photosynthetic rate (Pn), stomatal conductance (gs), and transpiration (E) as well. A general stimulation of the antioxidant enzymes ascorbate peroxidase, catalase and superoxide dismutase was observed, and a significant increase in the oxidized form of ascorbate and glutathione was evidenced for treated plants of both species. A difference between the two species was observed: C. pepo appeared to be more sensitive to B stress being damaged at all B concentration. C. sativus grown at 10 mg L(-1) B in nutrient solution showed some down-regulated mechanisms, i.e. increase in Chl b content and a good photochemical PSII efficiency as well as a higher amount of constitutive antioxidant molecules, that, however, are not sufficient to contrast the negative effects of B.

  1. Silicon improves salt tolerance by increasing root water uptake in Cucumis sativus L.

    Science.gov (United States)

    Zhu, Yong-Xing; Xu, Xuan-Bin; Hu, Yan-Hong; Han, Wei-Hua; Yin, Jun-Liang; Li, Huan-Li; Gong, Hai-Jun

    2015-09-01

    Silicon enhances root water uptake in salt-stressed cucumber plants through up-regulating aquaporin gene expression. Osmotic adjustment is a genotype-dependent mechanism for silicon-enhanced water uptake in plants. Silicon can alleviate salt stress in plants. However, the mechanism is still not fully understood, and the possible role of silicon in alleviating salt-induced osmotic stress and the underlying mechanism still remain to be investigated. In this study, the effects of silicon (0.3 mM) on Na accumulation, water uptake, and transport were investigated in two cucumber (Cucumis sativus L.) cultivars ('JinYou 1' and 'JinChun 5') under salt stress (75 mM NaCl). Salt stress inhibited the plant growth and photosynthesis and decreased leaf transpiration and water content, while added silicon ameliorated these negative effects. Silicon addition only slightly decreased the shoot Na levels per dry weight in 'JinYou 1' but not in 'JinChun 5' after 10 days of stress. Silicon addition reduced stress-induced decreases in root hydraulic conductivity and/or leaf-specific conductivity. Expressions of main plasma membrane aquaporin genes in roots were increased by added silicon, and the involvement of aquaporins in water uptake was supported by application of aquaporin inhibitor and restorative. Besides, silicon application decreased the root xylem osmotic potential and increased root soluble sugar levels in 'JinYou 1.' Our results suggest that silicon can improve salt tolerance of cucumber plants through enhancing root water uptake, and silicon-mediated up-regulation of aquaporin gene expression may in part contribute to the increase in water uptake. In addition, osmotic adjustment may be a genotype-dependent mechanism for silicon-enhanced water uptake in plants.

  2. Uptake and/or utilization of two simple phenolic acids by Cucumis sativus

    International Nuclear Information System (INIS)

    Shann, J.R.

    1986-01-01

    The uptake of ferulic acid (FA) and p-hydroxybenzoic acid (p-HBA) from solutions (0.1 to 1.00 mM, pH 4.0 to 7.0), was determined for intact and excised roots of Cucumis sativus. Uptake methods based on high performance liquid chromatographic (HPLC) analysis of phenolic acid depletion from solution were compared to those radioisotopic methods employing [U-ring- 14 C]FA or p-HBA. Although radiotracer methods more accurately reflected actual uptake of the compounds by cucumber seedlings, HPLC solution depletion methods may be useful in the elucidation of trends over very limited periods of time. The uptake of FA was unaffected by the presence of p-HBA. The uptake of p-HBA was reduced by 30% in the presence of FA when compared to the uptake from solutions containing p-HBA alone. Ferulic acid acts both as an allelopathic agent and precursor in the endogenous process of lignification. To evaluate the involvement of exogenous FA in lignin biosynthesis, roots of hydroponically grown cucumber seedlings were exposed to concentrations of FA labeled with [U-ring- 14 C]FA. Radiotracer was distributed throughout the seedling. A quantitative change in lignification occurred in treated seedlings. In roots and stems, the level of lignin increased with the number of exposures and as the concentrations of exogenous FA increased. Radiotracer was found in the residues of lignin isolated from seedling tissue treated with [U-ring- 14 C]FA. This suggested the utilization of the exogenously applied FA in the endogenous process of lignification

  3. Occidental diffusion of cucumber (Cucumis sativus) 500–1300 CE: two routes to Europe

    Science.gov (United States)

    Paris, Harry S.; Daunay, Marie-Christine; Janick, Jules

    2012-01-01

    Background The cucumber, Cucumis sativus, is one of the most widely consumed fruit vegetables the world over. The history of its dispersal to the Occident from its centre of origin, the Indian subcontinent, has been incorrectly understood for some time, due to the confusion of cucumbers with vegetable melons. Iconographic and literary evidence has shown that cucumber was absent in Roman times, up to 500 CE, but present in Europe by late medieval times, 1300. The objective of the present investigation was to determine more accurately when the cucumber arrived in Europe and by what route. Findings and Conclusions The evidence for the movement of C. sativus westward is entirely lexicographical until the 10th century. Syriac, Persian and Byzantine Greek sources suggest the presence of cucumbers, to the east and north-east of the Mediterranean Sea (modern Iran, Iraq and Turkey), by the 6th or 7th century. Arabic medical writings suggest the presence of cucumbers in Spain as early as the mid-9th century and in Tunisia by the early 10th century. Descriptive evidence in Arabic establishes the presence of cucumbers in Andalusia by the second half of the 10th century. Latin translations from Arabic sources indicate the presence of cucumbers in southern Italy by the second half of the 11th century. These writings, together with lexicographical discrepancies in names of cucurbits in late medieval Latin writings, suggest that cucumber was introduced to Europe by two independent diffusions. One diffusion appears to have been overland from Persia into eastern and northern Europe and preceded the Islamic conquests. The other, subsequent diffusion into western and southern Europe, was probably by a mostly maritime route from Persia or the Indian subcontinent into Andalusia. PMID:22104164

  4. Equilibrium and Kinetics Study of Adsorption of Crystal Violet onto the Peel of Cucumis sativa Fruit from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    T. Smitha

    2012-01-01

    Full Text Available The use of low-cost, locally available, high efficiency and eco-friendly adsorbents has been investigated as an ideal alternative to the current expensive methods of removing dyes from wastewater. This study investigates the potential use of the peel of Cucumis sativa fruit for the removal of crystal violet (CV dye from simulated wastewater. The effects of different system variables, adsorbent dosage, initial dye concentration, pH and contact time were investigated and optimal experimental conditions were ascertained. The results showed that as the amount of the adsorbent increased, the percentage of dye removal increased accordingly. Optimum pH value for dye adsorption was determined as 7.0. The adsorption of crystal violet followed pseudo-second order rate equation and fit well Langmuir and Freundlich equations. The maximum removal of CV was obtained at pH 7 as 92.15% for adsorbent dose of 0.2 g/50 mL and 25 mg L-1 initial dye concentration at room temperature. The maximum adsorption capacity obtained from Langmuir equation was 34.24 mg g-1. Furthermore, adsorption kinetics of (CV was studied and the rate of adsorption was found to conform to pseudo-second order kinetics with a good correlation (R2 > 0.9739. The peel of Cucumis sativa fruit can be attractive options for dye removal from diluted industrial effluents since test reaction made on simulated dyeing wastewater show better removal percentage of (CV.

  5. Cucurbita spp. and Cucumis sativus enhance the dissipation of polychlorinated biphenyl congeners by stimulating soil microbial community development

    International Nuclear Information System (INIS)

    Qin, Hua; Brookes, Philip C.; Xu, Jianming

    2014-01-01

    A number of Cucurbita species have the potential to extract polychlorinated biphenyls (PCBs) from soil, but their impact on the soil microbial communities responsible for PCB degradation remains unclear. A greenhouse experiment was conducted to investigate the effect of three Cucurbita and one Cucumis species on PCB dissipation and soil microbial community structure. Compared to the unplanted control, enhanced losses of PCBs (19.5%–42.7%) were observed in all planted soils. Cucurbita pepo and Cucurbita moschata treatments were more efficient in PCB dissipation, and have similar patterns of soil phospholipid fatty acids (PLFAs) and PCB congener profiles. Cucurbita treatments tend to have higher soil microbial biomass than Cucumis. Gram-negative (G − ) bacteria were significantly correlated with PCB degradation rates (R 2 = 0.719, p − bacteria were correlated with dissipation of the penta homologue group (R 2 = 0.590, p − bacteria contributed significantly to soil PCB dissipation. • Fungi have a great potential in the dissipation of high chlorinated biphenyls. -- Cucurbita associated fungi and G − bacteria have important influence on soil PCB dissipation rate and congener profile

  6. Variation in herbivory-induced volatiles among cucumber (Cucumis sativus L.) varieties has consequences for the attraction of carnivorous natural enemies

    NARCIS (Netherlands)

    Kappers, I.F.; Hoogerbrugge, H.; Bouwmeester, H.J.; Dicke, M.

    2011-01-01

    In response to herbivory by arthropods, plants emit herbivory-induced volatiles that attract carnivorous enemies of the inducing herbivores. Here, we compared the attractiveness of eight cucumber varieties (Cucumis sativus L.) to Phytoseiulus persimilis predatory mites after infestation of the

  7. Molecular mapping and candidate gene analysis for resistance to powdery mildew in Cucumis sativus stem.

    Science.gov (United States)

    Liu, P N; Miao, H; Lu, H W; Cui, J Y; Tian, G L; Wehner, T C; Gu, X F; Zhang, S P

    2017-08-31

    Powdery mildew (PM) of cucumber (Cucumis sativus), caused by Podosphaera xanthii, is a major foliar disease worldwide and resistance is one of the main objectives in cucumber breeding programs. The resistance to PM in cucumber stem is important to the resistance for the whole plant. In this study, genetic analysis and gene mapping were implemented with cucumber inbred lines NCG-122 (with resistance to PM in the stem) and NCG-121 (with susceptibility in the stem). Genetic analysis showed that resistance to PM in the stem of NCG-122 was qualitative and controlled by a single-recessive nuclear gene (pm-s). Susceptibility was dominant to resistance. In the initial genetic mapping of the pm-s gene, 10 SSR markers were discovered to be linked to pm-s, which was mapped to chromosome 5 (Chr.5) of cucumber. The pm-s gene's closest flanking markers were SSR20486 and SSR06184/SSR13237 with genetic distances of 0.9 and 1.8 cM, respectively. One hundred and fifty-seven pairs of new SSR primers were exploited by the sequence information in the initial mapping region of pm-s. The analysis on the F 2 mapping population using the new molecular markers showed that 17 SSR markers were confirmed to be linked to the pm-s gene. The two closest flanking markers, pmSSR27and pmSSR17, were 0.1 and 0.7 cM from pm-s, respectively, confirming the location of this gene on Chr.5. The physical length of the genomic region containing pm-s was 135.7 kb harboring 21 predicted genes. Among these genes, the gene Csa5G623470 annotated as encoding Mlo-related protein was defined as the most probable candidate gene for the pm-s. The results of this study will provide a basis for marker-assisted selection, and make the benefit for the cloning of the resistance gene.

  8. O Melos e Harmonia Acústica (1988 de César Guerra-Peixe, Koellreutter e Hindemith: similaridades e princípios básicos The Melos e Harmonia Acústica (1988 of César Guerra-Peixe, Koellreutter and Hindemith: basic principles and similarities

    Directory of Open Access Journals (Sweden)

    Ernesto Hartmann

    2013-06-01

    Full Text Available O Melos e Harmonia Acústica de César GUERRA-PEIXE (1988 apresenta um compêndio da atividade didática deste compositor expresso em forma de apostila. O presente trabalho busca traçar as possíveis influências comparando-o ao Caderno de Estudos com Koellreutter do próprio GUERRA-PEIXE (1944 e ao The Craft of Musical Composition de Paul HINDEMITH (1937, visando compreender melhor os pressupostos técnicos e teóricos.The Melos e Harmonia Acústica by César GUERRA-PEIXE (1988, presented a survey of the didactical activity of this composer expressed in a textbook form. This research attempts to trace possible influences, comparing it to The Craft of Musical Composition by Paul HINDEMITH (1937 and Caderno de Estudos com Koellreutter by GUERRA-PEIXE (1944 in order to better understand the technical and theoretical approaches embodied in it.

  9. Changes in the physiological regulation of transpiration caused by the effects of industrial air pollution. [Cucumis sativus

    Energy Technology Data Exchange (ETDEWEB)

    Kozinka, V; Klasova, A; Niznansky, A

    1963-01-01

    Through Hygen's method of quantitative analysis of transpiration curves, the authors studied the intensity of stomatal and cuticular transpiration of germinating leaves of Cucumis sativus which were experimentally exposed to solid impurities containing F. The difference between the control and experimental plants shows that the impurities not only blocked the regulating system of breathing but also caused increased cuticular transpiration. Numerous lesions were observed; cuticle damage also spread to the inner tissues. A direct relationship between microscopic and macroscopic symptoms was not proven. The creation of conditions adverse to the normal development of the water balance was intensified when the impurities were dropped onto the surface of the leaves. The possible protective function of trichomes is mentioned, but applies only when the impurities settle on a dry surface.

  10. The genome sequence of the North-European cucumber (Cucumis sativus L.) unravels evolutionary adaptation mechanisms in plants.

    Science.gov (United States)

    Wóycicki, Rafał; Witkowicz, Justyna; Gawroński, Piotr; Dąbrowska, Joanna; Lomsadze, Alexandre; Pawełkowicz, Magdalena; Siedlecka, Ewa; Yagi, Kohei; Pląder, Wojciech; Seroczyńska, Anna; Śmiech, Mieczysław; Gutman, Wojciech; Niemirowicz-Szczytt, Katarzyna; Bartoszewski, Grzegorz; Tagashira, Norikazu; Hoshi, Yoshikazu; Borodovsky, Mark; Karpiński, Stanisław; Malepszy, Stefan; Przybecki, Zbigniew

    2011-01-01

    Cucumber (Cucumis sativus L.), a widely cultivated crop, has originated from Eastern Himalayas and secondary domestication regions includes highly divergent climate conditions e.g. temperate and subtropical. We wanted to uncover adaptive genome differences between the cucumber cultivars and what sort of evolutionary molecular mechanisms regulate genetic adaptation of plants to different ecosystems and organism biodiversity. Here we present the draft genome sequence of the Cucumis sativus genome of the North-European Borszczagowski cultivar (line B10) and comparative genomics studies with the known genomes of: C. sativus (Chinese cultivar--Chinese Long (line 9930)), Arabidopsis thaliana, Populus trichocarpa and Oryza sativa. Cucumber genomes show extensive chromosomal rearrangements, distinct differences in quantity of the particular genes (e.g. involved in photosynthesis, respiration, sugar metabolism, chlorophyll degradation, regulation of gene expression, photooxidative stress tolerance, higher non-optimal temperatures tolerance and ammonium ion assimilation) as well as in distributions of abscisic acid-, dehydration- and ethylene-responsive cis-regulatory elements (CREs) in promoters of orthologous group of genes, which lead to the specific adaptation features. Abscisic acid treatment of non-acclimated Arabidopsis and C. sativus seedlings induced moderate freezing tolerance in Arabidopsis but not in C. sativus. This experiment together with analysis of abscisic acid-specific CRE distributions give a clue why C. sativus is much more susceptible to moderate freezing stresses than A. thaliana. Comparative analysis of all the five genomes showed that, each species and/or cultivars has a specific profile of CRE content in promoters of orthologous genes. Our results constitute the substantial and original resource for the basic and applied research on environmental adaptations of plants, which could facilitate creation of new crops with improved growth and yield in

  11. Comparative chromosomal localization of 45S and 5S rDNAs and implications for genome evolution in Cucumis.

    Science.gov (United States)

    Zhang, Zhen-Tao; Yang, Shu-Qiong; Li, Zi-Ang; Zhang, Yun-Xia; Wang, Yun-Zhu; Cheng, Chun-Yan; Li, Ji; Chen, Jin-Feng; Lou, Qun-Feng

    2016-07-01

    Ribosomal DNAs are useful cytogenetic markers for chromosome analysis. Studies investigating site numbers and distributions of rDNAs have provided important information for elucidating genome organization and chromosomal relationships of many species by fluorescence in situ hybridization. But relevant studies are scarce for species of the genus Cucumis, especially in wild species. In the present study, FISH was conducted to investigate the organization of 45S and 5S rDNA among 20 Cucumis accessions, including cultivars and wild accessions. Our results showed that the number of 45S rDNA sites varied from one to five pairs in different accessions, and most of these sites are located at the terminal regions of chromosomes. Interestingly, up to five pairs of 45S rDNA sites were observed in C. sativus var. sativus, the species which has the lowest chromosome number, i.e., 2n = 14. Only one pair of 5S rDNA sites was detected in all accessions, except for C. heptadactylus, C. sp, and C. spp that had two pairs of 5S rDNA sites. The distributions of 5S rDNA sites showed more variation than 45S rDNA sites. The phylogenetic analysis in this study showed that 45S and 5S rDNA have contrasting evolutionary patterns. We find that 5S rDNA has a polyploidization-related tendency towards the terminal location from an interstitial location but maintains a conserved site number, whereas the 45S rDNA showed a trend of increasing site number but a relatively conserved location.

  12. EFICIÊNCIA DE MÉTODOS ALTERNATIVOS UTILIZANDO ATMOSFERA MODIFICADA PASSIVA, NO CONTROLE DA PODRIDÃO DE MELÃO CANTALOUPE

    Directory of Open Access Journals (Sweden)

    Cynthia Renata Lima Sá

    2008-01-01

    Full Text Available This research avollue the efficiency of Potassium permanganate (KMnO4 plus other alternatives to control rot of melons. The trials were carried out at Embrapa Agroindústria Tropical located in Fortaleza, Ceara state, Brazil. Cantaloupe melons, hybrid 'Vera Cruz', were harvested from Dinamarca Indústria Agricola farm, located in the 304 BR km 38 - Nova Betânia - Mossoró, Rio Grande do Norte State. Fruits were sorted for uniformity, rinsed with alcohol 70%, inoculated with Fusarium pallidoroseum, and assembled for treatments with 600ppb of 1-methyiciclopropene (1- MCP; 1, 2 or 3g of Potassium permanganate; Carnauba wax; and Funginat (a blend essential oil. Five fruits were placed per box, and each box taken as a repetition. Fruits were also divided into two lots: not packed and packed in Xtend. Vermiculite sachets impregnated with potassium permanganate (KMnO4 were distributed according to the weight of the fruits in each box. Upon treatments, fruits were stored under low temperature, 3 ± 2°C, and relative humidity of 85 ± 2% for 14 days. After that period, fruit packages and boxes were removed from storage, low temperature and room temperature (23 ± 2°C and 90 ± 2% RH, respectively. Evaluations were loss of mass and grading from 15th to 18th day of storage. The experimental design was completely randomized in a factorial system 5x2, being five treatments (1- MCP, KMnO4, Carnaúba wax, Funginat, and control fruits, and two modified atmospheres (with and without X-tend. Results on disease incidence were written in percentage per box, transformed into arc sine and degrees of quadrant. The analysis of variance was performed with the aid of the ESTAT - System for Statistics Analysis, version 1.0, UNESP. Results showed significant difference principally regarding the use of packaging, suggesting that the use of modified atmosphere affects the quality of melons by increasing fruit shelf life. It has been also concluded that association of

  13. Effect of chromium toxicity on germination and early seedling growth ...

    African Journals Online (AJOL)

    USER

    2010-07-19

    Jul 19, 2010 ... germination and early seedling growth of melon (Cucumis melo L.). Chromium ... chromium on seed germination and seedling growth- biomass in early ..... such critical regulatory mechanisms are likely to operate in seeds at ...

  14. Macronutrient composition of three cucurbit species cultivated for ...

    African Journals Online (AJOL)

    .) Matsum. & Nakai., Cucumeropsis mannii Naudin, and Cucumis melo var. agrestis L.] largely cultivated in Côte d'Ivoire and consumed as sauce thickeners were analyzed for their proximate composition and compared to a local landrace of ...

  15. Effects of different irrigation regimes and nitrogen levels on yield and ...

    African Journals Online (AJOL)

    Jane

    2011-08-31

    Aug 31, 2011 ... levels on yield and quality of melon (Cucumis melo L.) M. Simsek1* and N. ... fertilization have significant adverse effects on water resources ... usage of water to meet the needs of plants (Stewart and. Nielsen, 1990).

  16. Pepino japonês (Cucumis sativus L. submetido ao tratamento com fécula de mandioca Japonese cucumber (Cucumis sativus L. submitted of the treatment with cassava starch film

    Directory of Open Access Journals (Sweden)

    Kelen Cristina dos Reis

    2006-06-01

    Full Text Available Com o presente trabalho objetivou-se avaliar a qualidade e a vida útil do pepino (Cucumis sativus L., utilizando recobrimento com película de fécula de mandioca. Após seleção, amostras de pepino japonês foram mergulhadas em suspensões de fécula de mandioca a 0, 2, 3 e 4%, secos ao ar e armazenados em câmara fria a 5ºC e 95% de UR por 8 dias. As análises realizadas foram perda de massa, pH, sólidos solúveis (SS , acidez titulável (AT, Cor L*a*b e firmeza. O delineamento utilizado foi o DIC com 3 repetições, com os tratamentos dispostos em esquema fatorial 4 x 5. O valor encontrado para firmeza nas amostras tratadas com película a 4% foram menores em comparação aos outros tratamentos, isto, provavelmente se deve à plasticidade do tecido que estas amostras apresentaram. A película reduziu significativamente a perda de massa das amostras mantidas sob refrigeração. A aplicação de película de fécula de mandioca na concentração mais elevada (4%, proporcionou ao pepino um aspecto melhor de conservação, tornando o produto mais atraente.This work was made to evaluate the properties and postharvest life of cucumber (Cucumis sativus L. coated with cassava starch film. After the selection the fruits were dipped in suspensions 0, 2, 3 and 4% starch, dried naturally and stored in chamber cold (5ºC ± 1ºC and 90% ± 5% HR during 8 days and the analyses were done in the time zero and in intervals of 2 days. The analyses done were loss mass, titratable acidity (TA, pH, soluble solids (SS, color L*a*b and firmness. The test was conducted in completely randomized design, with three repetitions, with the treatments disposed in factory layout 4x5. The value found for firmness in the samples treated with biofilm at 4% was smaller in comparison to the other treatments, this, is probably due to the plasticity of the tissue that these samples presented. The film reduced the loss of mass of the samples maintained under refrigeration

  17. JOÃO CABRAL DE MELO NETO: LA IMAGEN DEL RÍO EN LA POÉTICA DE LOS DESVALIDOS

    Directory of Open Access Journals (Sweden)

    GLORIA VERGARA

    2013-11-01

    Full Text Available In this article we review the cosmic image of water, from the theory of Gaston Bachelard, in two long poems of João Cabral de Melo Neto: O Rio ("The River" and O cão sem plumas ("The dog without feathers". I will see the river as cosmic image of the helpless in "The River" and the first part of "The dog without feathers", Paisagem do Capibaribe, understanding that poetry is not a complaint, but these texts denouncing misery. This poems project the worldview of those who resist the rigor, not only hunger and social spoils, but the river. The creatures that inhabit this world are as far away, the neglected, ignored what society. In the river, these beings are confused with the lama, not just your bank or depth, but the margin between liquid and solid, between the filth and survival. The gift of the destitute is his strength. Thus, the different shades reaching cosmic water image helps us to perceive the existence deployments in the "helpless" than lyrical subjects are depicted in Brazilian poetry.

  18. Insights into salicylic acid responses in cucumber (Cucumis sativus L.) cotyledons based on a comparative proteomic analysis.

    Science.gov (United States)

    Hao, J H; Dong, C J; Zhang, Z G; Wang, X L; Shang, Q M

    2012-05-01

    To investigate the response of cucumber seedlings to exogenous salicylic acid (SA) and gain a better understanding of SA action mechanism, we generated a proteomic profile of cucumber (Cucumis sativus L.) cotyledons treated with exogenous SA. Analysis of 1500 protein spots from each gel revealed 63 differentially expressed proteins, 59 of which were identified successfully. Of the identified proteins, 97% matched cucumber proteins using a whole cucumber protein database based on the newly completed genome established by our laboratory. The identified proteins were involved in various cellular responses and metabolic processes, including antioxidative reactions, cell defense, photosynthesis, carbohydrate metabolism, respiration and energy homeostasis, protein folding and biosynthesis. The two largest functional categories included proteins involved in antioxidative reactions (23.7%) and photosynthesis (18.6%). Furthermore, the SA-responsive protein interaction network revealed 13 key proteins, suggesting that the expression changes of these proteins could be critical for SA-induced resistance. An analysis of these changes suggested that SA-induced resistance and seedling growth might be regulated in part through pathways involving antioxidative reactions and photosynthesis. © 2012 Elsevier Ireland Ltd. All rights reserved.

  19. Exocarp Properties and Transcriptomic Analysis of Cucumber (Cucumis sativus) Fruit Expressing Age-Related Resistance to Phytophthora capsici.

    Science.gov (United States)

    Ando, Kaori; Carr, Kevin M; Colle, Marivi; Mansfeld, Ben N; Grumet, Rebecca

    2015-01-01

    Very young cucumber (Cucumis sativus) fruit are highly susceptible to infection by the oomycete pathogen, Phytophthora capsici. As the fruit complete exponential growth, at approximately 10-12 days post pollination (dpp), they transition to resistance. The development of age-related resistance (ARR) is increasingly recognized as an important defense against pathogens, however, underlying mechanisms are largely unknown. Peel sections from cucumber fruit harvested at 8 dpp (susceptible) and 16 dpp (resistant) showed equivalent responses to inoculation as did whole fruit, indicating that the fruit surface plays an important role in defense against P. capsici. Exocarp from 16 dpp fruit had thicker cuticles, and methanolic extracts of peel tissue inhibited growth of P. capsici in vitro, suggesting physical or chemical components to the ARR. Transcripts specifically expressed in the peel vs. pericarp showed functional differentiation. Transcripts predominantly expressed in the peel were consistent with fruit surface associated functions including photosynthesis, cuticle production, response to the environment, and defense. Peel-specific transcripts that exhibited increased expression in 16 dpp fruit relative to 8 dpp fruit, were highly enriched (Pfunctions. Specific transcripts included genes associated with potential physical barriers (i.e., cuticle), chemical defenses (flavonoid biosynthesis), oxidative stress, penetration defense, and molecular pattern (MAMP)-triggered or effector-triggered (R-gene mediated) pathways. The developmentally regulated changes in gene expression between peels from susceptible- and resistant- age fruits suggest programming for increased defense as the organ reaches full size.

  20. Phloem unloading follows an extensive apoplasmic pathway in cucumber (Cucumis sativus L.) fruit from anthesis to marketable maturing stage.

    Science.gov (United States)

    Hu, Liping; Sun, Huihui; Li, Ruifu; Zhang, Lingyun; Wang, Shaohui; Sui, Xiaolei; Zhang, Zhenxian

    2011-11-01

    The phloem unloading pathway remains unclear in fruits of Cucurbitaceae, a classical stachyose-transporting species with bicollateral phloem. Using a combination of electron microscopy, transport of phloem-mobile symplasmic tracer carboxyfluorescein, assays of acid invertase and sucrose transporter, and [(14)C]sugar uptake, the phloem unloading pathway was studied in cucumber (Cucumis sativus) fruit from anthesis to the marketable maturing stage. Structural investigations showed that the sieve element-companion cell (SE-CC) complex of the vascular bundles feeding fruit flesh is apparently symplasmically restricted. Imaging of carboxyfluorescein unloading showed that the dye remained confined to the phloem strands of the vascular bundles in the whole fruit throughout the stages examined. A 37 kDa acid invertase was located predominantly in the cell walls of SE-CC complexes and parenchyma cells. Studies of [(14)C]sugar uptake suggested that energy-driven transporters may be functional in sugar trans-membrane transport within symplasmically restricted SE-CC complex, which was further confirmed by the existence of a functional plasma membrane sucrose transporter (CsSUT4) in cucumber fruit. These data provide a clear evidence for an apoplasmic phloem unloading pathway in cucumber fruit. A presumption that putative raffinose or stachyose transporters may be involved in soluble sugars unloading was discussed. © 2011 Blackwell Publishing Ltd.

  1. Descripción de una especie nueva de Meloe Linnaeus, 1758 del subgénero Eurymeloe Reitter, 1911 (Coleoptera, Meloidae del norte de Marruecos

    Directory of Open Access Journals (Sweden)

    García-París, M.

    2009-12-01

    Full Text Available We describe a new species of Meloe (Coleoptera: Meloidae, subgenus Eurymeloe, included in the M. rugosus species group, related to species of the M. murinus subgroup. The specimens of the new species studied were found along the western Rif mountain chain (Talassemtane National Park in northwestern Morocco, and were located in hiperhumid montane forest habitats. The new species is characterized by having: a dull black coloration with greyish hue; a very short, curved, and not dense, yellow-whitish pilosity, which does not form tufts; a subrectangular transverse pronotum with a marked median grove and two longitudinal lateral depressions; head and pronotum punctures well impressed and subconfluent; elytra sligtly rugose; tarsomeres with slightly developed ventral pads; aedeagus with curved parameres, laterally depressed, apically pointed, with the distal ventral hook of median lobe close to apex. The new taxon es phenetically similar to M. nanus, M. baudueri and M. flavicomus, but distinguished from all of them by the mentioned morphological external and male genitalia characters. The distribution of the new species, only known from its type locality, overlaps those of M. murinus, M. nanus and possibly M. baudueri, but so far it has not been found in strict sympatry with any of them. The habitat type inhabited by the new species, mountain areas with mixed forests of Pinus pinaster hamiltonii var. maghrebiana, P. nigra mauritanica and Abies maroccana (endemic taxa of the limestone northwestern Rif mountain chain, contrasts with other habitat types recorded for species of the M. (E. murinus species subgroup of the subgenus Eurymeloe.Se describe una especie nueva de Meloe (Coleoptera: Meloidae del subgénero Eurymeloe, del grupo de M. rugosus, relacionada con especies del subgrupo de M. murinus. Los ejemplares estudiados de la especie nueva proceden del Rif occidental (Parque Nacional de Talassemtane, dorsal caliza rifeña, en el noroeste de

  2. Effects of gamma radiation on melon read-to-eat

    Energy Technology Data Exchange (ETDEWEB)

    Pires, Juliana A.; Polizel, Francine Fernanda, E-mail: jujuba_angelo@yahoo.com.br, E-mail: fran_sininho@hotmail.com [Faculdade de Tecnologia em Piracicaba (FATEP), Piracicaba, SP (Brazil); Harder, Marcia N.C.; Silva, Lucia C.A.S.; Arthur, Paula B.; Arthur, Valter, E-mail: mnharder@terra.com.br, E-mail: lcasilva@cena.usp.br, E-mail: paula.arthur@hotmail.com, E-mail: arthur@cena.usp.br [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)

    2013-07-01

    This work comes from the irradiation of Cantaloupe melons (Cucumis melo L.), with the aid of gamma irradiation (Co60) to physical and chemical changes to assess their conservation. The research aimed to evaluate the effects of irradiation on melons, including the possibility of conservation, through pH, acidity, soluble solids and fresh squash. The samples were minimally processed and submitted to gamma radiation Co{sup 60} at doses of 0 (control); 1kGy and 2kGy. Physicochemical analyzes were made in periods of 1, 7 and 14 days after irradiation treatment. On day 1 and day 7, pH levels in irradiated samples had increased compared to control. Since the 14th day, the dose decreased 1kGy equaling the control. Soluble solids showed a statistical gradual decrease according to the increase of dose. The 14th had no significant difference while the 7th the dose was increased. The 1kGy sample decreased in another dose compared to the control. In fresh squash, absent statistics were observed for all samples in the three periods. And for the analysis of titratable acidity, there was observed no significant difference at day 1. There was observed a decrease in the 2kGy and 1kGy dose to 7 days compared to the control. On 14th day, a reduction in the dose of 2kGy and deterioration of 1kGy dose of the sample. Therefore, it demonstrates the irradiation doses of 2kGy, 1kGy physic-chemically alters the Cantaloupe melon pH, soluble solids content and acidity. And the dose of 2kGy is the one that longer preserves samples based on acidity values, greater and smaller values of soluble solids. (author)

  3. Effects of gamma radiation on melon read-to-eat

    International Nuclear Information System (INIS)

    Pires, Juliana A.; Polizel, Francine Fernanda; Harder, Marcia N.C.; Silva, Lucia C.A.S.; Arthur, Paula B.; Arthur, Valter

    2013-01-01

    This work comes from the irradiation of Cantaloupe melons (Cucumis melo L.), with the aid of gamma irradiation (Co60) to physical and chemical changes to assess their conservation. The research aimed to evaluate the effects of irradiation on melons, including the possibility of conservation, through pH, acidity, soluble solids and fresh squash. The samples were minimally processed and submitted to gamma radiation Co 60 at doses of 0 (control); 1kGy and 2kGy. Physicochemical analyzes were made in periods of 1, 7 and 14 days after irradiation treatment. On day 1 and day 7, pH levels in irradiated samples had increased compared to control. Since the 14th day, the dose decreased 1kGy equaling the control. Soluble solids showed a statistical gradual decrease according to the increase of dose. The 14th had no significant difference while the 7th the dose was increased. The 1kGy sample decreased in another dose compared to the control. In fresh squash, absent statistics were observed for all samples in the three periods. And for the analysis of titratable acidity, there was observed no significant difference at day 1. There was observed a decrease in the 2kGy and 1kGy dose to 7 days compared to the control. On 14th day, a reduction in the dose of 2kGy and deterioration of 1kGy dose of the sample. Therefore, it demonstrates the irradiation doses of 2kGy, 1kGy physic-chemically alters the Cantaloupe melon pH, soluble solids content and acidity. And the dose of 2kGy is the one that longer preserves samples based on acidity values, greater and smaller values of soluble solids. (author)

  4. Cultivation and uses of cucurbits

    Science.gov (United States)

    Cultivated cucurbits have spread through trade and exploration from their respective Old and New World centers of origin to the six arable continents and are important in local, regional and world trade. Cucumber (Cucumis sativus L.), melon (Cucumis melo L.), pumpkin, squash and gourd (Cucurbita spp...

  5. Screening of Phytoconstituents, Investigation of Antioxidant and Antibacterial Activity of Methanolic and Aqueous Extracts of Cucumis sativus

    International Nuclear Information System (INIS)

    Sahar, A.; Naqvi, S.A.; Khan, Z.A.; Ahmad, M.; Hussain, Z.; Sahar, T.; Nosheen, S.

    2013-01-01

    The phytoconstituents, antioxidant potential and antibacterial activity of Cucumis sativus (C. sativus) cultivated in Pakistan were studied. In addition, the effect of extraction techniques (mercerization and refluxing) on the total phenolics, antioxidant activity and antibacterial potential of C. sativus fruit pulp were also studied. Methanol extract was screened for its phytoconstituents. The antioxidant activity was assessed by determination of total phenolic contents (TPC), total flavonoid contents (TFC) and performing different in vitro antioxidant models such as 2,2-Diphenyl-1-picryl hydrazyl (DPPH) free radical scavenging, reducing power, percent inhibition of peroxidation in linoleic acid and nitric oxide free radical scavenging assays. Phytochemicals screening results revealed the presence of flavonoids, glycosides, tannic acid and saponins while absence of alkaloids, steroids and anthraquinones. The TPC was found in appreciable concentration (41.03 mg gallic acid equivalent (GAE)/g) in extract obtained by 4h methanolic mercerization. Long refluxing technique (4h refluxing) was found unfavorable to some extent as it resulted only 33.69 mg GAE/g TPC in methanolic extract. Anyhow the extraction with water using mercerization and refluxing techniques found least effective e.g. 4h mercerization and refluxing showed 14.14 and 18.16 mg GAE/g respectively. Antibacterial assay showed extract obtained by 4h and 2h methanolic mercerization have good potential to inhibit the growth (09.6+-0.7 to 18.5+-0.8 mm) of infection causing bacteria. The results of antioxidants and antibacterial in vitro assays advocated that 4h methanolic mercerization is an effective extraction technique. Therefore, it could be concluded that methanolic mercerization is a technique of maximum extraction of phenolics and bioactive constituents. (author)

  6. Control of cucumber (Cucumis sativus L. tolerance to chilling stress – evaluating the role of ascorbic acid and glutathione

    Directory of Open Access Journals (Sweden)

    Alexander S. Lukatkin

    2014-12-01

    Full Text Available Chilling temperatures (1-10 ºC are known to disturb cellular physiology, cause oxidative stress via creating imbalance between generation and metabolism of reactive oxygen species (ROS leading finally to cell and/or plant death. Owing to known significance of low molecular antioxidants - ascorbic acid (AsA and glutathione (GSH in plant stress-tolerance, this work analyzes the role of exogenously applied AsA and GSH in the alleviation of chilling stress (3°C-impact in cucumber (Cucumis sativus L. cv. Vjaznikowskij 37 plants. Results revealed AsA and GSH concentration dependent metabolism of ROS such as superoxide (O2•‾ and the mitigation of ROS-effects such as lipid peroxidation (LPO as well as membrane permeability (measured as electrolyte leakage in C. sativus leaf discs. AsA concentration (750 µM and GSH (100 µM exhibited maximum reduction in O2•‾ generation, LPO intensity as well as electrolyte leakage, all of these were increased in cold water (3°C and 25°C-treated leaf discs. However, AsA, in particular, had a pronounced antioxidative effect, more expressed in case of leaf discs during chilling (3°C; whereas, at temperature 25°C, some AsA concentrations (such as 50 and 100 mM AsA exhibited a prooxidative effect that requires molecular-genetic studies. Overall, it is inferred that AsA and GSH have high potential for sustainably increasing chilling-resistance in plants.

  7. SELDI-TOF MS-based discovery of a biomarker in Cucumis sativus seeds exposed to CuO nanoparticles.

    Science.gov (United States)

    Moon, Young-Sun; Park, Eun-Sil; Kim, Tae-Oh; Lee, Hoi-Seon; Lee, Sung-Eun

    2014-11-01

    Metal oxide nanoparticles (NPs) can inhibit plant seed germination and root elongation via the release of metal ions. In the present study, two acute phytotoxicity tests, seed germination and root elongation tests, were conducted on cucumber seeds (Cucumis sativus) treated with bulk copper oxide (CuO) and CuO NPs. Two concentrations of bulk CuO and CuO NPs, 200 and 600ppm, were used to test the inhibition rate of root germination; both concentrations of bulk CuO weakly inhibited seed germination, whereas CuO NPs significantly inhibited germination, showing a low germination rate of 23.3% at 600ppm. Root elongation tests demonstrated that CuO NPs were much stronger inhibitors than bulk CuO. SELDI-TOF MS analysis showed that 34 proteins were differentially expressed in cucumber seeds after exposure to CuO NPs, with the expression patterns of at least 9 proteins highly differing from those in seeds treated with bulk CuO and in control plants. Therefore, these 9 proteins were used to identify CuO NP-specific biomarkers in cucumber plants exposed to CuO NPs. A 5977-m/z protein was the most distinguishable biomarker for determining phytotoxicity by CuO NPs. Principal component analysis (PCA) of the SELDI-TOF MS results showed variability in the modes of inhibitory action on cucumber seeds and roots. To our knowledge, this is the first study to demonstrate that the phytotoxic effect of metal oxide NPs on plants is not caused by the same mode of action as other toxins. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Benefits from Bio and organic fertilization by cucumber (Cucumis Sativus) with application of 15N stable isotope

    International Nuclear Information System (INIS)

    Galal, Y. G. M.; Soliman, S. M.; Ahmed, F. A.; El-Sherbiny, A. E. A.; Dahdouh, S. M.

    2012-12-01

    Benefits from bio and organic fertilizer were evaluated under cucumber (Cucumis Sativus) crop grown on sandy soil at a field scale. The experiment was conducted under drip irrigation system. Fertilization treatment indicated that the combination of 50% mineral fertilizer (MF) + 50% organic compost (OC) was superior over all other fertilization treatment when the fresh weight of cucumber biomass or fruits was considered. It means that half of the recommended dose of of mineral fertilizer is enough to meet the requirement of cucumber crop when supplemented with organic compost. Nitrogen derived from mineral fertilizer (Ndff) by cucumber at different plant growth stages was significantly affected by the rate of addition and enhanced with microbial inoculation. Arbuscular mycorrhizea (AMF) was superior over Azospirillum and Rhizobium inoculations. The enhancement of Ndff uptake by plants was more pronounced at the fruit stage than at vegetative, flowering and hay growth stages. The highest values of Ndfa were induced by Rhizobium at hay stage followed by fruit. Similar trend, but to different extents was noticed with AMF and Azospirillum inoculum s. Most of nitrogen derived from compost (Ndfc) was occurred by addition of 50% MF + 50% Oc. Rhizobium and AMF were more effective than Azospirilum. High quantities of Ndfc were recognized at hay stage compared to other growth stages.The efficient use of mineral fertilizer-N (%NUE) was increased by addition of half:half mineral and organic fertilizer. Similarly, it seems that microbial inoculation in general has a synergistic effect on enhancement of %NUE. Higher NUE occurred at hay growth stage than others. (Author)

  9. [Effects of temperature regime on low-light tolerance of Cucumis sativus seedling leaves in their photosynthesis].

    Science.gov (United States)

    Li, Wei; Sui, Xiao-lei; Zhang, Zhen-xian

    2008-12-01

    In a phytotron, the effects of three temperature regimes (day/night 25 degrees C/18 degrees C, optimal temperature; 15 degrees C/9 degrees C, suboptimal temperature; and 9 degrees C/7 degrees C, low temperature) on the low-light (75-85 micromol x m(-2) x s(-1)) tolerance of two Cucumis sativus cultivars (shade-susceptible Jinyan 2 and shade-tolerant Deltastar) seedling leaves in their photosynthesis were studied. The results showed that under low light, the SPAD, net photosynthesis rate (Pn), stomatal conductance (Gs), transpiration rate (Tr), water use efficiency (WUE), actual photochemical efficiency of PS II in the light (phi(PS II)), and photochemical quenching of chlorophyll fluorescence (q(p)) of cucumber leaves decreased, with the decrement getting more with decreasing temperature, while the superoxide dismutase (SOD), peroxidase (POD) and catalase (CAT) activities were in adverse. During the recovery process after low-light stress relieved, the parameters of gas exchange and chlorophyll fluorescence of the leaves recovered gradually, and the recovery of some gas exchange parameters lagged to that of chlorophyll fluorescence parameters. Under low light, the lower the temperature, the more damage the photosynthesis apparatus suffered, and the lesser tolerance to low light the cucumber leaves had in their photosynthesis. During the low temperature and low light treatment period, the decrease of Pn, phi(PS II), and q(p) was more obvious for Jinyan 2 than for Deltastar; and during the relief period, the recovery of these parameters was slower for Jinyan 2 than for Deltastar. It was indicated that Jinyan 2 had weaker tolerance to low temperature and/or low light in its photosynthesis than Deltastar.

  10. VALORACIÓN DE ATRIBUTOS DE CALIDAD EN PEPINO (Cucumis sativus L. FORTIFICADO CON VITAMINA E VALORAÇÃO DE ATRIBUTOS DE QUALIDADE EM PEPINO (Cucumis sativus L. FORTIFICADO COM VITAMINA E VALUATION OF QUALITY ATTRIBUTES IN CUCUMBER (Cucumis sativus L. FORTIFIED WITH VITAMIN E

    Directory of Open Access Journals (Sweden)

    MISAEL CORTÉS

    2011-06-01

    Full Text Available El objetivo de este trabajo fue desarrollar un producto mínimamente procesado fortificado con vitamina E, a partir de pepino (Cucumis sativus L, utilizando la ingeniería de matrices. Rodajas impregnadas al vacío (IV con DL-α-tocoferol acetato emulsificado en una fase acuosa isotónica al pepino (NaCl al 1%, son evaluadas en cuanto a propiedades fisicoquímicas, color, textura, estabilidad de la vitamina E y sensorialmente, por influencia del proceso, tiempo de almacenamiento y envasado (con y sin vacío. La vitamina E se cuantifica por HPLC (% del valor diario recomendado (VDR/100 g de pepino fresco, según la norma Colombiana. La respuesta IV alcanza niveles de 6.05±1.49%, correspondiente a 33.3±5.8 mg vitamina E y 110.5±19.1% VDR en 100 g de pepino fresco. Durante el almacenamiento en 9 días se presenta una pérdida aproximadamente del 50%, debido a la poca retención de la emulsión en el interior de la matriz. Los parámetros fisicoquímicos, el color y la textura son afectados por la IV, el tiempo y el envasado, siendo durante el almacenamiento más oscuras y más resistentes que el producto fresco. La ingeniería de matrices representa una metodología efectiva para fortificar el pepino con vitamina E.O objetivo deste estudo foi desenvolver um produto mínimamente processado fortificado com vitamina E, a partir de pepino (Cucumis sativus L, utilizando a engenharia de matrizes. Fatias de pepino foram impregnadas a vácuo (IV com DL-α- acetato de tocoferol emulsificado numa fase aquosa isotónica (NaCl a 1%, e foram avaliadas quanto às propiedades fisico-químicas, cor, textura, estabilidade da vitamina E e sensorialmente, tendo em consideração os factores: processo, tempo de armazenamento e envasado (com e sem vácuo. A vitamina E quantificou-se por HPLC (% do Valor Diario Recomendado (VDR/100 g de pepino fresco, de acordo com a norma Colombiana. A resposta à IV alcanzou niveis de 6.05±1.49%, correspondente a 33.3±5.8 mg

  11. Compensation effect of bacterium containing biofertilizer on the growth of Cucumis sativus L. under Al-stress conditions.

    Science.gov (United States)

    Tóth, Brigitta; Lévai, L; Kovács, B; Varga, Mária Borbélyné; Veres, Szilvia

    2013-03-01

    Biofertilizers are used to improve soil fertility and plant production in sustainable agriculture. However, their applicability depends on several environmental parameters. The aim of our study was to evaluate the effect of free-living bacteria containing fertilizer on the growth of cucumber (Cucumis sativus L. cvs. Delicates) under aluminium (Al) stress. Different responses to Al stress of cucumber growth parameters were examined in terms of root elongation and physiological traits, such as Spad index (relative chlorophyll value), biomass accumulation of root and shoot, Al uptake and selected element contents (Fe, Mn, Zn, Mg) of leaves and root. The applied bacteria containing biofertilizer contains Azotobacter chroococcum and Bacillus megaterium. The dry weights of cucumber shoots and roots decreased in line with the increasing Al concentration. Due to different Al treatments (10-3 M, 10-4 M) higher Al concentration was observed in the leaves, while the amounts of other elements (Fe, Mn, Zn, Mg) decreased. This high Al content of the leaves decreased below the control value when biofertilizer was applied. In the case of the roots the additional biofertilizer treatments compensated the effect of Al. The relative chlorophyll content was reduced during Al-stress in older plants and the biofertilizer moderated this effect. The root/shoot ratio was decreased in all the Al-treatments in comparison to the control. The living bacteria containing fertilizer also had a modifying effect. The root/shoot ratio increased at the 10-4 M Al2(SO4)2 + biofertilizer and 10-4 M Al(NO3)3 + biofertilizer treatments compared to the control and Al-treatments. According to our results the biofertilizer is an alternative nutrient supply for replacing chemical fertilizers because it enhances dry matter production. Biofertilizer usage is also offered under Al polluted environmental conditions. Although, the nutrient solution is a clean system where we can examine the main processes without

  12. Allelopathic influence of aqueous extracts from the leaves of Morus alba L. on seed germination and seedling growth of Cucumis sativus L. and Sinapsis alba L.

    Directory of Open Access Journals (Sweden)

    Katarzyna Możdżeń

    2014-04-01

    Full Text Available The aim of the present study was to elucidate impact of the aqueous extracts from leaves of Morus alba L. on germination, growth and photosynthetic activity of Cucumis sativus L. and Sinapis alba L. Plants were grown for 21 days at the temperature 25°C (day and 18°C (night, within 12/12 hours photoperiod, light intensity 150 μmol·m-2·s-1 and relative humidity 60-70% (day/night. Our experiments proved that allelopathic compounds in aqueous extracts of the leaves M. alba at high concentrations, reduce power and energy of germination. Biometric analysis of seedlings and adult plants grown showed that allelopathic substances have stimulating or inhibiting function depending on the stage of treatment. Moreover, they cause changes in chlorophyll contents and activity of photosystem II (PS II.

  13. Agrobiodiversity Indices for Three Cucurbit Species in Khorasan- Razavi Province

    Directory of Open Access Journals (Sweden)

    Mehdi Nassiri Mahallati

    2017-09-01

    Full Text Available Introduction The deterioration of genetic resources of many field crops due to monoculture and other agricultural activities has been well documented. Estimates indicate that the introduction of new varieties has contributed at least 80% of the increase in crop production, yet, these gains have been offset by the loss of 90% of landraces. The importance of biodiversity in enhancing the sustainability of crop production in agroecosystems has been well acknowledged in the literature. This has been achieved by increasing the biodiversity at cropping systems, species, and variety levels, which corresponds to biodiversity at the ecosystem, species, and ecotype levels in natural ecosystems. Conservation of biodiversity is prerequisite for sustainable agroecosystems. In the past, diverse species, genotypes and varieties were used in agroecosystems that ensured their sustainability. At present, this approach has changed and new varieties have replaced old ones and on sustainability of systems has been negatively impacted. In the other word, agrobiodiversity or the variety of species in cropping systems has dropped rapidly. Materials and methods In this research, agrobiodiversity of melon (Cucumis.melo var. Inodorus, watermelon (Citrullus Vulgaris and cantaloupe (Cucumis.melo var. Cantaloupensis were evaluated at the genotype and variety levels. For this purpose necessary data including the number of cultivated genotypes or land races and cultivated area for each of them were collected from 25 counties of Khorasan Razavi province. Accurate data was gathered from the appropriate database and also by filling questionnaire for growing season of 2010-2011. Then spatial biodiversity indices of Simpson and Shannon, evenness, and similarity indices of Sorenson were calculated for three cucurbit crops. Results and discussion The results showed that from total cultivated area of cucurbit species in 2010-2011 growing season, 48, 30, 20 and 2 percent belonged to

  14. Vitamin D deficiency is associated with ethnicity and knee pain in a multi-ethnic South-East Asian nation: Results from Malaysian Elders Longitudinal Research (MELoR).

    Science.gov (United States)

    Mat, Sumaiyah; Jaafar, Mohamad Hasif; Sockalingam, Sargunan; Raja, Jasmin; Kamaruzzaman, Shahrul Bahyah; Chin, Ai-Vyrn; Abbas, Azlina Amir; Chan, Chee Ken; Hairi, Noran Naqiah; Othman, Sajaratulnisah; Cumming, Robert; Tan, Maw Pin

    2018-05-01

    To determine the association between vitamin D and knee pain among participants of the Malaysian Elders Longitudinal Research (MELoR) study. This was a cross-sectional study from the MELoR study consisting of a representative group of 1011 community-dwelling older persons (57% female), mean age 86.5 (54-94) years; 313 were Malays, 367 Chinese and 330 Indians. Participants were asked if they had knee pain. Levels of serum 25-hydroxy cholecalciferol (25-[OH]D), an indicator of vitamin D status, were measured using routine laboratory techniques. In unadjusted analysis, presence of knee pain was significantly associated with vitamin D deficiency (odds ratio [OR] 1.42; 95% confidence interval (CI) 1.08-1.85, P 0.011). Vitamin D levels were significantly associated with ethnicity differences where Malays (OR 7.08; 95% CI 4.94-10.15) and Indians (OR 6.10; 95% CI 4.28-9.71) have lower levels of vitamin D compared to Chinese. Subsequent multivariate analysis revealed that the association between vitamin D deficiency and knee pain was confounded by ethnic differences. A previous study suggested that vitamin D deficiency was associated with knee pain. This relationship was reproduced in our study, but we further established that the association was explained by ethnic variations. As vitamin D status is dependent on skin tone, diet and sunlight exposure, which are all effected by ethnicity, future studies are now required to determine whether a true relationship exists between vitamin D and knee pain. © 2018 Asia Pacific League of Associations for Rheumatology and John Wiley & Sons Australia, Ltd.

  15. Assessment of General and Specific Combining Ability and Heterosis of Some Cucumber (Cucumis sativus L. Lines for Vegetative Traits

    Directory of Open Access Journals (Sweden)

    Fatemeh Moradipour

    2017-10-01

    Full Text Available Introduction: Cucumber (Cucumis sativus L. is one of the most widely cultivated vegetables. Plant length is a quantitative trait is controlled by many genes. These traits are difficult to study due to the complex nature of their inheritance. The combining ability estimation is useful in determining the breeding value of cucumber lines by suggesting the appropriate use in a breeding program. In studying combining ability, the most commonly utilized experimental approach is the diallel design. General combining ability is a measure of additive genetic action; and specific combining ability (SCA is deviation from additivity. General combining ability is a main effect and SCA is an interaction. The aim is to determine the breeding value of the cross. Heterosis has been utilized to exploit dominance variance through production of hybrids. There are reports on positive and negative heterosis in cucumber however, there are differences between reports. This research was conducted to estimate general and specific combining ability and heterosis in cucumber inbred lines and hybrids to produce hybrids with high yield and quality. Material and Methods: In the spring of 2014, the seven parental lines and their 21 F1 hybrid were planted at the University of Guilan, in loamy sand field. Three replications were arranged in a randomized complete block design. The sandy loam soil was prepared by plowing and disking and formed into raised beds by plowed and harrow prior to plant establishment. Rows were on 1 m centers and plants were about 25 cm apart in the row. Prior to planting 150 kg·ha-1 of nitrogen from urea and 100 kg·ha-1 of phosphorous from triple superphosphate and 80 kg·ha-1 of potassium sulfate was applied. Side dressing with the same amount of nitrogen and phosphorus occurred at 50% flowering stage. Irrigation with 250 m3·ha-1, three times weekly, was begun at plant first flowering. In each replication, 12 individuals of each line or hybrid were

  16. Evaluation of the metam sodium in joint action with the clomazone and sulfentrazone like alternative to the use of methyl bromide in the melon cultivation of cantaloupe kind, in Carrillo, Guanacaste, Costa Rica

    International Nuclear Information System (INIS)

    Buzano Barrantes, Pedro

    2002-01-01

    This research realized a study in the melon cultivation of cantaloupe kind with the objective to evaluate the utilization of metam sodium joint with the clomazone and sulfentrazone weed-killers like substitutes of methyl bromide in the experimental station of Melons de Costa Rica located in Carrillo, Guanacaste, during the season of 1998-1999. The treatments were: metam sodium (148 g.i.a./ha) + sulfentrazone (60 g.i.a./ha), metam sodium (148 g.i.a./ha) + sulfentrazone (100 g.i.a./ha), metam sodium (148 g.i.a./ha) + clomazone (240 g.i.a./ha), metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha), sulfentrazone (60 g.i.a.), sulfentrazone (100 g.i.a.), clomazone (240 g.i.a./ha), clomazone (480 g.i.a./ha), metam sodium (148 g.i.a./ha), methyl bromide (250 kg./ha) and an absolute control. The experimental design was unconditional at random with eleven treatments and three repetitions by treatments with four beds of 35m x 0.8m by repetition. The results showed that the best treatments were: metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha), with a 13.3% less of weeds control than the methyl bromide (250 kg/ha) and the treatment with metam sodium (148 g.i.a./ha) with a 19.2% less of weeds control than the methyl bromide (250 Kg/ha). The 5,9% of difference among them is by the clomazone's action (480 g.i.a./ha). The treatment with methyl bromide (250 Kg./ha) was the highest in output, 2286 total boxes by hectare, followed by the treatments with metam sodium (148 g.i.a./ha) + sulfentrazone (100 g.i.a./ha) with 1906 and metam sodium (148 g.i.a./ha) + clomazone (480 g.i.a./ha) that produced 1912.33 boxes of melon by hectare. (Author) [es

  17. PORSUK NEHRİ SUYUNUN CUCUMIS SATIVUS (L. TOHUMLARININ FİDE GELİŞİMİ ÜZERİNE ETKİLERİNİN BELİRLENMESİ

    Directory of Open Access Journals (Sweden)

    Mehmet ÇALISEKİ

    2016-03-01

    Full Text Available Porsuk Çayı 448 km uzunluğu ile Sakarya Irmağı’nın en uzun koludur ve Bayatçık Deresi ile Kızıltaş Suyu’nun birleşmesi ile oluşur. Kütahya Ovası’ndan geçip Eskişehir’in güneybatısında yer alan Porsuk-I ve Porsuk-II barajlarında toplandıktan sonra Eskişehir Ovası’ndan ve Eskişehir ilinden geçer ve Sakarya Irmağı’na ulaşır. Porsuk Çayı, Eskişehir’de tarım arazilerinin sulama suyu olarak kullanılmaktadır. Tüm İç Anadolu’da olduğu gibi Eskişehir’de de tarımı yapılan en yaygın bahçe bitkileri arasında Cucumis sativus (L. yer almaktadır. İnsan beslenmesinde ilk bakışta önemli gibi görünmese de Cucumis sativus; vitaminler, enzimler, mineral maddeler bakımından zengin bir bitkidir. Fakat protein, karbonhidrat ve yağ bakımından fakirdir. Bu çalışmada, tohumların çimlendirilmesinde şehir şebeke suyu ve farklı oranlarda seyreltilmiş, şehir içinde ve şehir dışında belirlenen istasyonlardan alınan Porsuk nehrine ait su örnekleri kullanılmıştır. Fidelerin kök-gövde uzunlukları, kök ve gövdeye ait yaş ve kuru ağırlıklar ölçülerek şebeke suyu ve Porsuk nehrine ait suyun fide gelişimi üzerine etkileri araştırılmıştır. Elde edilen verilere göre, kök uzunluğunun nehir suyunun seyreltme oranı ile doğru orantıda arttığı ve su içeriğinin seyreltme oranı arttıkça azaldığı tespit edilmiştir

  18. Transcriptomic analysis of short-fruit 1 (sf1) reveals new insights into the variation of fruit-related traits in Cucumis sativus.

    Science.gov (United States)

    Wang, Lina; Cao, Chenxing; Zheng, Shuangshuang; Zhang, Haiyang; Liu, Panjing; Ge, Qian; Li, Jinrui; Ren, Zhonghai

    2017-06-07

    Fruit size is an important quality trait in different market classes of Cucumis sativus L., an economically important vegetable cultivated worldwide, but the genetic and molecular mechanisms that control fruit size are largely unknown. In this study, we isolated a natural cucumber mutant, short fruit 1 (sf1), caused by a single recessive Mendelian factor, from the North China-type inbred line CNS2. In addition to significantly decreased fruit length, other fruit-related phenotypic variations were also observed in sf1 compared to the wild-type (WT) phenotype, indicating that sf1 might have pleiotropic effects. Microscopic imaging showed that fruit cell size in sf1 was much larger than that in WT, suggesting that the short fruit phenotype in sf1 is caused by decreased cell number. Fine mapping revealed that sf1 was localized to a 174.3 kb region on chromosome 6. Similarly, SNP association analysis of bulked segregant RNA-Seq data showed increased SNP frequency in the same region of chromosome 6. In addition, transcriptomic analysis revealed that sf1 might control fruit length through the fine-tuning of cytokinin and auxin signalling, gibberellin biosynthesis and signal transduction in cucumber fruits. Overall, our results provide important information for further study of fruit length and other fruit-related features in cucumber.

  19. The Two Translationally Controlled Tumor Protein Genes, CsTCTP1 and CsTCTP2, Are Negative Modulators in the Cucumis sativus Defense Response to Sphaerotheca fuliginea

    Directory of Open Access Journals (Sweden)

    Xiangnan Meng

    2018-04-01

    Full Text Available Pathogen stress often significantly decreases cucumber production. However, knowledge regarding the molecular mechanism and signals of cucumber disease resistance is far from complete. Here, we report two translationally controlled tumor protein genes, CsTCTP1 and CsTCTP2, that are both negative modulators in the Cucumis sativus defense response to Sphaerotheca fuliginea. Subcellular localization analysis showed that CsTCTP1 and CsTCTP2 were both localized in the cytoplasm. Expression analysis indicated that the transcript levels of CsTCTP1 and CsTCTP2 were linked to the degree of cucumber resistance to S. fuliginea. Transient overexpression of either CsTCTP1 or CsTCTP2 in cucumber cotyledons impaired resistance to S. fuliginea, whereas silencing of either CsTCTP1 or CsTCTP2 enhanced cucumber resistance to S. fuliginea. The relationship of several defense-related genes and ABA and target of rapamycin (TOR signaling pathway-related genes to the overexpressing and silencing of CsTCTP1/CsTCTP2 in non-infested cucumber plants was investigated. The results indicated that CsTCTP1 participates in the defense response to S. fuliginea by regulating the expression of certain defense-associated genes and/or ABA signaling pathway-associated genes, and CsTCTP2 participates through regulating the expression of TOR signaling pathway-associated genes. Our findings will guide enhancing the resistance of cucumber to powdery mildew.

  20. Effects of exogenous application of CPPU, NAA and GA4+7 on parthenocarpy and fruit quality in cucumber (Cucumis sativus L.).

    Science.gov (United States)

    Qian, Chunlu; Ren, Nannan; Wang, Jingye; Xu, Qiang; Chen, Xuehao; Qi, Xiaohua

    2018-03-15

    In protected vegetable fields, plant growth regulators are often used to improve cucumber fruit growth. However, the effects of plant growth regulators on the appearance and nutritional quality of cucumber (Cucumis sativus L.) remain largely unknown. In the present study, 100 mg/L N-(2-chloro-4-pyridyl)-N'-phenylurea (CPPU), naphthaleneacetic acid (NAA) or gibberellin A4+A7 (GA 4+7 ) was applied to the female cucumber flowers 1 day before anthesis and at anthesis. The CPPU, NAA and GA 4+7 treatments resulted in parthenocarpic fruits with similar weights, sizes and shapes as the pollinated fruits. NAA treatment did not affect the appearance and nutritional characteristics of cucumber at harvest and after storage. CPPU treatment increased the flesh firmness at harvest but decreased phenolic acid and vitamin C contents after storage. GA 4+7 treatment decreased the flesh firmness but increased total flavonoids and protein content after storage. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Study of the effect of uranium and thorium on the growing of pepper (Capsicum annuum var. longum) and cucumber (Cucumis sativus) plants

    International Nuclear Information System (INIS)

    Uenak, T.; Yildirim, Y.; Tokucu, G.; Uenak, G.; Oecal, J.; Konyali, D.; Kilic, S.

    2007-01-01

    The transportation rate of uranium and thorium to different plants grown in soils having high level of these elements varies closely with the plant characteristics. In this study, the pepper (Capsicum annuum var. longum) and cucumber (Cucumis sativus) plants were chosen as vegetables which are commonly consumed over different regions by different populations. The results obtained can be summarized as follows: (1) High uranium concentration in the soil prevents the growing of the plants. Only the plants in the pot having the uranium concentration of about 263 ppm grew significantly. The plants in other pots having a higher concentration turned pale and died in a few weeks. (2) In the pot having thorium level of about 263 ppm, the plants were well grown and fruited in comparison to the control plants, but the increase of thorium concentration inversely influenced their growing. (3) The gross activities measured in different parts of the plants were not particularly high, however, in both cases the maximum activities were measured in the stems rather than in the fruits and leaves. (4) The plants grown in soils having thorium content lived longer than the control plants and at the greenhouse conditions indicated above, all plants lived more than one whole year flowering and fruiting. (author)

  2. Phytotoxicity of ZnO nanoparticles and the released Zn(II) ion to corn (Zea mays L.) and cucumber (Cucumis sativus L.) during germination.

    Science.gov (United States)

    Zhang, Ruichang; Zhang, Haibo; Tu, Chen; Hu, Xuefeng; Li, Lianzhen; Luo, Yongming; Christie, Peter

    2015-07-01

    Toxicity of engineered nanoparticles on organisms is of concern worldwide due to their extensive use and unique properties. The impacts of ZnO nanoparticles (ZnO NPs) on seed germination and root elongation of corn (Zea mays L.) and cucumber (Cucumis sativus L.) were investigated in this study. The role of seed coats of corn in the mitigation toxicity of nanoparticles was also evaluated. ZnO NPs (1,000 mg L(-1)) reduced root length of corn and cucumber by 17 % (p < 0.05) and 51 % (p < 0.05), respectively, but exhibited no effects on germination. In comparison with Zn(2+), toxicity of ZnO NPs on the root elongation of corn could be attributed to the nanoparticulate ZnO, while released Zn ion from ZnO could solely contribute to the inhibition of root elongation of cucumber. Zn uptake in corn exposed to ZnO NPs during germination was much higher than that in corn exposed to Zn(2+), whereas Zn uptake in cucumber was significantly correlated with soluble Zn in suspension. It could be inferred that Zn was taken up by corn and cucumber mainly in the form of ZnO NPs and soluble Zn, respectively. Transmission electron microscope confirmed the uptake of ZnO NPs into root of corn. Although isolation of the seed coats might not be the principal factor that achieved avoidance from toxicity on germination, seed coats of corn were found to mitigate the toxicity of ZnO NPs on root elongation and prevent approximately half of the Zn from entering into root and endosperm.

  3. Comparative studies of the phytochemistry, proximate analysis, mineral and vitamin compositions of the methanol leaf extracts of Cucumis sativus L. and Daucus carota L.

    Directory of Open Access Journals (Sweden)

    Essien Augustine Dick

    2016-08-01

    Full Text Available     Cucumis sativus  and Daucus carota are medicinal plants used in folkloric medicine to treat and prevent various diseases but the basis for this has not been highlighted. Quantitative phytochemicial analysis revealed the presence of anthocyanins, flavonoids, carotenoids and pyrrolidine in D. carota leaf methanol extract but in C. sativus only flavonoids and carotenoids was found present although in a lower amounts. Proximate analysis revealed  that both plants methanol leaf extracts contain moisture, protein, carbohydrate, fat, fiber and ash. The moisture content of C. sativus (95 ± 0.02% was more than that of D. Carota (82.20 ± 0.01% but the protein, carbohydrate, fat, ash and fiber contents of D. Carota was more than that of C. sativus. The mineral compositions also revealed the presence of Ca, P, Mg, Fe,Zn,Na, and K in both C.sativus and D. carota although in various proportions. The P, Ca, Mg, Fe and Na contents in D. carota were more than that of C. Sativus, but C. sativus has a higher Zn and K contents than D. carota. The vitamin analysis also revealed the presence of important vitamins including A, B1, B2,  B6 ,  C,E, niacin and folate. The vitamin A content of  D. carota were very high (2,901 ± 0.02µg compared to that of  C. Sativus (23 ± 0.01µg. These important macroelements, minerals and vitamins embedded in these important plants may be the reasons behind its use in forklore medicine for its various dietary and therapeutic applications.

  4. Differential Gene Expression in Response to Papaya ringspot virus Infection in Cucumis metuliferus Using cDNA- Amplified Fragment Length Polymorphism Analysis

    Science.gov (United States)

    Lin, Chia-Wei; Chung, Chien-Hung; Chen, Jo-Chu; Yeh, Shy-Dong; Ku, Hsin-Mei

    2013-01-01

    A better understanding of virus resistance mechanisms can offer more effective strategies to control virus diseases. Papaya ringspot virus (PRSV), Potyviridae, causes severe economical losses in papaya and cucurbit production worldwide. However, no resistance gene against PRSV has been identified to date. This study aimed to identify candidate PRSV resistance genes using cDNA-AFLP analysis and offered an open architecture and transcriptomic method to study those transcripts differentially expressed after virus inoculation. The whole genome expression profile of Cucumis metuliferus inoculated with PRSV was generated using cDNA-amplified fragment length polymorphism (cDNA-AFLP) method. Transcript derived fragments (TDFs) identified from the resistant line PI 292190 may represent genes involved in the mechanism of PRSV resistance. C. metuliferus susceptible Acc. 2459 and resistant PI 292190 lines were inoculated with PRSV and subsequently total RNA was isolated for cDNA-AFLP analysis. More than 400 TDFs were expressed specifically in resistant line PI 292190. A total of 116 TDFs were cloned and their expression patterns and putative functions in the PRSV-resistance mechanism were further characterized. Subsequently, 28 out of 116 candidates which showed two-fold higher expression levels in resistant PI 292190 than those in susceptible Acc. 2459 after virus inoculation were selected from the reverse northern blot and bioinformatic analysis. Furthermore, the time point expression profiles of these candidates by northern blot analysis suggested that they might play roles in resistance against PRSV and could potentially provide valuable information for controlling PRSV disease in the future. PMID:23874746

  5. Orthology Analysis and In Vivo Complementation Studies to Elucidate the Role of DIR1 during Systemic Acquired Resistance in Arabidopsis thaliana and Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Marisa Isaacs

    2016-05-01

    Full Text Available AtDIR1 (Defective in Induced Resistance1 is an acidic lipid transfer protein essential for systemic acquired resistance (SAR in Arabidopsis thaliana. Upon SAR induction, DIR1 moves from locally infected to distant uninfected leaves to activate defense priming; however, a molecular function for DIR1 has not been elucidated. Bioinformatic analysis and in silico homology modeling identified putative AtDIR1 orthologs in crop species, revealing conserved protein motifs within and outside of DIR1’s central hydrophobic cavity. In vitro assays to compare the capacity of recombinant AtDIR1 and targeted AtDIR1-variant proteins to bind the lipophilic probe TNS (6,P-toluidinylnaphthalene-2-sulfonate provided evidence that conserved leucine 43 and aspartic acid 39 contribute to the size of the DIR1 hydrophobic cavity and possibly hydrophobic ligand binding. An Arabidopsis–cucumber SAR model was developed to investigate the conservation of DIR1 function in cucumber (Cucumis sativus, and we demonstrated that phloem exudates from SAR-induced cucumber rescued the SAR defect in the Arabidopsis dir1-1 mutant. Additionally, an AtDIR1 antibody detected a protein of the same size as AtDIR1 in SAR-induced cucumber phloem exudates, providing evidence that DIR1 function during SAR is conserved in Arabidopsis and cucumber. In vitro TNS displacement assays demonstrated that recombinant AtDIR1 did not bind the SAR signals azelaic acid (AzA, glycerol-3-phosphate or pipecolic acid. However, recombinant CsDIR1 and CsDIR2 interacted weakly with AzA and pipecolic acid. Bioinformatic and functional analyses using the Arabidopsis–cucumber SAR model provide evidence that DIR1 orthologs exist in tobacco, tomato, cucumber, and soybean, and that DIR1-mediated SAR signaling is conserved in Arabidopsis and cucumber.

  6. Brassinosteroids-Induced Systemic Stress Tolerance was Associated with Increased Transcripts of Several Defence-Related Genes in the Phloem in Cucumis sativus.

    Directory of Open Access Journals (Sweden)

    Pingfang Li

    Full Text Available Brassinosteroids (BRs, a group of naturally occurring plant steroidal compounds, are essential for plant growth, development and stress tolerance. Recent studies showed that BRs could induce systemic tolerance to biotic and abiotic stresses; however, the molecular mechanisms by which BRs signals lead to responses in the whole plant are largely unknown. In this study, 24-epibrassinosteroid (EBR-induced systemic tolerance in Cucumis sativus L. cv. Jinyan No. 4 was analyzed through the assessment of symptoms of photooxidative stress by chlorophyll fluorescence imaging pulse amplitude modulation. Expression of defense/stress related genes were induced in both treated local leaves and untreated systemic leaves by local EBR application. With the suppressive subtractive hybridization (SSH library using cDNA from the phloem sap of EBR-treated plants as the tester and distilled water (DW-treated plants as the driver, 14 transcripts out of 260 clones were identified. Quantitative Real Time-Polymerase Chain Reaction (RT-qPCR validated the specific up-regulation of these transcripts. Of the differentially expressed transcripts with known functions, transcripts for the selected four cDNAs, which encode an auxin-responsive protein (IAA14, a putative ankyrin-repeat protein, an F-box protein (PP2, and a major latex, pathogenesis-related (MLP-like protein, were induced in local leaves, systemic leaves and roots after foliar application of EBR onto mature leaves. Our results demonstrated that EBR-induced systemic tolerance is accompanied with increased transcript of genes in the defense response in other organs. The potential role of phloem mRNAs as signaling components in mediating BR-regulated systemic resistance is discussed.

  7. A fragment substitution in the promoter of CsHDZIV11/CsGL3 is responsible for fruit spine density in cucumber (Cucumis sativus L.).

    Science.gov (United States)

    Zhang, Haiyang; Wang, Lina; Zheng, Shuangshuang; Liu, Zezhou; Wu, Xiaoqin; Gao, Zhihui; Cao, Chenxing; Li, Qiang; Ren, Zhonghai

    2016-07-01

    The indel in the promoter of CsHDZIV11 co-segregates with fruit spine density and could be used for molecular breeding in cucumber. Fruit spine density is an important quality trait for marketing in cucumber (Cucumis sativus L.). However, the molecular basis of fruit spine density in cucumber remains unclear. In this study, we isolated a mutant, few spines 1 (fs1), from CNS2 (wild type, WT), a North China-type cucumber with a high density of fruit spines. Genetic analysis showed that fs1 was controlled by a single recessive Mendelian factor. Bulked segregant analysis combined with genome resequencing were used for mapping fs1 in the F2 population derived from a cross between the fs1 mutant and WT, and it was located on chromosome 6 through association analysis. To develop more polymorphic markers to locate fs1, another F2 population was constructed from the cross between fs1 and 'Chinese long' 9930. Then, fs1 was narrowed down to a 110.4-kb genomic region containing 25 annotated genes. A fragment substitution was identified in the promoter region of Csa6M514870 between fs1 and WT. This fragment in fs1 was also present in wild cucumber. Csa6M514870 encodes a PDF2-related protein, a homeodomain-leucine zipper IV transcription factor (CsHDZIV11/CsGL3) sharing high identity and similarity with proteins related to trichome formation or epidermal cell differentiation. Quantitative reverse-transcription PCR revealed a higher expression level of CsHDZIV11 in young fruits from fs1 compared to WT. A molecular marker based on this indel co-segregated with the spine density. This work provides a solid foundation not only for understanding the molecular mechanism of fruit spine density, but also for molecular breeding in cucumber.

  8. Induction of cinnamate 4-hydroxylase and phenylpropanoids in virus-infected cucumber and melon plants.

    OpenAIRE

    Belles Albert, José Mª; López-Gresa, María Pilar; Fayos, J.; Pallás Benet, Vicente; Rodrigo Bravo, Ismael; Conejero Tomás, Vicente

    2008-01-01

    [EN] In the present work, we have looked for the nature of the phenylpropanoids biosynthesized during the plant-pathogen reaction of two systems, Cucumis sativus and Cucumis melo infected with either prunus necrotic ringspot virus (PNRSV) or melon necrotic spot virus (MNSV), respectively. An accumulation of p-coumaric, caffeic and/or ferulic acids was observed in infected plant extracts hydrolysed with P-glucosidase or esterase. Analysis of undigested samples by HPLC/ESI revealed that these c...

  9. Identification and characterization of potential NBS-encoding resistance genes and induction kinetics of a putative candidate gene associated with downy mildew resistance in Cucumis

    Directory of Open Access Journals (Sweden)

    Wan Hongjian

    2010-08-01

    Full Text Available Abstract Background Due to the variation and mutation of the races of Pseudoperonospora cubensis, downy mildew has in recent years become the most devastating leaf disease of cucumber worldwide. Novel resistance to downy mildew has been identified in the wild Cucumis species, C. hystrix Chakr. After the successful hybridization between C. hystrix and cultivated cucumber (C. sativus L., an introgression line (IL5211S was identified as highly resistant to downy mildew. Nucleotide-binding site and leucine-rich repeat (NBS-LRR genes are the largest class of disease resistance genes cloned from plant with highly conserved domains, which can be used to facilitate the isolation of candidate genes associated with downy mildew resistance in IL5211S. Results Degenerate primers that were designed based on the conserved motifs in the NBS domain of resistance (R proteins were used to isolate NBS-type sequences from IL5211S. A total of 28 sequences were identified and named as cucumber (C. sativus = CS resistance gene analogs as CSRGAs. Polygenetic analyses separated these sequences into four different classes. Quantitative real-time polymerase chain reaction (qRT-PCR analysis showed that these CSRGAs expressed at different levels in leaves, roots, and stems. In addition, introgression from C. hystrix induced expression of the partial CSRGAs in cultivated cucumber, especially CSRGA23, increased four-fold when compared to the backcross parent CC3. Furthermore, the expression of CSRGA23 under P. cubensis infection and abiotic stresses was also analyzed at different time points. Results showed that the P. cubensis treatment and four tested abiotic stimuli, MeJA, SA, ABA, and H2O2, triggered a significant induction of CSRGA23 within 72 h of inoculation. The results indicate that CSRGA23 may play a critical role in protecting cucumber against P. cubensis through a signaling the pathway triggered by these molecules. Conclusions Four classes of NBS-type RGAs were

  10. The Infection of Cucumber (Cucumis sativus L. Roots by Meloidogyne incognita Alters the Expression of Actin-Depolymerizing Factor (ADF Genes, Particularly in Association with Giant Cell Formation

    Directory of Open Access Journals (Sweden)

    Bin Liu

    2016-09-01

    Full Text Available Cucumber (Cucumis sativus L. is threatened by substantial yield losses due to the south root-knot nematode (Meloidogyne incognita. However, understanding of the molecular mechanisms underlying the process of nematode infection is still limited. In this study, we found that M. incognita infection affected the structure of cells in cucumber roots and treatment of the cytoskeleton inhibitor (cytochalasin D reduced root-knot nematode (RKN parasitism. It is known that Actin-Depolymerizing Factor (ADF affects cell structure, as well as the organization of the cytoskeleton. To address the hypothesis that nematode-induced abnormal cell structures and cytoskeletal rearrangements might be mediated by the ADF genes, we identified and characterized eight cucumber ADF (CsADF genes. Phylogenetic analysis showed that the cucumber ADF gene family is grouped into four ancient subclasses. Expression analysis revealed that CsADF1, CsADF2-1, CsADF2-2, CsADF2-3 (Subclass I and CsADF6 (Subclass III have higher transcript levels than CsADF7-1, CsADF7-2 (Subclass II genes and CsADF5 (Subclass IV in roots. Members of subclass I genes (CsADF1, CsADF2-1, CsADF2-2 and CsADF2-3, with the exception of CsADF2-1, exhibited a induction of expression in roots 14 days after their inoculation (DAI with nematodes. However, the expression of subclass II genes (CsADF7-1 and CsADF7-2 showed no significant change after inoculation. The transcript levels of CsADF6 (Subclass III showed a specific induction at 21 DAI, while CsADF5 (Subclass IV was weakly expressed in roots, but was strongly up-regulated as early as 7 DAI. In addition, treatment of roots with cytochalasin D caused an approximately two-fold down-regulation of the CsADF genes in the treated plants. These results suggest that CsADF gene mediated actin dynamics are associated with structural changes in roots as a consequence of M. incognita infection.

  11. The effects of different sewage sludge amendment rates on the heavy metal bioaccumulation, growth and biomass of cucumbers (Cucumis sativus L.).

    Science.gov (United States)

    Eid, Ebrahem M; Alrumman, Sulaiman A; El-Bebany, Ahmed F; Hesham, Abd El-Latif; Taher, Mostafa A; Fawy, Khaled F

    2017-07-01

    When sewage sludge is incorrectly applied, it may adversely impact agro-system productivity. Thus, this study addresses the reaction of Cucumis sativus L. (cucumber) to different amendment rates (0, 10, 20, 30, 40 and 50 g kg -1 ) of sewage sludge in a greenhouse pot experiment, in which the plant growth, heavy metal uptake and biomass were evaluated. A randomized complete block design with six treatments and six replications was used as the experimental design. The soil electrical conductivity, organic matter and Cr, Fe, Zn and Ni concentrations increased, but the soil pH decreased in response to the sewage sludge applications. As approved by the Council of European Communities, all of the heavy metal concentrations in the sewage sludge were less than the permitted limit for applying sewage sludge to land. Generally, applications of sewage sludge of up to 40 g kg -1 resulted in a considerable increase in all of the morphometric parameters and biomass of cucumbers in contrast to plants grown on the control soil. Nevertheless, the cucumber shoot height; root length; number of leaves, internodes and fruits; leaf area; absolute growth rate and biomass decreased in response to 50 g kg -1 of sewage sludge. All of the heavy metal concentrations (except the Cu, Zn and Ni in the roots, Mn in the fruits and Pb in the stems) in different cucumber tissues increased with increasing sewage sludge application rates. However, all of the heavy metal concentrations (except the Cr and Fe in the roots, Fe in the leaves and Cu in the fruits) were within the normal range and did not reach phytotoxic levels. A characteristic of these cucumbers was that all of the heavy metals had a bioaccumulation factor sewage sludge used in this study could be considered for use as a fertilizer in cucumber production systems in Saudi Arabia and can also serve as a substitute method of sewage sludge disposal. Graphical Abstract The effects of different sewage sludge amendment rates on the heavy

  12. Crítica e invenção nas poéticas de João Cabral de Melo Neto e Manoel de Barros DOI - 10.5752/P.2358-3428.2013v17n33p147

    Directory of Open Access Journals (Sweden)

    Luiz Hernrique Barbosa

    2013-12-01

    Full Text Available Partindo da hipótese de que as poéticas de João Cabral de Melo Neto e Manoel de Barros são guiadas por um traço comum, o da convergência entre poesia e crítica, este estudo mostra as especificidades de cada poeta ao produzir poesia crítica e textos críticos sobre poesia. Chega-se à conclusão de que essa convergência tem por objetivo apresentar a matéria de poesia dos poetas: a eleição do elemento prosaico. É ressaltado que os dois poetas, ao elevarem ao estatuto de poesia elementos pouco nobres, ao fazerem da crítica a matéria fundamental de sua poesia, estariam renovando uma poesia que não se vale de tais elementos.Palavras-chave: Crítica. Poesia. João Cabral de Melo Neto. Manoel de Barros.

  13. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    shyn

    2015-08-05

    Aug 5, 2015 ... of oils of Shea nut, Sesamum indicum, Cucurbita pepo,. Cucumis melo ..... 1.62 mgKOH/g) which is lower than that of olive oil 17. mgKOH/g (Oyedele ..... Oyedele AO (2002). The Skin Tolerance of Shea Fat Employed as.

  14. African Journal of Biotechnology - Vol 14, No 31 (2015)

    African Journals Online (AJOL)

    Comparative physico-chemical and proximate analysis of oils of Shea nut, Sesamum indicum, Cucurbita pepo, Cucumis melo seeds commonly cultivated in West Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CAT Ouattara, MK Somda, R Moyen, AS Traore ...

  15. Phenotypic and molecular evaluation of genetic diversity of rapeseed

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-05

    Oct 5, 2009 ... seed yield per plant, 1000-seed weight, oil content and protein content) were analyzed in a three-year ... regard to many characters of value for breeding process. (Cowling ..... tances determined by molecular markers and heterosis ..... Comparative analysis of cultivated melon groups (Cucumis melo L.).

  16. Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment

    DEFF Research Database (Denmark)

    Bernillon, Stéphane; Biais, Benoit; Deborde, Catherine

    2013-01-01

    Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non...

  17. Postharvest firmness behaviour of near-isogenic lines of melon

    NARCIS (Netherlands)

    Tijskens, L.M.M.; Dos-Santos, N.; Jowkar, M.M.; Obando-Ulloa, J.M.; Moreno, E.; Schouten, R.E.; Monforte, A.J.; Fernández-Trujillo, J.P.

    2009-01-01

    In two consecutive seasons the firmness of 13¿15 near-isogenic lines (NILs) of melons (Cucumis melo L.) was followed during storage at 21 °C. Firmness was measured using non-destructive compression of whole melon fruit to a predefined compression distance of 2 mm. The same individuals (about 6 per

  18. Metabolomic and elemental profiling of melon fruit quality as affected by genotype and environment

    NARCIS (Netherlands)

    Bernillon, S.; Biais, B.; Deborde, C.; Maucort, M.; Cabasson, C.; Gibon, Y.; Hansen, T.; Husted, S.; Vos, de R.C.H.; Mumm, R.; Jonker, H.; Ward, J.L.; Miller, S.J.; Baker, J.M.; Burger, J.; Tadmor, Y.; Beale, M.H.; Schjoerring, J.K.; Schaffer, A.; Rolin, D.; Hall, R.D.; Moing, A.

    2013-01-01

    Melon (Cucumis melo L.) is a global crop in terms of economic importance and nutritional quality. The aim of this study was to explore the variability in metabolite and elemental composition of several commercial varieties of melon in various environmental conditions. Volatile and non-volatile

  19. Metabolomics in melon: A new opportunity for aroma analysis

    NARCIS (Netherlands)

    Allwood, J.W.; Cheung, W.W.L.; Xu, Y.; Mumm, R.; Vos, de C.H.; Deborde, C.; Biais, B.; Maucourt, M.; Berger, Y.; Schaffer, A.; Rolin, D.; Moing, A.; Hall, R.D.; Goodacre, R.

    2014-01-01

    Cucumis melo fruit is highly valued for its sweet and refreshing flesh, however the flavour and value are also highly influenced by aroma as dictated by volatile organic compounds (VOCs). A simple and robust method of sampling VOCs on polydimethylsiloxane (PDMS) has been developed. Contrasting

  20. Comparative physico-chemical and proximate analysis of oils of ...

    African Journals Online (AJOL)

    In rural areas of developing countries like Burkina Faso, nutritive elements are mainly composed of vegetable source. Shea nut, seeds of Sesamum indicum, Cucumis melo and Cucurbita pepo, four species widely consumed were studied. The proximate parameters: moisture, proteins and fat were analysed. Saponification ...

  1. Plectosphaerella species associated with root and collar rots of horticultural crops in southern Italy

    NARCIS (Netherlands)

    Carlucci, A.; Raimondo, M.L.; Santos, J.; Phillips, A.J.L.

    2012-01-01

    Plectosphaerella cucumerina, most frequently encountered in its Plectosporium state, is well known as a pathogen of several plant species causing fruit, root and collar rot, and collapse. It is considered to pose a serious threat to melon (Cucumis melo) production in Italy. In the present study, an

  2. An insight into the sequential, structural and phylogenetic properties ...

    Indian Academy of Sciences (India)

    Prakash

    composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.

  3. African Journal of Biotechnology - Vol 10, No 34 (2011)

    African Journals Online (AJOL)

    ... microcephaly associated (ASPM) gene mutation is a major cause of primary ... Optimization of somatic embryogenesis induction in Iranian melon (Cucumis melo cv. ... related gene expression in response to enhanced UV-B radiation in Arabidopsis ... Exobiopolymer from polyhydroxyalkanoate-producing transgenic yeast ...

  4. Protection of melon plants against Cucumber mosaic virus infection ...

    African Journals Online (AJOL)

    This study was carried out to characterize a virus causing severe mosaic, yellowing, stunting and leaf deformation on melon (Cucumis melo L.), and evaluate the capacity of Pseudomonas fluorescens as biofertilizer to improve plant growth and restrict the accumulation of the virus in the plant. The virus was identified as an ...

  5. Serological and molecular detection and prevalence of Cucurbit ...

    African Journals Online (AJOL)

    During the 2009 growing seasons, virus-like symptoms were noticed on cucurbit crops (melons (Cucumis melo L.) and watermelons [Citrullus lanatus (Thunb.) Matsum and Nakai)] grown in the Sistan region. The symptoms were widespread and included initial chlorotic lesions followed by yellowing of whole leaves and ...

  6. Effects of foliar potassium fertilization on muskmelon fruit quality and yield

    Science.gov (United States)

    Consumer preference of many fruits and vegetables such as muskmelon [Cucumis melo L. (Reticulatus Group)] is determined by a few key quality traits such as sugar content, aroma and texture. These quality traits are directly related to adequate potassium (K) content in plant tissues. However, soil-...

  7. UM ESTUDO SOBRE A OBRA “FUNDAMENTOS DA POLÍTICA JURÍDICA” DE OSVALDO FERREIRA DE MELO, ATRAVÉS DOS ELEMENTOS DE PERCEPÇÃO JURÍDICA DA “TEORIA TRIDIMENSIONAL DO DIREITO” DE MIGUEL REALE

    OpenAIRE

    Lehmkuhl, Mílard Zhaf Alves

    2012-01-01

    O presente trabalho apresenta uma visão da obra “Fundamentos da Política Jurídica” de Osvaldo Ferreira de Melo a partir dos elementos de Percepção Jurídica, fato – valor – norma, colhidos da obra “Teoria Tridimensional do Direito” de Miguel Reale. O artigo se inicia com uma breve apresentação da obra “Fundamentos da Política Jurídica” e sobre os elementos de percepção jurídica da “Teoria Tridimensional do Direito”. Partindo dessa contextualização e dessa tridimensionalidade como ferramenta de...

  8. Reação de genótipos de meloeiro a Myrothecium Reaction of melon genotypes to Myrothecium roridum

    Directory of Open Access Journals (Sweden)

    Marissônia A Noronha

    2006-12-01

    Full Text Available A expansão da cultura do meloeiro (Cucumis melo L. no Nordeste brasileiro tem favorecido a ocorrência de doenças como o cancro-de-mirotécio, causado pelo fungo Myrothecium roridum. Visando selecionar genótipos com potencial de utilização nos programas de melhoramento e/ou no manejo integrado da doença, foram avaliados 150 genótipos de meloeiro. Plantas com 22 dias de idade, desenvolvidas em casa de vegetação, foram feridas no colo e inoculadas com uma suspensão do patógeno (3x10(6 conídios/ml. As avaliações foram realizadas diariamente, até seis dias após a retirada da câmara úmida, com o auxílio de uma escala descritiva de notas de 0 a 4. Com os dados da última avaliação, os genótipos foram distribuídos em cinco classes de reação à doença. Nenhum genótipo foi imune ou altamente resistente ao patógeno, enquanto 26,7% foram medianamente resistentes (MR e 73,3% foram suscetíveis (S ou altamente suscetíveis (AS. Esses resultados evidenciam a dificuldade na obtenção de fontes com elevados níveis de resistência a M. roridum. Os grupos Cantaloupe, Charentais, Gália e 'Indefinido' apresentaram a maior freqüência de genótipos com a reação MR e a menor freqüência de genótipos AS. A maioria dos genótipos dos grupos Valenciano Verde (66,7%, Cantaloupe (57,4%, Gália (60,0% e 'Indefinido' (53,8% foram S. Os genótipos 'PI 420149', 'Caroline', 'A3', 'Chilton' e 'PS-1 Pele de Sapo' apresentaram os menores valores de severidade final da doença e mostraram-se promissoras fontes de resistência ao patógeno e devem ser preferidos sob condições favoráveis à doença.The expansion of the melon (Cucumis melo L. fields in the Brazilian Northeast favored the occurrence of diseases such as the Myrothecium stem canker caused by the fungus Myrothecium roridum. In order to select genotypes with potential use in genetic breeding programs and in integrated disease management, 150 melon genotypes were evaluated. Twenty

  9. Acumulación de Grados-Día en un Cultivo de Pepino (Cucumis sativus L. en un Modelo de Producción Aeropónico Growing Degree Days Accumulation in a Cucumber (Cucumis sativus L. Crop Grown in an Aeroponic Production Model

    Directory of Open Access Journals (Sweden)

    Dubián Hoyos García

    2012-06-01

    Full Text Available Resumen. La temperatura tiene gran influencia sobre los cultivos y es clave en la determinación de la fecha de siembra, cosecha y las variables de producción. Los grados-día (GDD o unidades térmicas (HU son uno de los índices más comúnmente utilizados para estimar el desarrollo de las plantas y para predecir la fecha de cosecha. En el cultivo de pepino (Cucumis sativus L., el número de días desde la siembra hasta la cosecha depende del genotipo y su interacción con la temperatura ambiental. En este trabajo se estudiaron variables fenométricas que inciden sobre la eficiencia y producción de cultivos bajo un sistema aeropónico. Se determinó que se requirieron 726 y 660 grados-día, correspondientes a 73 y 64 días para los materiales comerciales Dasher II y Poinsset 76, respectivamente. Se analizó el efecto de dos periodos de riego 30 y 60 s, con un intervalo de aplicación de cuatro min durante el día, sobre las variables área foliar y peso seco de tallos y hojas en el híbrido Dasher II. No se encontraron diferencias significativas para los parámetros evaluados lo que indicó que el tiempo de 30 s representó una ventaja económica por el ahorro de energía. Se usaron tres soluciones nutritivas: Hoagland y Arnon, Aeropónicos 100% y Aeropónicos 50%, para determinar el efecto sobre el peso seco y el área foliar. Se encontró una reducción de las variables área foliar, materia seca acumulada en el tallo y las hojas, peso promedio de frutos (hasta 44,3% y número promedio de frutos, con la solución Aeropónicos al 50% de la concentración comercial. Los resultados permiten implementar variables de eficiencia en el cultivo aeropónico de pepino, las cuales inciden en el rendimiento, viabilidad económica y ambiental de la tecnología.Abstract. Plant growth and development is determined largely by weather which is composed by several factors. Temperature is one of such key factors which is very important for deciding sowing and

  10. Cucumis sativus L-type lectin receptor kinase (CsLecRK) gene family response to Phytophthora melonis, Phytophthora capsici and water immersion in disease resistant and susceptible cucumber cultivars.

    Science.gov (United States)

    Wu, Tingquan; Wang, Rui; Xu, Xiaomei; He, Xiaoming; Sun, Baojuan; Zhong, Yujuan; Liang, Zhaojuan; Luo, Shaobo; Lin, Yu'e

    2014-10-10

    L-type lectin receptor kinase (LecRK) proteins are an important family involved in diverse biological processes such as pollen development, senescence, wounding, salinity and especially in innate immunity in model plants such as Arabidopsis and tobacco. Till date, LecRK proteins or genes of cucumber have not been reported. In this study, a total of 25 LecRK genes were identified in the cucumber genome, unequally distributed across its seven chromosomes. According to similarity comparison of their encoded proteins, the Cucumis sativus LecRK (CsLecRK) genes were classified into six major clades (from Clade I to CladeVI). Expression of CsLecRK genes were tested using QRT-PCR method and the results showed that 25 CsLecRK genes exhibited different responses to abiotic (water immersion) and biotic (Phytophthora melonis and Phytophthora capsici inoculation) stresses, as well as that between disease resistant cultivar (JSH) and disease susceptible cultivar (B80). Among the 25 CsLecRK genes, we found CsLecRK6.1 was especially induced by P. melonis and P. capsici in JSH plants. All these results suggested that CsLecRK genes may play important roles in biotic and abiotic stresses. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Genetic diversity of cucumber estimated by morpho-physiological and EST-SSR markers.

    Science.gov (United States)

    Pandey, Sudhakar; Ansari, Waquar Akhter; Pandey, Maneesh; Singh, Bijendra

    2018-02-01

    In the present study, genetic variation among 40 cucumber genotypes was analyzed by means of morpho-physiological traits and 21 EST-SSR markers. Diversity was observed for morpho-physiological characters like days to 50% female flowering (37-46.9, number of fruits/plant (1.33-5.80), average fruit weight (41-333), vine length (36-364), relative water content (58.5-92.7), electrolyte leakage (15.9-37.1), photosynthetic efficiency (0.40-0.75) and chlorophyll concentration index (11.1-28.6). The pair wise Jaccard similarity coefficient ranged from 0.00 to 0.27 for quantitative traits and 0.24 to 0.96 for EST-SSR markers indicating that the accessions represent genetically diverse populations. With twenty-one EST-SSR markers, polymorphism revealed among 40 cucumber genotypes, number of alleles varied 2-6 with an average 3.05. Polymorphism information content varied from 0.002 to 0.989 (mean = 0.308). The number of effective allele (Ne), expected heterozygosity (He) and unbiased expected heterozygosity (uHe) of these EST-SSRs were 1.079-1.753, 0.074-0.428 and 0.074-0.434, respectively. Same 21 EST-SSR markers transferability checked in four other Cucumis species: snapmelon ( Cucumis melo var. momordica ), muskmelon ( Cucumis melo L.), pickling melon ( Cucumis melo var. conomon ) and wild muskmelon ( Cucumis melo var. agrestis ) with frequency of 61.9, 95.2, 76.2, and 76.2%, respectively. Present study provides useful information on variability, which can assist geneticists with desirable traits for cucumber germplasm utilization. Observed physiological parameters may assists in selection of genotype for abiotic stress tolerance also, EST-SSR markers may be useful for genetic studies in related species.

  12. Strobilurin and boscalid in the quality of net melon fruits

    Directory of Open Access Journals (Sweden)

    Ana Claudia Macedo

    2017-05-01

    Full Text Available Until recently, fungicides were used exclusively for disease control; however observations of physiological effects brought a new concept to the use of these products. Strobilurins have positive physiological effects on crop yield, due to the increase of liquid photosynthesis and better hormonal balance. However, boscalid complements the action of these fungicides, applied alternately or together. The aim of this study was to evaluate the effect of strobilurins (azoxystrobin and pyraclostrobin, boscalid and the mixture of these on the physical-chemical quality of net melon fruits (Cucumis melo var. Reticulatus. The experiment was conducted in the municipality of São Manuel (SP, using the hybrid of Cantaloupe M2-308 net melon, the experimental design was in randomized blocks with five replicates. The treatments used were: T1 - control; T2 - azoxystrobin 60g ha-1 of active principle (a.p.; T3 - boscalid 75g ha-1 of the a.p.; T4 - pyraclostrobin 50g ha-1 of the a.p.; T5 - boscalid (37,5g ha-1 of the a.p. + pyraclostrobin (25g ha-1 of the a.p. The first application of the treatments was carried out at fourteen days after the transplanting of the seedlings and the others at seven day intervals, totaling eight applications throughout the cycle. Two fruits of each plot were collected, which were identified for analysis in the laboratory. The following characteristics were evaluated: fresh fruit mass; mesocarp thickness, pulp texture, peel trajectory, pH, titratable acidity, soluble solids and the ratio. The results were submitted to analysis of variance and the averages compared by the Tukey test at 5% probability using the SISVAR program. The fruits of the plants treated with boscalid 75g ha-1 were the ones that showed higher concentration of soluble solids and low titratable acidity, resulting in a better ratio. Despite the lower value, the fruits of the plants treated with pyraclostrobin 50g ha-1 showed a high ratio value, besides presenting higher

  13. QUALIDADE FISIOLÓGICA E SANITÁRIA DE SEMENTES DE MELÃO UTILIZADAS NO PÓLO AGRÍCOLA ASSU-BARAÚNA-MOSSORÓ

    OpenAIRE

    Andreya Kalyana de Oliveira; Salvador Barros Torres; Rui Sales Júnior

    2008-01-01

    This research was conducted to evaluate the physiological and sanity quality of melon (Cucumis melo L.) seeds used in agricultural region Assu-Baraúna-Mosssó in the Rio Grande do Norte. For seed lots each from the hybrids Goldex and Vereda were used. Research was conducted at the Seed Analysis Laboratory and Irrigation Agricultural of the Department of Crop Science of the UFERSA from August 2006 to July 2007. The physiological quality was evaluated by the germination, first count germination,...

  14. TOXICITY OF INSECTICIDES USED IN MUSKMELON ON FIRST-INSTAR LARVAE OF Chrysoperla genanigra FREITAS (NEUROPTERA: CHRYSOPIDAE)

    OpenAIRE

    SILVA, BÁRBARA KARINE DE ALBUQUERQUE; GODOY, MAURÍCIO SEKIGUCHI DE; LIMA, ALRICÉLIA GOMES DE; OLIVEIRA, ANNA KÉZIA SOARES DE; PASTORI, PATRIK LUIZ

    2017-01-01

    ABSTRACT Brazil is one of the world's largest producers of melon (Cucumis melo L.), and Rio Grande do Norte and Ceará are the largest producers states of the country (99% of exports). This crop had great socio- economic importance in the Brazilian Northeast, however, it is affected by insect pests and consequently, large amounts of pesticides are applied to it, which greatly affect beneficial organisms, such as Chrysopidae. This bioassay evaluated the toxicity of nine insecticides used in com...

  15. Response of Cucumber (Cucumis sativus L

    African Journals Online (AJOL)

    user

    The growth and yield of cucumber (Cucumus sativus L.) in response to application of goat ... The main plot treatment was organic manure source (goat dung and poultry dropping) while ... manure useful and important in soil fertility maintenance is their impact on soil fertility ... scarce and high cost of mineral fertilizer.

  16. TECHNOLOGY TRANSFER FOR CUCUMBER (Cucumis sativus ...

    African Journals Online (AJOL)

    Dell

    2011-11-07

    Nov 7, 2011 ... affordable and sustainable Protected Intensive Produc- tion System (PIPS) to ... for the production and marketing of cucumber crop. MATERIALS AND ..... production, distribution, and consumption in Asia. {Mubarik A (ed.)}.

  17. Estudo comparativo da ação anti-helmíntica da batata de purga (Operculina hamiltonii e do melão de são caetano (Mormodica charantia em caprinos (Capra hircus naturalmente infectados Comparative study of the anti-helminthic action of the potato of purges (Operculina hamiltonii and the cantaloups of São Caetano (Mormodica charatia in naturally infected goats (Capra hircus

    Directory of Open Access Journals (Sweden)

    Luciano de Brito-Junior

    2011-08-01

    -helminthic action of the Operculina hamiltonii plants (potato of purges, Marmodica charantia (Cantaloups of Sao Caetano and of moxedctin at 0.2% about the natural helminthic infections of goats, there had been used 40 goats, without defined race, females, with age between six and 12 months, naturally infected, separated in four groups: GROUP 1 (G1 negative control animals treated with distilled water; GROUP 2 (G2 -animal treated with the alcoholic extract of O. hamiltonii; GROUP 3 (G3 - animal treated with the alcoholic extract of M. charantia and GROUP 4 (G4 - positive control animals treated with moxidectina at 0.2%. All of them had received the treatments for three days in a row. The feces samples were collected at: 0, 30 and 60 days after treatment, for the accomplishment of the egg counting per gram of excrements (EPG and larvae culture. To evaluate the effect of the treatments, a reduction on the egg counting per gram of excrements (RECE was applied. The RECE of the G2, G3 and G4 were: 63 and 90; 40 and 40; 100 and 100%, respectively for 30 and 60 days post-treatment, respectively. During the period of study it was observed that all collected samples were positive for larvae of helminths of the superfamily Trichostrongyloidea, except for the G4, throughout 30-60 days and post-treatment. The Haemonchus was the most prevalent parasite in the culture of feces.

  18. A biotransformation process for the production of cucurbitacin B from its glycoside using a selected Streptomyces sp.

    Science.gov (United States)

    Mei, Jianfeng; Li, Sha; Jin, Hang; Tang, Lan; Yi, Yu; Wang, Hong; Ying, Guoqing

    2016-09-01

    Cucurbitacin B (CuB) and its glycoside, cucurbitacin B 2-o-β-D-glucoside (CuBg), abundantly occur in the pedicels of Cucumis melo. Compared with CuB, CuBg is not efficiently extracted from the pedicels. Furthermore, the anticancer activity of CuBg is lower than that of the aglycone. A process for CuBg biotransformation to CuB was developed for the first time. A strain of Streptomyces species that converts CuBg into CuB was isolated from an enrichment culture of C. melo pedicels. After optimization of conditions for enzyme production and biotransformation, a maximum conversion rate of 92.6 % was obtained at a CuBg concentration of 0.25 g/L. When biotransformation was performed on C. melo pedicel extracts, the CuB concentration in the extracts increased from 1.50 to 3.27 g/L. The conversion rate was almost 100 %. The developed process may be an effective biotransformation method for industrial production CuB from C. melo pedicels for pharmaceuticals.

  19. Biological effects and application of proton beam (H+) implantation on melon seeds

    International Nuclear Information System (INIS)

    Sun Xun; Ren Ruixing; Meng Hui; Shi Jinguo; Tang Zhangxiong; Tao Xianping

    2006-01-01

    Various doses and energy of the proton beam (H + ) were used to treat dry seeds of melon (Cucumis melo L.). Results show that, the proton beam irradiation can induced structural variations of chromosomes and abnormal behaviors during mitosis and meiosis. The percentage of cells with chromosomal aberration increased with the increment of energy and dose of the proton. The micronuclei, chromosomal bridge and chromosomal fragments were included in chromosomal aberration. The proton beam was effective in inducing mutants of early maturity. A early maturity line T 63-1-17-8-1-3 was selected from the progenies of the seeds treated with the proton beam. (authors)

  20. Producción de melón y sandía en la Comarca Lagunera: un estudio de planeación para reducir la volatilidad de precios.

    OpenAIRE

    Ramírez Barraza, Brenda Aracely

    2014-01-01

    Actualmente los productores de melón (Cucumis melo L.) y sandía (Citrullus lanatus), productos que compiten por el uso de los recursos en la Comarca Lagunera, enfrentan el problema de bajos precios en los meses de junio, julio y agosto como consecuencia de la existencia de excesos de oferta temporales. Los excesos de oferta se originan por la concentración de la producción en algunos meses, o bien por dedicar una mayor superficie a alguno de los dos cultivos. Para analizar cómo cambios en l...

  1. Substrate and nutrient solution developed using a biodigestor effluent for melon cultivation

    OpenAIRE

    Villela Jr., Luiz V. E. [UNESP; De Araújo, Jairo A. C. [UNESP; Barbosa, José C. [UNESP; Perez, Luiz R.B.

    2007-01-01

    Buscando a sustentabilidade em uma pequena propriedade agrícola visou-se com o presente estudo, ao aproveitamento do efluente de biodigestor proveniente da fermentação anaeróbia de estrume bovino, no cultivo sem solo do meloeiro. O experimento foi conduzido em Jaboticabal, SP, Brasil, localizado na Latitude 21º 15- 22" S e Longitude 48º 18- 58" W. Cultivou-se o meloeiro (Cucumis melo L. cv. Bonus nº 2) em substrato, com semeadura realizada em outubro de 2003 e se utilizou delineamento experim...

  2. Parasitoide Opius sp. (Hymenoptera: Braconidae) no manejo integrado da mosca minadora na cultura do meloeiro

    OpenAIRE

    Nogueira, Carlos Henrique Feitosa

    2012-01-01

    Os estados do Rio Grande do Norte e Ceará são os principais produtores de melão do Brasil. São responsáveis por cerca de 90% da produção nacional, o que faz do cultivo do meloeiro Cucumis melo L. um dos principais segmentos da cadeia do agronegócio nesses estados. Apesar da alta tecnologia empregada para o cultivo desta olerícola, essa cultura vem sofrendo sérios danos devido ao ataque da mosca minadora Liriomyza sativae (Diptera: Agromyzidae). O método de controle utilizado pelos produtores ...

  3. Instrumental and sensory analyses of quality attributes of grafted specialty melons.

    Science.gov (United States)

    Guan, Wenjing; Zhao, Xin; Huber, Donald J; Sims, Charles A

    2015-11-01

    Soilborne disease management remains a great challenge in melon production with the phaseout of soil fumigant methyl bromide. Grafting has been shown to be an effective approach to control soilborne diseases. However, previous research has yielded mixed results regarding the impacts of rootstock on fruit quality. Very few studies have assessed melon quality attributes using both sensory evaluation and instrumental methods. Galia melon 'Arava' (Cucumis melo L. var. reticulatus Ser.) and honeydew melon 'Honey Yellow' (C. melo L. var. inodorus Naud.) were grafted onto commercial hybrid squash (Cucurbita maxima Duchesne × Cucurbita moschata Duchesne) rootstocks and root-knot nematode-resistant Cucumis metulifer E. Mey. ex Naud. rootstock. The grafting combinations were evaluated under different production conditions. Grafting with hybrid squash rootstocks resulted in reduced soluble solids content (SSC) and decreased sensory ratings of 'Arava' fruit. By contrast with grafted 'Arava', grafted 'Honey Yellow' did not exhibit significant differences in sensory properties and instrumental measurements regardless of production conditions and rootstock selection. The effects of grafting on fruit quality attributes differed between the two distinctive types of melon scion used. Potential negative impacts of rootstocks on melon fruit quality need to be considered in the selection and use of disease-resistant rootstocks. © 2014 Society of Chemical Industry.

  4. WATERMELON MOSAIC VIRUS OF PUMPKIN (Cucurbita maxima FROM SULAWESI: IDENTIFICATION, TRANSMISSION, AND HOST RANGE

    Directory of Open Access Journals (Sweden)

    Wasmo Wakmana

    2016-10-01

    Full Text Available A mosaic disease of pumpkin (Cucurbita maxima was spread widely in Sulawesi. Since the virus had not yet been identified, a study was conducted to identify the disease through mechanical inoculation, aphid vector transmission, host range, and electron microscopic test. Crude sap of infected pumpkin leaf samples was rubbed on the cotyledons of healthy pumpkin seedlings for mechanical inoculation. For insect transmission, five infective aphids were infected per seedling. Seedlings of eleven different species were inoculated mechanically for host range test. Clarified sap was examined under the electron microscope. Seeds of two pumpkin fruits from two different infected plants were planted and observed for disease transmission up to one-month old seedlings. The mosaic disease was transmitted mechanically from crude sap of different leaf samples to healthy pumpkin seedlings showing mosaic symptoms. The virus also infected eight cucurbits, i.e., cucumber (Cucumis sativus, green melon (Cucumis melo, orange/rock melon (C. melo, zucchini (Cucurbita pepo, pumpkin (Cucurbita maxima, water melon (Citrulus vulgaris, Bennicosa hispida, and blewah (Cucurbita sp.. Aphids  transmitted the disease from one to other pumpkin seedlings. The virus was not transmitted by seed. The mosaic disease of pumpkin at Maros, South Sulawesi, was associated with flexious particles of approximately 750 nm length, possibly a potyvirus, such as water melon mosaic virus rather than papaya ringspot virus or zucchini yellow mosaic virus.

  5. Chloroxyanion residues in cantaloupe and tomatoes after chlorine dioxide gas sanitation

    Science.gov (United States)

    Chlorine dioxide gas is effective at cleansing fruits and vegetables of bacterial pathogens and(or) rot organisms, but few data are available on chemical residues remaining subsequent to chlorine gas treatment. Therefore, studies were conducted to quantify chlorate and perchlorate residues after tom...

  6. Expression and epigenetic profile of protoplast cultures (Cucumis sativus L.)

    Czech Academy of Sciences Publication Activity Database

    Cápal, Petr; Ondřej, V.

    2014-01-01

    Roč. 50, č. 6 (2014), s. 789-794 ISSN 1054-5476 Institutional support: RVO:61389030 Keywords : SOMATIC EMBRYOGENESIS * DNA METHYLATION * CHROMATIN Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.981, year: 2014

  7. Genetic identification of a dwarf mutant in cucumber (Cucumis ...

    African Journals Online (AJOL)

    madam mine

    2012-03-08

    Mar 8, 2012 ... and 5% acetic acid, v/v (FAA). The samples were dehydrated in a graded ethanol series and were then embedded in paraffin after a transition through xylene. Thin sections (5 mm) of specimens from each sample for microscopic observation were cut by an ultramicrotome (PowerTome-XL, RMC, USA), ...

  8. Comparison of de novo assembly statistics of Cucumis sativus L.

    Science.gov (United States)

    Wojcieszek, Michał; Kuśmirek, Wiktor; Pawełkowicz, Magdalena; PlÄ der, Wojciech; Nowak, Robert M.

    2017-08-01

    Genome sequencing is the core of genomic research. With the development of NGS and lowering the cost of procedure there is another tight gap - genome assembly. Developing the proper tool for this task is essential as quality of genome has important impact on further research. Here we present comparison of several de Bruijn assemblers tested on C. sativus genomic reads. The assessment shows that newly developed software - dnaasm provides better results in terms of quantity and quality. The number of generated sequences is lower by 5 - 33% with even two fold higher N50. Quality check showed reliable results were generated by dnaasm. This provides us with very strong base for future genomic analysis.

  9. Diploidization of cucumber (Cucumis sativus L. haploids by colchicine treatment

    Directory of Open Access Journals (Sweden)

    Vesselina Nikolova

    2014-01-01

    Full Text Available Haploid cucumber plants are totally infertile and do not undergo spontaneous diploidization. The use of haploids depends on the possibility of doubling the chromosome number and the obtaining of stable doubled haploids (DH. Four haploids of different genotypes propagated vegetatively were treated with colchicine in order to obtain DH. The following procedures were used: 1 apical shoot meristem treatment, 2 soaking of shoot explants, 3 placing of shoot explants on medium with colchicine. Plants of the C1 generation were evaluated in respect to morphological and cytological characters and fertility. The best result of 20.9% DH was obtained after repeated treatment of the meristem with colchicine. A large group of chimeras (28.5% was also distinguished as were haploids and tetraploids. DH plants were fertile and gave uniform progeny. Chimeras had a decreased fertility and showed disturbances in meiotic divisions.

  10. in differentiation of selected species of Cucumis grown in Southern ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... series, Operon, USA) primers for amplification products. The PCR reaction was performed with 20 ng template DNA; Taq buffer with 1.5 mM MgCl2; dNTPs (1 mM/µl);. Taq polymerase (2 units); primer (5 pm); spermidine (20 mM) and reaction volume of 20 µl. Amplifications were performed on a. Eppendorf ...

  11. Resistance in Cucumis sativus L. to Tetranychus urticae Koch

    OpenAIRE

    Ponti, de, O.M.B.

    1980-01-01


    Chapter 1
    The role of plant breeding and particularly of host plant resistance in integrated control is discussed. Host plant resistance to insects and mites, especially to Tetranychus urticae is reviewed. A standard terminology for disease and pest resistance is recommended.

    Chapter 2
    The relationship between the twospotted spider mite and cucumber has been studied on plants and on leaf disks of a number of varieties with different...

  12. Resistance in Cucumis sativus L. to Tetranychus urticae Koch

    NARCIS (Netherlands)

    Ponti, de O.M.B.

    1980-01-01


    Chapter 1
    The role of plant breeding and particularly of host plant resistance in integrated control is discussed. Host plant resistance to insects and mites, especially to Tetranychus urticae is reviewed. A standard terminology for disease and pest

  13. TRANSFER OF METALS FROM SOIL TO Cucumis sativus FRUIT ...

    African Journals Online (AJOL)

    iudousoro

    and cadmium from shoot to leaf; and nickel and chromium from shoot to fruit. Generally ... The main human exposure route of all toxic metals in Eket was ..... The existential potential for nickel and lead contamination and toxicity raises the issue.

  14. BOTANICAL IDENTIFICATION AND GENETIC DIVERSITY IN MELONS FROM FAMILY FARMING IN THE STATE OF MARANHÃO

    Directory of Open Access Journals (Sweden)

    SIMONE DE SOUZA MACÊDO

    2017-01-01

    Full Text Available The aim of this work was to perform botanical identification and to estimate genetic diversity in two sequential inbred generations (progenies S1 and S2 of melon accessions from traditional agriculture in the state of Maranhão, in order to generate useful information for commercial melon breeding. Two field experiments were carried out in a completely randomized block, using four replicates of 15 accessions from a first selfing cycle in 2013, and three replicates of 25 subaccessions (generation S2 in 2014. Flower and fruit descriptors were measured to obtain quantitative and qualitative data, in addition to a systematized photographic documentation of fruit for visually comparing the progenies S1 and S2. Distance matrices for quantitative and qualitative data were obtained and used to perform a joint analysis and UPGMA method. Large genetic diversity was found in the accessions analysed, since the presence of melon progenies was observed in the Cucumis melo ssp. agrestis, with its botanical varieties momordica and conomom, and of the Cucumis melo ssp. melo, with the botanical varieties cantalupensis and chandalak. Divergence analysis showed the formation of three groups in generation S1 and four groups in S2. However, the groups were not separated either by subspecies or by botanical variety. Thus, in addition to the large genetic diversity among and within melon accessions from family farming in the state of Maranhão, the progenies presented a large introgression of traits of the different subspecies and their botanical varieties due to the reproductive system and seed management of these species.

  15. Formulation and quality control of a topical gel product for treatment of melasmaFormulation and quality control of a topical gel product for treatment of melasma

    Directory of Open Access Journals (Sweden)

    A. Ketabi

    2017-11-01

    Full Text Available Background and objectives: Melasma is one of the most common pigmentary disorders. It has a considerable impact on quality of life. The treatment of melasma has still remained a challenge because the efficient treatment has not been proven until now and there is still a need to find new depigmenting products.Allium cepa L. and Cucumis melo L. seeds as well as tragacanth have been introduced in Iranian traditional medicine (ITM as depigmenting agents. Moreover, modern studies have shown their antioxidant and inhibitory mushroom tyrosinase effect.In this study, a topical gel containing Allium cepa L. and Cucumis melo L. seeds extract was prepared with tragacanth and quality control evaluations have been accomplished. Method: After performing quality control of plants seeds and tragacanth according to pharmacopoeia, the ethanol extract of A. cepa and hydroalcoholic extract of C. melo seeds were prepared. An appropriate gel formulation was selected on the base of suitable viscosity. The gel product was formulated using 5% of each plant extracts in tragacanth gel base. In addition, the herbal gel was evaluated using pharmaceutical behavior such as physical appearance, pH, viscosity, spreadability as well as phenolics content. Results: The herbal gel product showed acceptable pharmaceutical behavior as well as considerable phenolic content (1.43±0.01 mg/g. Conclusion: The prepared topical gel product could be a good natural formulation candidate for clinical studies in the field of hyperpigmentation. Moreover, phenolic content of the product could be considered as an indicator for its quality control.

  16. Differential Colonization Dynamics of Cucurbit Hosts by Erwinia tracheiphila.

    Science.gov (United States)

    Vrisman, Cláudio M; Deblais, Loïc; Rajashekara, Gireesh; Miller, Sally A

    2016-07-01

    Bacterial wilt is one of the most destructive diseases of cucurbits in the Midwestern and Northeastern United States. Although the disease has been studied since 1900, host colonization dynamics remain unclear. Cucumis- and Cucurbita-derived strains exhibit host preference for the cucurbit genus from which they were isolated. We constructed a bioluminescent strain of Erwinia tracheiphila (TedCu10-BL#9) and colonization of different cucurbit hosts was monitored. At the second-true-leaf stage, Cucumis melo plants were inoculated with TedCu10-BL#9 via wounded leaves, stems, and roots. Daily monitoring of colonization showed bioluminescent bacteria in the inoculated leaf and petiole beginning 1 day postinoculation (DPI). The bacteria spread to roots via the stem by 2 DPI, reached the plant extremities 4 DPI, and the plant wilted 6 DPI. However, Cucurbita plants inoculated with TedCu10-BL#9 did not wilt, even at 35 DPI. Bioluminescent bacteria were detected 6 DPI in the main stem of squash and pumpkin plants, which harbored approximately 10(4) and 10(1) CFU/g, respectively, of TedCu10-BL#9 without symptoms. Although significantly less systemic plant colonization was observed in nonpreferred host Cucurbita plants compared with preferred hosts, the mechanism of tolerance of Cucurbita plants to E. tracheiphila strains from Cucumis remains unknown.

  17. First cytogenetic record for a species of Otothyropsis Ribeiro, Carvalho & Melo, 2005 (Loricariidae, Hypoptopomatinae

    Directory of Open Access Journals (Sweden)

    Carlos Alexandre Fernandes

    Full Text Available ABTRACT Hypoptopomatinae is a monophyletic subfamily that includes 147 species, distributed in 20 genera. Otothyropsis is a genus of Hypoptopomatinae, recently described. Here, we provided the first cytogenetic information of Otothyropsis . The specimens were collected from córrego Dourado, a small tributary of rio Iguatemi, which flows into rio Paraná. The specimens of Otothyropsis cf. polyodon were analyzed with respect to diploid number, C-Band and Ag-NOR patterns. The diploid number was 54 chromosomes, distributed in 18 metacentric, 28 submetacentric, and 8 subtelocentric chromosomes, with single Ag-NOR and conspicuous heterochromatic blocks on the short and long arms of the 24th pair of chromosomes. Our study highlights the conservation trend of the diploid number (2n=54 and fundamental number (FN = 108 among the species of Hypoptopomatinae. However, the karyotype formula (18m+28sm+8st seems to be specific to O. cf. polyodon , considering the other Hypoptopomatinae species already analyzed.

  18. Poesia e Morte: João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Maiara Knihs

    2011-12-01

    Full Text Available A obsessão formal aliada à obsessão de certas imagens, ou, como prefere o próprio poeta, de algumas ideias fixas, são uma marca da obra cabralina. Marca da obsessão na e pela escritura. Incluindo, ainda que de maneira menos acentuada, os primeiros livros em que experimenta, muito via digestão da poesia de Murilo Mendes e de Carlos Drummond de Andrade, certo surrealismo – como é o caso do livro Pedra do sono e do poema dramático Os três mal amados – passando pelo auge do seu construtivismo – no caso de O engenheiro e de Psicologia da composição – a poesia do poeta pernambucano trabalha essa obsessão colocando em jogo pelo menos dois grandes fantasmas: o nordeste brasileiro e o sul espanhol. Essas imagens se desdobram em outras imagens – a pedra, a seca, a plantação de cana, os cemitérios do nordeste e, ao mesmo tempo, correspondem à dança flamenca, ao canto à palo-seco, à tauromaquia sevilhanas.

  19. The Challenge of Peat Substitution in Organic Seedling Production: Optimization of Growing Media Formulation through Mixture Design and Response Surface Analysis.

    Directory of Open Access Journals (Sweden)

    Francesco Giovanni Ceglie

    Full Text Available Peat replacement is an increasing demand in containerized and transplant production, due to the environmental constraints associated to peat use. However, despite the wide information concerning the use of alternative materials as substrates, it is very complex to establish the best materials and mixtures. This work evaluates the use of mixture design and surface response methodology in a peat substitution experiment using two alternative materials (green compost and palm fibre trunk waste for transplant production of tomato (Lycopersicon esculentum Mill.; melon, (Cucumis melo L.; and lettuce (Lactuca sativa L. in organic farming conditions. In general, the substrates showed suitable properties for their use in seedling production, showing the best plant response the mixture of 20% green compost, 39% palm fibre and 31% peat. The mixture design and applied response surface methodology has shown to be an useful approach to optimize substrate formulations in peat substitution experiments to standardize plant responses.

  20. Effect of freeze-drying on the antioxidant compounds and antioxidant activity of selected tropical fruits.

    Science.gov (United States)

    Shofian, Norshahida Mohamad; Hamid, Azizah Abdul; Osman, Azizah; Saari, Nazamid; Anwar, Farooq; Dek, Mohd Sabri Pak; Hairuddin, Muhammad Redzuan

    2011-01-01

    The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L.), mango (Mangifera indica L.), papaya (Carica papaya L.), muskmelon (Cucumis melo L.), and watermelon Citruluss lanatus (Thunb.) were investigated. Significant (p dried fruit samples, except muskmelon. There was no significant (p > 0.05) change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested.

  1. The Antioxidant and Antihaemolytic Activities and the Polyphenolic Contents of Some Plants Seeds Extracts

    International Nuclear Information System (INIS)

    Atrooz, O.; Harb, M.; Al-Qato, M.

    2007-01-01

    Results of the this study which were carried out on yhe ethanol and acetone extracts of Prunus armeniaca, Cerasus vulgare, Nespole, Opuntia ficus-indica, Cucumis melo, and Vitis vinifera proved that theses extracts contain bioctive substances such as polyohenols and flavonids. The UV-VIS spectropgotometric assays showed that the extracted materials posses strong band in the range between 250-300 nm which confirm the presence of polyphenols and flavonoids. The concentration of these materials were different depending on the type pf plant seeds and the solvents used for extraction. The antioxidant and antihaemolytic activities of the extracts were determined by 1, 1-dipheny1-2picry1-hydeazy1 (DPPH) method, and red blood cells (RBCs) haemolysis test. Results of these extracts showed remarkable antioxidant activities depending on the origin of plant extracts. (Author's) 23 refs., 4 Tabs., 1fig

  2. Biological and molecular characterization of Brazilian isolates of Zucchini yellow mosaic virus

    Directory of Open Access Journals (Sweden)

    David Marques de Almeida Spadotti

    2015-02-01

    Full Text Available Zucchini yellow mosaic virus (ZYMV causes substantial economic losses in cucurbit crops. Although ZYMV has been present in Brazil for more than 20 years, there is little information about the biological and molecular characteristics of the isolates found in the country. This study aimed to characterize the experimental hosts, pathotypes and genetic diversity of a collection of eleven Brazilian ZYMV isolates within the coat protein gene. For biological analysis, plant species from Amaranthaceae, Chenopodiaceae, Cucurbitaceae, Fabaceae, Solanaceae, and Pedaliaceae were mechanically inoculated and pathotypes were identified based on the reaction of a resistant Cucumis melo, accession PI414723. All of the cucurbit species/varieties and Sesamum indicum were systemically infected with all isolates. The nucleotide sequence variability of the coat protein gene ranged from 82 % to 99 % compared to the corresponding sequences of ZYMV isolates from different geographical locations. No recombination event was detected in the coat protein gene of the isolates.

  3. Evaluation of an analytical methodology using QuEChERS and GC-SQ/MS for the investigation of the level of pesticide residues in Brazilian melons.

    Science.gov (United States)

    da Silva Sousa, Jonas; de Castro, Rubens Carius; de Albuquerque Andrade, Gilliane; Lima, Cleidiane Gomes; Lima, Lucélia Kátia; Milhome, Maria Aparecida Liberato; do Nascimento, Ronaldo Ferreira

    2013-12-01

    A multiresidue method based on the sample preparation by modified QuEChERS and detection by gas chromatography coupled to single quadruple mass spectrometers (GC-SQ/MS) was used for the analysis of 35 multiclass pesticides in melons (Cucumis melo inodorus) produced in Ceara-Brazil. The rates of recovery for pesticides studied were satisfactory (except for the etridiazole), ranging from 85% to 117% with a relative standard deviation (RSD) of less than 15%, at concentrations between 0.05 and 0.20 mg kg(-1). The limit of quantification (LOQ) for most compounds was below the MRLs established in Brazil. The combined relative uncertainty (Uc) and expanded uncertainty (Ue) was determined using repeatability, recovery and calibration curves data for each pesticide. Analysis of commercial melons samples revealed the presence of pesticides bifenthrin and imazalil at levels below the MRLs established by ANVISA, EU and USEPA. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Proteogenomics data for deciphering Frankia coriariae interactions with root exudates from three host plants

    Directory of Open Access Journals (Sweden)

    Guylaine Miotello

    2017-10-01

    Full Text Available Frankia coriariae BMG5.1 cells were incubated with root exudates derived from compatible (Coriaria myrtifolia, incompatible (Alnus glutinosa and non-actinorhizal (Cucumis melo host plants. Bacteria cells and their exoproteomes were analyzed by high-throughput proteomics using a Q-Exactive HF high resolution tandem mass spectrometer incorporating an ultra-high-field orbitrap analyzer. MS/MS spectra were assigned with two protein sequence databases derived from the closely-related genomes from strains BMG5.1 andDg1, the Frankia symbiont of Datisca glomerata. The tandem mass spectrometry data accompanying the manuscript describing the database searches and comparative analysis (Ktari et al., 2017, doi.org/10.3389/fmicb.2017.00720 [1] have been deposited to the ProteomeXchange with identifiers PXD005979 (whole cell proteomes and PXD005980 (exoproteome data.

  5. Cucurbits depicted in Byzantine mosaics from Israel, 350–600 ce

    Science.gov (United States)

    Avital, Anat; Paris, Harry S.

    2014-01-01

    Background and Aims Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Results and Conclusions Twenty-three mosaics dating from 350–600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round–pyriform and probably used as vessels. PMID:24948671

  6. Cucurbits depicted in Byzantine mosaics from Israel, 350-600 ce.

    Science.gov (United States)

    Avital, Anat; Paris, Harry S

    2014-08-01

    Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Twenty-three mosaics dating from 350-600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round-pyriform and probably used as vessels. © The Author 2014. Published by Oxford University Press on behalf of

  7. Appearance and overall acceptability of fresh-cut cantaloupe pieces from whole melon treated with wet steam process

    Science.gov (United States)

    Minimally processed fresh-cut fruits have a limited shelf-life because of deterioration caused by spoilage microflora and changes in physiological processes. Whole melons were inoculated with 7 log CFU/ml of each bacterium (Salmonella, Escherichia coli O157:H7 and Listeria monocytogenes) and then t...

  8. Cooling parameters for fruits and vegetables of different sizes in a hydrocooling system

    Directory of Open Access Journals (Sweden)

    Teruel Bárbara

    2004-01-01

    Full Text Available The cooling of fruits and vegetables in hydrocooling system can be a suitable technique. This work aimed to define cooling time for fruits and vegetables of different sizes, presenting practical indexes that could be used to estimate cooling time for produce with similar characteristics. Fruits (orange melon-Cucumis melo, mango-Mangifera indica, guava-Psidium guajava, orange-Citrus sinensis Osbeck, plum-Prunus domestica, lime-Citrus limon, and acerola-Prunus cerasus and vegetables (cucumber-Cucumis sativus, carrot-Daucus carota, and green bean-Phaseolus vulgaris, were cooled in a hydrocooling system at 1°C. The volume of fruits and vegetables ranged between 8.18 cm³ and 1,150.35 cm³, and between 13.06 cm³ and 438.4 cm³, respectively. Cooling time varied proportionally to produce volume (from 8.5 to 124 min for fruits, and from 1.5 to 55 min, for vegetables. The relationship between volume and time needed to cool fruits (from 1.03 min cm-3 to 0.107 min cm-3 and vegetables (from 0.06 min cm-3 to 0.12 min cm-3 is an index that could be used to estimate cooling time for fruits and vegetables with similar dimensions as those presented in this work.

  9. De novo comparative transcriptome analysis of genes involved in fruit morphology of pumpkin cultivars with extreme size difference and development of EST-SSR markers.

    Science.gov (United States)

    Xanthopoulou, Aliki; Ganopoulos, Ioannis; Psomopoulos, Fotis; Manioudaki, Maria; Moysiadis, Theodoros; Kapazoglou, Aliki; Osathanunkul, Maslin; Michailidou, Sofia; Kalivas, Apostolos; Tsaftaris, Athanasios; Nianiou-Obeidat, Irini; Madesis, Panagiotis

    2017-07-30

    The genetic basis of fruit size and shape was investigated for the first time in Cucurbita species and genetic loci associated with fruit morphology have been identified. Although extensive genomic resources are available at present for tomato (Solanum lycopersicum), cucumber (Cucumis sativus), melon (Cucumis melo) and watermelon (Citrullus lanatus), genomic databases for Cucurbita species are limited. Recently, our group reported the generation of pumpkin (Cucurbita pepo) transcriptome databases from two contrasting cultivars with extreme fruit sizes. In the current study we used these databases to perform comparative transcriptome analysis in order to identify genes with potential roles in fruit morphology and fruit size. Differential Gene Expression (DGE) analysis between cv. 'Munchkin' (small-fruit) and cv. 'Big Moose' (large-fruit) revealed a variety of candidate genes associated with fruit morphology with significant differences in gene expression between the two cultivars. In addition, we have set the framework for generating EST-SSR markers, which discriminate different C. pepo cultivars and show transferability to related Cucurbitaceae species. The results of the present study will contribute to both further understanding the molecular mechanisms regulating fruit morphology and furthermore identifying the factors that determine fruit size. Moreover, they may lead to the development of molecular marker tools for selecting genotypes with desired morphological traits. Copyright © 2017. Published by Elsevier B.V.

  10. Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.

    Science.gov (United States)

    Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani

    2015-06-01

    Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Genome-Wide Analysis of Simple Sequence Repeats in Bitter Gourd (Momordica charantia

    Directory of Open Access Journals (Sweden)

    Junjie Cui

    2017-06-01

    Full Text Available Bitter gourd (Momordica charantia is widely cultivated as a vegetable and medicinal herb in many Asian and African countries. After the sequencing of the cucumber (Cucumis sativus, watermelon (Citrullus lanatus, and melon (Cucumis melo genomes, bitter gourd became the fourth cucurbit species whose whole genome was sequenced. However, a comprehensive analysis of simple sequence repeats (SSRs in bitter gourd, including a comparison with the three aforementioned cucurbit species has not yet been published. Here, we identified a total of 188,091 and 167,160 SSR motifs in the genomes of the bitter gourd lines ‘Dali-11’ and ‘OHB3-1,’ respectively. Subsequently, the SSR content, motif lengths, and classified motif types were characterized for the bitter gourd genomes and compared among all the cucurbit genomes. Lastly, a large set of 138,727 unique in silico SSR primer pairs were designed for bitter gourd. Among these, 71 primers were selected, all of which successfully amplified SSRs from the two bitter gourd lines ‘Dali-11’ and ‘K44’. To further examine the utilization of unique SSR primers, 21 SSR markers were used to genotype a collection of 211 bitter gourd lines from all over the world. A model-based clustering method and phylogenetic analysis indicated a clear separation among the geographic groups. The genomic SSR markers developed in this study have considerable potential value in advancing bitter gourd research.

  12. José Bento Leite Ferreira de Melo, padre e político o Liberalismo moderado no extremo sul de Minas Gerais José Bento Leite Ferreira de Melo, priest and politic moderated Liberalism in the Minas southern

    Directory of Open Access Journals (Sweden)

    Isaías Pascoal

    2007-06-01

    Full Text Available Este artigo procura explicitar a trajetória política do Pe. José Bento Leite Ferreira de Mello. Após atuar em várias legislaturas como deputado, foi escolhido senador em 1834 pela Regência. José Bento foi, por mais de 20 anos, um dos mais importantes representantes políticos do sul de Minas. Sua ação foi ampla. Padre, vereador, jornalista, criador de Partido Liberal em várias vilas do sul de Minas, criador da Sociedade Defensora da Independência e Liberdade Nacional, deputado e, finalmente, senador. Tornou-se o mais expressivo articulador político dos interesses da elite sul-mineira na Corte, ao mesmo tempo em que a engajava nos desafios da luta pela constituição do Estado Nacional brasileiro na versão desejada pelos liberais moderados.This article intent to show the politic trajectory of Pe. José Bento Leite Ferreira de Mello. After acting in various legislatures as deputy, he was chosen senator in 1834 by the Regency. José Bento was, for over 20 years, one of the most important politic representative of the south of Minas. His action was wide. Priest, counselor, journalist, creator of Liberal Party in different villages of the south of Minas, creator of the Protector Society of Independency and National Freedom, deputy and, finally, senator. He became the most expressive politic articulator of the south-miner elite in the Corte, at the same time that he was engaging it in the challenges of the fight for the constitution of the Brazilian National State in the version desired by the moderated liberals.

  13. Protagonistas na Terapia Ocupacional brasileira: as memórias de Virgílio Cordeiro de Melo Filho/ Protagonists in brazilian occupational therapy: the memories of Virgílio Cordeiro de Melo Filho

    Directory of Open Access Journals (Sweden)

    Amara Lúcia Holanda Tavares Battistel

    2017-04-01

    Full Text Available Entrevista concedida para a composição da tese de doutorado intitulada História de Vida de Professores de Terapia Ocupacional: Três vidas, três histórias, quatro cantos do Brasil.

  14. Paratextos Cabralinos: uma Sugestão de Leitura da Obra de João Cabral de Melo Neto

    Directory of Open Access Journals (Sweden)

    Marcelo dos Santos

    2011-12-01

    Full Text Available Ao se tomar conhecimento da vida em arquivo do poeta, é (quase impossível não tecer, ainda que fantasmal e esquematicamente, a teia de relações do poeta, de amizades (e inimizades, de afinidades (e de incompatibilidades, de diálogos prováveis e improváveis. Reler a obra poética de Cabral a partir de uma ida aos arquivos significa reconhecer rastros de uma grafia que essa vida em arquivo inevitavelmente territorializa, como por exemplo acontece com as dedicatórias, epígrafes e demais citações, que ganham reforço significativo quando superpostas à troca de cartas com seus correspondentes, aos diálogos registrados em entrevistas, aos depoimentos etc. De certa forma, ressignificar essas partículas que Genette (2009 denomina de paratextos deve interessar ao leitor, a esse novo leitor que lê a vida espelhada no texto, sem necessariamente confundir-se na leitura do texto como espelho da vida.

  15. ¡Tómelo o déjelo! Evidencia experimental sobre racionalidad, preferencias sociales y negociación

    Directory of Open Access Journals (Sweden)

    Luis Alejandro Palacio García

    2015-01-01

    Full Text Available El juego del ultimátum ha permitido entender mejor el poder de negociación asociado a una amenaza, tema en el cual la información y la comunicación son centrales. Este artículo presenta una revisión selectiva de la literatura sobre experimentos económicos en el juego del ultimátum, organizando los principales avances de la teoría al incorporar la evidencia empírica en este contexto. Los resultados de estos experimentos han mostrado que las personas se desvían sistemáticamente de la predicción teórica; de hecho, se encontró que los proponentes hacen ofertas cercanas a la repartición equitativa y los receptores suelen rechazar las ofertas que consideran injustas. Indiscutiblemente, este juego se ha ganado un espacio central en la economía del comportamiento, por lo que la revisión aquí realizada será de gran utilidad para los investigadores que estén trabajando tanto en negociación como en economía experimental.

  16. Cucumber (Cucumis sativus L.) embryo development in situ after pollination with irradiated pollen

    International Nuclear Information System (INIS)

    Faris, N.M.; Niemirowicz-Szczytt, K.

    1999-01-01

    Embryological studies were undertaken to compare the normal development of cucumber endosperm and embryo with that observed after pollination with gamma-irradiated pollen (0.1 and 0.3 kGy). Delayed penetration of the pollen tube occurred at both irradiation doses. Endosperm and embryo development was also delayed, but was initiated within 6 days after pollination in 100% of embryo sacs at 0.1 kGy and in 70-80% at 0.3 kGy. Various abnormalities in endosperm and embryo cell structure confirmed progressive degeneration, which occurred earlier with the higher dose of irradiation. Degeneration increased dramatically; only 30-40% of the embryos reached the globular stage 15 days after pollination. (author)

  17. Genome-wide analysis of WRKY gene family in Cucumis sativus.

    Science.gov (United States)

    Ling, Jian; Jiang, Weijie; Zhang, Ying; Yu, Hongjun; Mao, Zhenchuan; Gu, Xingfang; Huang, Sanwen; Xie, Bingyan

    2011-09-28

    WRKY proteins are a large family of transcriptional regulators in higher plant. They are involved in many biological processes, such as plant development, metabolism, and responses to biotic and abiotic stresses. Prior to the present study, only one full-length cucumber WRKY protein had been reported. The recent publication of the draft genome sequence of cucumber allowed us to conduct a genome-wide search for cucumber WRKY proteins, and to compare these positively identified proteins with their homologs in model plants, such as Arabidopsis. We identified a total of 55 WRKY genes in the cucumber genome. According to structural features of their encoded proteins, the cucumber WRKY (CsWRKY) genes were classified into three groups (group 1-3). Analysis of expression profiles of CsWRKY genes indicated that 48 WRKY genes display differential expression either in their transcript abundance or in their expression patterns under normal growth conditions, and 23 WRKY genes were differentially expressed in response to at least one abiotic stresses (cold, drought or salinity). The expression profile of stress-inducible CsWRKY genes were correlated with those of their putative Arabidopsis WRKY (AtWRKY) orthologs, except for the group 3 WRKY genes. Interestingly, duplicated group 3 AtWRKY genes appear to have been under positive selection pressure during evolution. In contrast, there was no evidence of recent gene duplication or positive selection pressure among CsWRKY group 3 genes, which may have led to the expressional divergence of group 3 orthologs. Fifty-five WRKY genes were identified in cucumber and the structure of their encoded proteins, their expression, and their evolution were examined. Considering that there has been extensive expansion of group 3 WRKY genes in angiosperms, the occurrence of different evolutionary events could explain the functional divergence of these genes.

  18. Effect of adding wood vinegar on cucumber (Cucumis sativus L) seed germination

    Science.gov (United States)

    Lei, Ming; Liu, Bingjie; Wang, Xiao

    2018-03-01

    Wood vinegar, a liquid by-product that was obtained from the condensed vapor generated during the biomass pyrolysis, had been reported as plant growth promotor, but the impact on the plant seeds was still not clear. Thus, we investigated the effects of wood vinegar on the germination and seedling growth of cucumber seeds through the germination experiments. The results showed that the different diluted wood vinegar addition showed no significant difference in the germination rates of cucumber seeds compared to those of the CK treatment (P > 0.05). However, the added wood vinegar at the 10000-time dilution significantly increased the root length and dry biomass of cucumber by 20.9 % and 5.92 %, respectively (P < 0.05). Therefore, the wood vinegar at an optimal time of dilution could be used a promising soaking agent for the seeds germination, and further enhance crop yields.

  19. Selection Of Suitable Particle Size And Particle Ratio For Japanese Cucumber Cucumis Sativus L. Plants

    Directory of Open Access Journals (Sweden)

    Galahitigama GAH

    2015-08-01

    Full Text Available This study was conducted to select the best particle size of coco peat for cucumber nurseries as well as best particle ratio for optimum plant growth and development of cucumber. The experiment was carried out in International Foodstuff Company and Faculty of Agriculture University of Ruhuna Sri Lanka during 2015 to 2016. Under experiment one three types of different particle sizes were used namely fine amp88040.5mm T2 medium 3mm-0.5mm T3 and coarse 4mm T4 with normal coco peat T1 as treatments. Complete Randomized Design CRD used as experimental design with five replicates. Germination percentage number of leaves per seedling seedling height in frequent day intervals was taken as growth parameters. Analysis of variance procedure was applied to analyze the data at 5 probability level. The results revealed that medium size particle media sieve size 0.5mm -3mm of coco peat was the best particle size for cucumber nursery practice when considered the physical and chemical properties of medium particles of coco peat. In the experiment of selecting of suitable particle ratio for cucumber plants the compressed mixture of coco peat particles that contain 70 ww unsieved coco peat 20 ww coarse particles and 10 ww coconut husk chips 5 12mm has given best results for growth performances compared to other treatments and cucumber grown in this mixture has shown maximum growth and yield performances.

  20. Alleviation of cadmium toxicity in cucumber (Cucumis sativus) seedlings by the application of selenium

    International Nuclear Information System (INIS)

    Sun, H.; Wang, X.; Wang, Y.; Wei, T.; Wang, G.

    2016-01-01

    In the present study, the role of selenium in cadmium toxicity was investigated in cucumber seedlings by hydroponic experiments. The application of Se for cucumber exposed to Cd significantly reduced Cd accumulation in all tissues, elevated Cd-depressed chlorophyll content, and improved photosynthetic performance. External Se significantly reduced ·OH, H2O2 and malondialdehyde content. Exogenous Se balanced Cd-depressed elements (e.g., Se enhanced Cd-induced decreases in root Zn, leaf/stem/root Mn concentrations) and carbohydrate contents. External Se also significantly decreased the Cd-induced increases in Na+K+-, Ca2+Mg2+- and total ATPase activities, which recovered almost to control level. Results indicate that application of Se can alleviate Cd toxicity in cucumber seedlings by reducing Cd uptake and reactive oxygen species (ROS) accumulation, moreover protecting photosynthetic machinery from damaging, balancing elements and carbohydrate contents, and improving ATPase activities in cucumber.

  1. Response to chilling in cucumber (Cucumis sativus L. plants treated with triacontanol and Asahi SL.

    Directory of Open Access Journals (Sweden)

    Edward Borowski

    2012-12-01

    Full Text Available In pot experiments on cucumber cv. Śremski F1, the effect of short-term chilling on plants earlier treated with triacontanol (TRIA and Asahi SL was investigated. These plants were grown in a phytotron at an air temperature of 27/22°C (day/night, using fluorescent light with far flux density of 220 µmol × m-2 × s-1, with a photoperiod 16/8. At the 4th true leaf stage, the respective experimental series were sprayed with: 1 H2O - control, 2 TRIA 0.01, 3 TRIA 0.1, 4 TRIA 1.0 mg × dm-3, 5 Asahi SL 0.2, 6 Asahi SL 0.3%. After 24 hours one half of the plants from each experimental series was treated for a period of 3 days at a temperature of 12/6°C, with all the other growth conditions unchanged. The obtained results have shown that short-term chilling stress caused a significant increase in electrolyte leakage, free proline content and in the activity of guaiacol peroxidase in leaves, but a decrease in chlorophyll a+b content, stomatal conductance, transpiration, photosynthesis, leaf area and in the activity of catalase in leaves. The application of TRIA or ASAHI SL on leaves in the pre-stress period reduced the values of the traits which had been increased as a result of chilling and increased those which had reduced. Generally, TRIA was most effective at a concentration of 0.1 mg × dm-3, and Asahi SL at a concentration of 0.3%.

  2. Impact of Methyl Jasmonate on Enhancing Chilling Tolerance of Cucumber (Cucumis sativus L. Seedlings

    Directory of Open Access Journals (Sweden)

    F. Saydpour

    2016-12-01

    Full Text Available Cucumber is a warm season crop that suffers from chilling injury at temperatures below 10°C. In recent years, jasmonates have been used for reduction of chilling injuries in plants. An experiment was, therefore, conducted to test whether methyl jasmonate (MeJA application at various concentrations (0, 0.05, 0.1 and 0.15 mM through seed soaking or foliar spray would protect cucumber seedlings, subjected to chilling stress. Results showed that MeJA application decreased chilling index, ion leakage, malondialdehyde content and hydrogen peroxide free radical and increased growth parameters, proline contents, chlorophylls contents and antioxidant activity. Although, seed soaking method provided better protection compared to foliar spray method, the highest cold tolerance was obtained with 0.15mM MeJA application in both application methods that caused low level of chilling index (1.67, malondialdehyde content (0.11 nm g-1 FW, hydrogen peroxide free radical (0.22 nm g-1 FW and ion leakage (32.87%. In general, it may be concluded that MeJA could be used effectively to protect cucumber seedling from damaging effects of chilling stress at the early stages of growth.

  3. The effect of exogenous spermidine on cucumber plant (Cucumis sativus L. growth in drought stress

    Directory of Open Access Journals (Sweden)

    Zbyszek K. Blamowski

    2013-12-01

    Full Text Available The effect of exogenous spermidine (0; 1 and 2 mmol·dm-3 on cucumber plant subjected lo seven day drought (30% f.w.c. were studied. Growth rate of plants, gas exchange, chlorophyll fluorescence, water saturation deficit in tissue (WSD. leakage electrolytes (El as well as the content of free proline were determined. The results showed that drought inhibited growth and gas exchange, decreased the potential efficiency of PSII (Fv/Fm but increased the value of WSD, EL and the level of free proline in tissue. The spermidine treatment of plants immediately before drought influenced the decrease concentration of free proline, water deficit and leakage of electrolytes but the increase of stomatal conductance (gs, intensity of photosynthesis (Pn and transpiration (E. Greater change on the course of primary photosynthetic reactions in PSII (Fv/Fm., ΦPSII, qP, qN were not detected. The autors concluded, that in drought. conditions exogenous speimidine together with proline induced by stress, contribute to increase of water content in tissue and maintenance of the enzymatic activity of cells as well as they guaIantee the integrity of cell membranes. Profitable effect of spermidine on the condition of cucumber in drought period shorted the time necessary for plants to come back to level of control treatment.

  4. Alleviation of cadmium toxicity in cucumber (Cucumis sativus) seedlings by the application of selenium

    Energy Technology Data Exchange (ETDEWEB)

    Sun, H.; Wang, X.; Wang, Y.; Wei, T.; Wang, G.

    2016-07-01

    In the present study, the role of selenium in cadmium toxicity was investigated in cucumber seedlings by hydroponic experiments. The application of Se for cucumber exposed to Cd significantly reduced Cd accumulation in all tissues, elevated Cd-depressed chlorophyll content, and improved photosynthetic performance. External Se significantly reduced ·OH, H2O2 and malondialdehyde content. Exogenous Se balanced Cd-depressed elements (e.g., Se enhanced Cd-induced decreases in root Zn, leaf/stem/root Mn concentrations) and carbohydrate contents. External Se also significantly decreased the Cd-induced increases in Na+K+-, Ca2+Mg2+- and total ATPase activities, which recovered almost to control level. Results indicate that application of Se can alleviate Cd toxicity in cucumber seedlings by reducing Cd uptake and reactive oxygen species (ROS) accumulation, moreover protecting photosynthetic machinery from damaging, balancing elements and carbohydrate contents, and improving ATPase activities in cucumber.

  5. Gamma irradiation effect on seeds of various Cucumis sativus L. genotypes

    International Nuclear Information System (INIS)

    Zagorcheva, L.; Aleksandrova, M.

    1987-01-01

    Air dry seeds of the three cucumber cultivar types: with long fruits (Velina F 1 , Gergana and Starozagorski Langi), with moderately long fruits (Bistrenski) and with short fruit (Addis, K-2, line 22a, G-3 and Pobeda F 1 ), as well as the reciprocal crosses of Bistrenski and Gergana were 60C o gamma irradiated (200, 300, 400 and 500 Gy; 6 Gy/min). In order to study whether the great differences in radiosensitivity were genetically determined, the reciprocal hybrids between the radiosensitive cv. Bistrenski and the radioresistant parent cv. Gergana were investigated. The seeds were sown in flats, filled with moist perlite. The plants were grown in nutrient solution under controlled conditions for 8 h and 12 h. Radiosensitivity, expressed as depression coefficient, was determined by the criteria germination, survival and pollen sterility (for various cultivars) and plant and root weight (for reciprocal crosses). It was found that the reaction of different cultivars and cultivar types to radiation treatment was strictly specific. Short-fruited cultivars were with higher radioresistance. The day length modified radiosensitivity. The reaction of short-fruited cultivars to environmental changes was more pronounced. A positive correlation existed between radiosensitivity and chromosome aberration frequency in cucumbers. The presence of a lipid layer beneath the seed cover conditioned the greater radioresistance of cucumbers. The hybrids Bistrenski/Gergana were more radioresistant in F 1 and F 2 than the parent with higher radioresistance. The differences between the hybrids and the radioresistant parent were statistically significant and this fact proved the presence of genetic control. All radiosensitivity criteria in F 1 were influenced by heterosis. The inheritance of radiosensitivity was overdominant. 1 fig.; 5 tabs.; 16 refs

  6. Cucumber plants (cucumis sativus l.) growth and crop yield of chicken manure fertilized with plant spacing

    Science.gov (United States)

    Pratiwi Aritonang, Sri; Panjaitan, Ernitha; Parsaulian Tondang, Fetrus

    2018-03-01

    The research was conducted in Tanjung Sari, Kecamatan Medan Selayang Kotamadya Medan ± 32 meters above sea level. It started since July 2016 to September 2016. It was designed with randomization block design with two factorial experiments which are chicken manure and plant spacing. First factor was 4 doses of chicken manure, symbolized by K; K0 = 1.5 kg/plot, K1 = 2 kg/plot, K2 = 2.5 kg/plot and K3 = 3 kg/plot. Second was 4 different plant spacing, symbolized by J; J0 = 30 cm x 60 cm, J1 =: 35 cm x 60 cm, J2 = 40 cm x 60 cm and J3 = 45 cm x 60 cm. The result shows that giving 3kg/plot of chicken manure increases plant height to 162.15 cm with 22.44 number of leaves. Fresh fruits per sample was weight 1121.88 g and per plot is 4.52 kg with 9.17 and 36.67 units of fruits per sample and plot respectively. With 45 cm x 60 cm (J3) for plant spacing gives a plant with the height of 160.51 cm and 22.85 number of leaves. Fresh fruits obtained is 1216.67 g and 9.33 units per sample while per plot gives 4.90 kg and 7.33 units of fresh fruits. This plant spacing leads to a better output for the yield compared to narrower spacing. There are no interaction between chicken manure dosage and plant spacing towards plant height, number of leaves, fresh fruits weight and units per sample and plot.

  7. Fraksi Kloroform Ekstrak Buah Mentimun (Cucumis sativus L.) Sebagai Anti Bakteri terhadap Staphylococcus epidermidis

    OpenAIRE

    Pratika Viogenta; Samsuar Samsuar; Ahmad Ferry Yeriza Utama

    2017-01-01

    The use of antibiotics in the community massively trigger resistance to bacteria, to that need for research on other alternatives, especially herbal medicine as an antibacterial. One of the medicinal plants are cucumbers that are widely available in Indonesia. The purpose of this study was to scientifically prove the antibacterial activity of chloroform fraction cucumber extract against Staphylococcus epidermidis. Extraction cucumber done by maceration, then extract fractionated with chlorofo...

  8. Fraksi Kloroform Ekstrak Buah Mentimun (Cucumis sativus L. Sebagai Anti Bakteri terhadap Staphylococcus epidermidis

    Directory of Open Access Journals (Sweden)

    Pratika Viogenta

    2017-08-01

    Full Text Available The use of antibiotics in the community massively trigger resistance to bacteria, to that need for research on other alternatives, especially herbal medicine as an antibacterial. One of the medicinal plants are cucumbers that are widely available in Indonesia. The purpose of this study was to scientifically prove the antibacterial activity of chloroform fraction cucumber extract against Staphylococcus epidermidis. Extraction cucumber done by maceration, then extract fractionated with chloroform. The fraction was used the concentration of 5%, 10%, 15%, 20% and 25%. Then tested the antibacterial power and determination of the MIC. Results of test antibacterial of the extract chloroform of cucumber against S. epidermidis showed a zone of inhibition at concentrations of 5%, 10%, 15%, 20%, 25% diameter respectively 5.86 mm, 6.5 mm, 7.05 mm, 7.43 mm, and 9.92 mm, in addition to it tested the determination of minimum inhibitory concentration, minimum inhibitory concentrations of chloroform fraction extract cucumber fruit against S. epidermidis is at a concentration of 3%. The results obtained from the culture media growth on NA which means the fraction of the chloroform extract of cucumber in 3% is bacteriostatic.

  9. Genetic and environmental effects on production of spontaneous tetraploids in cucumber (Cucumis sativus L.)

    Science.gov (United States)

    The appearance of spontaneous tetraploid (4x) plants is a serious problem for cucumber growers and the seed industry. These plants produce unacceptable fruits with poor quality that do not meet market standards, and result in substantial losses. A higher frequency of spontaneous 4x plants has been a...

  10. [Effects of exogenous spermidine on Cucumis sativus L. seedlings photosynthesis under root zone hypoxia stress].

    Science.gov (United States)

    Wang, Tian; Wang, Suping; Guo, Shirong; Sun, Yanjun

    2006-09-01

    With water culture, this paper studied the effects of exogenous spermidine (Spd) on the net photosynthetic rate (Pn), intercellular CO2 concentrations (Ci), stomatal conductance (Gs), transpiration rate (Tr), apparent quantum yield (phi c), and carboxylation efficiency (CE) of cucumber seedlings tinder hypoxia stress. The results showed that the Pn decreased gradually under hypoxia stress, and reached the minimum 10 days after by 63. 33% of the control. Compared with that of hypoxia-stressed plants, the Pn after 10 days application of exogenous Spd increased 1.25 times. A negative correlation (R2 = 0.4730 - 0.7118) was found between Pn and Ci. Gs and Tr changed in wider ranges, which decreased under hypoxia-stress, but increased under hypoxia-stress plus exogenous Spd application. There was a significant positive correlation between Gs and Tr (R2 = 0.7821 - 0.9458), but these two parameters had no significant correlation with Pn; Hypoxia stress induced a decrease of phi c and CE by 63.01% and 72.33%, respectively, while hypoxia stress plus exogenous Spd application made phi c and CE increase by 23% and 14%, respectively. The photo-inhibition of cucumber seedlings under hypoxia stress was mainly caused by non-stomatal limitation, while exogenous Spd alleviated the hypoxia stress by repairing photosynthesis system.

  11. Structure, evolution and functional inference on the Mildew Locus O (MLO) gene family in three cultivated Cucurbitaceae spp.

    Science.gov (United States)

    Iovieno, Paolo; Andolfo, Giuseppe; Schiavulli, Adalgisa; Catalano, Domenico; Ricciardi, Luigi; Frusciante, Luigi; Ercolano, Maria Raffaella; Pavan, Stefano

    2015-12-29

    The powdery mildew disease affects thousands of plant species and arguably represents the major fungal threat for many Cucurbitaceae crops, including melon (Cucumis melo L.), watermelon (Citrullus lanatus L.) and zucchini (Cucurbita pepo L.). Several studies revealed that specific members of the Mildew Locus O (MLO) gene family act as powdery mildew susceptibility factors. Indeed, their inactivation, as the result of gene knock-out or knock-down, is associated with a peculiar form of resistance, referred to as mlo resistance. We exploited recently available genomic information to provide a comprehensive overview of the MLO gene family in Cucurbitaceae. We report the identification of 16 MLO homologs in C. melo, 14 in C. lanatus and 18 in C. pepo genomes. Bioinformatic treatment of data allowed phylogenetic inference and the prediction of several ortholog pairs and groups. Comparison with functionally characterized MLO genes and, in C. lanatus, gene expression analysis, resulted in the detection of candidate powdery mildew susceptibility factors. We identified a series of conserved amino acid residues and motifs that are likely to play a major role for the function of MLO proteins. Finally, we performed a codon-based evolutionary analysis indicating a general high level of purifying selection in the three Cucurbitaceae MLO gene families, and the occurrence of regions under diversifying selection in candidate susceptibility factors. Results of this study may help to address further biological questions concerning the evolution and function of MLO genes. Moreover, data reported here could be conveniently used by breeding research, aiming to select powdery mildew resistant cultivars in Cucurbitaceae.

  12. Potencial de vida útil pós-colheita de quatro genótipos de melão tipo Galia Potential of postharvest shelf life of four genotypes of Galia type melons

    Directory of Open Access Journals (Sweden)

    Patrícia Lígia Dantas de Morais

    2004-12-01

    Full Text Available Avaliou-se o potencial de vida útil pós-colheita de melões (Cucumis melo L. tipo Galia (genótipos Primal, Solarking, Total e Vicar. Utilizou-se o delineamento inteiramente casualizado em esquema fatorial 4 (genótipos x 4 (tempos de armazenamento: 0, 3, 6 e 9 dias, com três repetições. Os frutos foram colhidos no estádio de maturação IV (predominantemente amarelo e armazenados à temperatura de 20 ± 1ºC e umidade relativa de 50 ± 2%. O genótipo Solarking apresentou uma firmeza média de polpa superior aos demais, do inicio ao final do período de armazenamento. Em todos os genótipos, os valores de sólidos solúveis no início do armazenamento encontraram-se dentro da faixa aceitável para comercialização no mercado externo, havendo pouca variação com o decorrer do período de armazenamento. A aparência interna limitou o tempo de vida útil pós-colheita do genótipo Total em apenas seis dias. Os genótipos Solarking, Vicar e Primal apresentaram maior potencial na conservação pós-colheita, principalmente o híbrido Solarking, que chegou aos nove dias de armazenamento com boa aparência interna.The postharvest life span of Galia (genotypes Primal, Solarking, Total, and Vicar melons (Cucumis melo L. was evaluated by a four (genotypes x four (storage periods: 0, 3, 6, and 9 days factorial experiment, in a completely randomized design with three replications. The fruits were harvested at maturation stage IV (yellow color predominance, and stored under 20 ± 1ºC and HR 50 ± 2%. Solarking's average firmness was better than that of the other genotypes during the experimental period. At the beginning of the experiment all genotypes had soluble solids contents at the level (eight to ten percent required for exportation, with these levels varying slightly during storage. The internal aspect limited to six days the postharvest life span of genotype Total. Solarking, Vicar, and Primal showed great postharvest conservation potential

  13. Concentração de nitrogênio na solução nutritiva e número de frutos sobre a qualidade de frutos de melão Nitrogen concentration in nutrient solution and number of fruits on quality of melon fruits

    Directory of Open Access Journals (Sweden)

    Luis Felipe Villani Purquerio

    2005-07-01

    Full Text Available O trabalho foi conduzido em ambiente protegido, na UNESP-FCAV, em Jaboticabal (SP, de junho a novembro de 2001, com o objetivo de avaliar a qualidade dos frutos do meloeiro (Cucumis melo var. reticulatus, híbrido Bônus nº2, cultivado em sistema hidropônico NFT, em função da concentração de nitrogênio na solução nutritiva (80; 140; 200 e 300 mg L-1 e do número de fruto por planta (2; 3; 4 e livre. O delineamento experimental foi de blocos ao acaso, em parcelas subdivididas, com seis repetições. O teor de sólidos solúveis totais e acidez total titulável foram maiores em frutos colhidos de plantas com menor número de frutos pré-estabelecidos. O aumento da concentração de N na solução nutritiva proporcionou aumento na acidez total titulável e nenhum efeito sobre o teor de sólidos solúveis totais. Houve redução nos diâmetros longitudinal, transversal e na espessura do mesocarpo com o aumento da concentração de N, bem como com o aumento do número de frutos por planta. O índice de formato de fruto manteve-se igual ou muito próximo a 1.The effect of nitrogen concentrations (80; 140; 200 and 300 mg L-1 and fruit number per plant (2; 3; 4 and free setting, on the quality of net melon fruits (Cucumis melo var. reticulatus, Bonus nº 2 hybrid was investigated. The experiment was carried out at UNESP-FCAV, Jaboticabal, Brazil, using a NFT hydroponic system, from June to November/2001. The experimental design was of randomized split plots, with six replications. Total soluble solids content and total acidity were higher in fruits harvested from plants with a smaller number of pre-set fruits. A slight increase was observed on total acidity due to the increase of nitrogen concentration in nutrient solution, without any significant effect on total soluble solids. An increase of the N concentration and the number of fruits per plant resulted in a reduction of fruit longitudinal and transversal diameters and pulp thickness. Fruit

  14. Caracterização morfológica e dissimilaridade genética entre variedades crioulas de melão Morphological characterization and genetic dissimilarity in melon landraces

    Directory of Open Access Journals (Sweden)

    Raquel Silviana Neitzke

    2009-12-01

    Full Text Available Variedades crioulas de melão (Cucumis melo são cultivadas no Sul do Brasil para consumo familiar e também para comercialização dos frutos. No entanto, existe uma carência de trabalhos relativos a sua caracterização. Este trabalho teve por objetivo caracterizar e avaliar a variabilidade genética de variedades crioulas de melão do Sul do Brasil mantidos no Banco Ativo de Germoplasma de Cucurbitáceas da Embrapa Clima Temperado. Foram caracterizados 14 acessos utilizando 26 descritores morfológicos de fruto. Os dados foram analisados pelos métodos de agrupamento de Tocher e hierárquico UPGMA. Os métodos de agrupamento foram parcialmente concordantes. O acesso C88 possui características distintas, ficando isolado dos demais, pois é o único entre todos os avaliados que apresenta formato piriforme e sem gomos, cor de epicarpo creme, cor de polpa branca e ruptura profunda no fruto. Existe grande variabilidade genética, para caracteres de frutos, nas variedades crioulas de melão conservadas nesse Banco Ativo de Germoplasma, com potencial para uso no melhoramento genético, destacando-se o acesso C71 por possuir sabor adocicado e polpa de cor laranja e o C72, por apresentar elevados valores de peso de fruto e espessura de polpa.Melon landraces (Cucumis melo are cultivated in South of Brazil for family consumption and also for marketing fruits. However, there is a lack of works related to characterization of these landraces. The objective of this work was to characterize and evaluate genetic variability of melon landraces from South of Brazil which are maintained in the Cucurbitaceae Genebank at Embrapa Clima Temperado, trough morphological characterization. Fourteen accessions were characterized in 26 morphological fruit descriptors. Data were analyzed by Tocher grouping method and UPGMA hierarchical. The two methods agreed partially. The accession C88 has unique characteristics, being isolated when compared to the other accessions, it

  15. Divergência genética entre cinco genótipos de melão rendilhado Genetic divergence among five muskmelon cultivars

    Directory of Open Access Journals (Sweden)

    Adriana Antonieta do Nascimento Rizzo

    2002-06-01

    Full Text Available Estimou-se a divergência genética entre cinco genótipos de melão rendilhado (Cucumis melo var. reticulatus Naud. (JAB-20, JAB-21, JAB-22, JAB-23 e 'Bônus nº 2' e determinou-se qual a contribuição relativa das 16 características avaliadas [nº médio de flores masculinas, hermafroditas/planta; produção total de frutos/m², peso médio dos frutos comerciáveis; diâmetro médio transversal e longitudinal do fruto (DMTF e DMLF; diâmetro médio transversal da inserção do pedúculo (DMTP; espessura média do mesocarpo e epicarpo (EMM e EME; diâmetro médio longitudinal e transversal do lóculo (DMTL e DMLL; proporção da cavidade (PC; desprendimento de sementes (DS; teor de sólidos solúveis totais (SST, pH e acidez titulável (AT] na divergência gen��tica. Obtiveram-se dois grupos de similaridade: I- JAB-20, JAB-21 e 'Bônus nº2' e II- JAB-22 e JAB-23. As características DMLF, DMTP, DMLL, DS e SST foram as que mais contribuíram para a divergência genética entre os genótipos.The genetic divergence of five cultivars of muskmelon was estimated (Cucumis melo var. reticulatus Naud (JAB-20, JAB-21, JAB-22, JAB-23 and 'Bônus nº2' and the relative contribution of each 16 characteristics were determined (number of male flowers per plant; total production of fruit, weight of fruits; longitudinal and transversal diameters of fruits; thickness and color of flesh and skin; longitudinal and transversal loculos diameter of fruits; seed loosing; netting thickness; and % total solvers solids, pH and total acidity in genetic divergence. Two groups of similarity were formed between the genitors by the values of D², one of then was constituted of the JAB-20 and JAB-21 and 'Bônus nº 2' genotypes, and another of the JAB-22 and JAB-23. The characteristics of longitudinal loculos diameters, longitudinal diameter of fruits, transversal diameter of peduncle insertion, % total solvers solids and seed loosing contributed to for genetic

  16. Fungal species that cause powdery mildew in greenhouse-grown cucumber and melon in Paraná State, Brazil=Espécies de fungos que causam oídio em casas de vegetação cultivadas com pepino e melão no Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Dauri José Tessmann

    2012-07-01

    Full Text Available The powdery mildew caused by Oidium spp. is an important disease for several crops of the Cucurbitaceae family. Although the teleomorphs, Podosphaera xanthii and Golovinomyces cichoracearum, currently have already been described as the causal agents of powdery mildew in Brazil, only P. xanthii is considered the main causal agent of powdery mildew field epidemics. The objective of this work was to identify and determine the prevalence of the species causing powdery mildew in cucumber (Cucumis sativus and melon (Cucumis melo var. reticulatus grown in greenhouses in the State of Paraná in Brazil. The morphological traits of the conidial stages, such as the presence of fibrosin bodies and a germinative tube, were used to identify the species. Leaves exhibiting high severity of powdery mildew were collected from plants of 13 plastic greenhouses during different seasons in 2003/2004 and in different regions of Paraná State. In all environments, a significant prevalence of P. xanthii (80-100% was observed affecting parthenocarpic or ordinary cucumber and melon. Golovinomyces cichoracearum was observed in six greenhouses, with up to 20% of conidia of this species on the samples.O oidio, causado por Oidium sp. é uma importante doença para espécies de plantas cultivadas da família das cucurbitáceas. Apesar das espécies teleomórficas Podosphaera xanthii e Golovinomyces cichoracearum já terem sido citadas como causadoras de oídio no Brasil, geralmente em trabalhos publicados atualmente tem-se referenciado somente a P. xanthii como agente causal dessa doença em cucurbitáceas em cultivo convencional. Por isso, este trabalho teve como objetivo identificar e quantificar a freqüência de ocorrência dessas duas espécies causadoras de oídio nas culturas de pepino (Cucumis sativus e melão nobre (Cucumis melo var. reticulatus conduzidas em estufas plásticas no Estado do Paraná. Para a identificação de P. xanthii e G. cichoracearum utilizaram

  17. Genetic and virulence variability among Erwinia tracheiphila strains recovered from different cucurbit hosts.

    Science.gov (United States)

    Rojas, E Saalau; Dixon, P M; Batzer, J C; Gleason, M L

    2013-09-01

    The causal agent of cucurbit bacterial wilt, Erwinia tracheiphila, has a wide host range in the family Cucurbitaceae, including economically important crops such as muskmelon (Cucumis melo), cucumber (C. sativus), and squash (Cucurbita spp.). Genetic variability of 69 E. tracheiphila strains was investigated by repetitive-element polymerase chain reaction (rep-PCR) using BOXA1R and ERIC1-2 primers. Fingerprint profiles revealed significant variability associated with crop host; strains isolated from Cucumis spp. were clearly distinguishable from Cucurbita spp.-isolated strains regardless of geographic origin. Twelve E. tracheiphila strains isolated from muskmelon, cucumber, or summer squash were inoculated onto muskmelon and summer squash seedlings, followed by incubation in a growth chamber. Wilt symptoms were assessed over 3 weeks, strains were reisolated, and rep-PCR profiles were compared with the inoculated strains. Wilting occurred significantly faster when seedlings were inoculated with strains that originated from the same crop host genus (P<0.001). In the first run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon seedlings at a median of 7.8 and 5.6 days after inoculation (dai), respectively. Summer squash seedlings wilted 18.0, 15.7, and 5.7 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. In a second run of the experiment, cucumber and muskmelon strains caused wilting on muskmelon at 7.0 and 6.9 dai, respectively, whereas summer squash seedlings wilted at 23.6, 29.0 and 9.0 dai when inoculated with muskmelon-, cucumber-, and squash-origin strains, respectively. Our results provide the first evidence of genetic diversity within E. tracheiphila and suggest that strain specificity is associated with plant host. This advance is a first step toward understanding the genetic and population structure of E. tracheiphila.

  18. Alkaline stress and iron deficiency regulate iron uptake and riboflavin synthesis gene expression differently in root and leaf tissue: implications for iron deficiency chlorosis.

    Science.gov (United States)

    Hsieh, En-Jung; Waters, Brian M

    2016-10-01

    Iron (Fe) is an essential mineral that has low solubility in alkaline soils, where its deficiency results in chlorosis. Whether low Fe supply and alkaline pH stress are equivalent is unclear, as they have not been treated as separate variables in molecular physiological studies. Additionally, molecular responses to these stresses have not been studied in leaf and root tissues simultaneously. We tested how plants with the Strategy I Fe uptake system respond to Fe deficiency at mildly acidic and alkaline pH by measuring root ferric chelate reductase (FCR) activity and expression of selected Fe uptake genes and riboflavin synthesis genes. Alkaline pH increased cucumber (Cucumis sativus L.) root FCR activity at full Fe supply, but alkaline stress abolished FCR response to low Fe supply. Alkaline pH or low Fe supply resulted in increased expression of Fe uptake genes, but riboflavin synthesis genes responded to Fe deficiency but not alkalinity. Iron deficiency increased expression of some common genes in roots and leaves, but alkaline stress blocked up-regulation of these genes in Fe-deficient leaves. In roots of the melon (Cucumis melo L.) fefe mutant, in which Fe uptake responses are blocked upstream of Fe uptake genes, alkaline stress or Fe deficiency up-regulation of certain Fe uptake and riboflavin synthesis genes was inhibited, indicating a central role for the FeFe protein. These results suggest a model implicating shoot-to-root signaling of Fe status to induce Fe uptake gene expression in roots. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  19. Greenhouse crop residues: Energy potential and models for the prediction of their higher heating value

    Energy Technology Data Exchange (ETDEWEB)

    Callejon-Ferre, A.J.; Lopez-Martinez, J.A.; Manzano-Agugliaro, F. [Departamento de Ingenieria Rural, Universidad de Almeria, Ctra. Sacramento s/n, La Canada de San Urbano, 04120 Almeria (Spain); Velazquez-Marti, B. [Departamento de Ingenieria Rural y Agroalimentaria, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)

    2011-02-15

    Almeria, in southeastern Spain, generates some 1,086,261 t year{sup -1} (fresh weight) of greenhouse crop (Cucurbita pepo L., Cucumis sativus L., Solanum melongena L., Solanum lycopersicum L., Phaseoulus vulgaris L., Capsicum annuum L., Citrillus vulgaris Schrad. and Cucumis melo L.) residues. The energy potential of this biomass is unclear. The aim of the present work was to accurately quantify this variable, differentiating between crop species while taking into consideration the area they each occupy. This, however, required the direct analysis of the higher heating value (HHV) of these residues, involving very expensive and therefore not commonly available equipment. Thus, a further aim was to develop models for predicting the HHV of these residues, taking into account variables measured by elemental and/or proximate analysis, thus providing an economically attractive alternative to direct analysis. All the analyses in this work involved the use of worldwide-recognised standards and methods. The total energy potential for these plant residues, as determined by direct analysis, was 1,003,497.49 MW h year{sup -1}. Twenty univariate and multivariate equations were developed to predict the HHV. The R{sup 2} and adjusted R{sup 2} values obtained for the univariate and multivariate models were 0.909 and 0.946 or above respectively. In all cases, the mean absolute percentage error varied between 0.344 and 2.533. These results show that any of these 20 equations could be used to accurately predict the HHV of crop residues. The residues produced by the Almeria greenhouse industry would appear to be an interesting source of renewable energy. (author)

  20. Vitamins and Minerals: How to Get What You Need

    Science.gov (United States)

    ... 70 milligrams) kiwi (1 medium kiwi = 70 milligrams) strawberries (1/2 cup = 49 milligrams) cantaloupe (1/4 ... breakfast. One cup (about a handful) of halved strawberries or cubed cantaloupe provides the recommended daily amount ...

  1. Antisense repression of sucrose phosphate synthase in transgenic muskmelon alters plant growth and fruit development

    International Nuclear Information System (INIS)

    Tian, Hongmei; Ma, Leyuan; Zhao, Cong; Hao, Hui; Gong, Biao; Yu, Xiyan; Wang, Xiufeng

    2010-01-01

    To unravel the roles of sucrose phosphate synthase (SPS) in muskmelon (Cucumis melo L.), we reduced its activity in transgenic muskmelon plants by an antisense approach. For this purpose, an 830 bp cDNA fragment of muskmelon sucrose phosphate synthase was expressed in antisense orientation behind the 35S promoter of the cauliflower mosaic virus. The phenotype of the antisense plants clearly differed from that of control plants. The transgenic plant leaves were markedly smaller, and the plant height and stem diameter were obviously shorter and thinner. Transmission electron microscope observation revealed that the membrane degradation of chloroplast happened in transgenic leaves and the numbers of grana and grana lamella in the chloroplast were significantly less, suggesting that the slow growth and weaker phenotype of transgenic plants may be due to the damage of the chloroplast ultrastructure, which in turn results in the decrease of the net photosynthetic rate. The sucrose concentration and levels of sucrose phosphate synthase decreased in transgenic mature fruit, and the fruit size was smaller than the control fruit. Together, our results suggest that sucrose phosphate synthase may play an important role in regulating the muskmelon plant growth and fruit development.

  2. Molecular characterization and expression studies during melon fruit development and ripening of L-galactono-1,4-lactone dehydrogenase

    DEFF Research Database (Denmark)

    Pateraki, Irene; Sanmartin, Maite; Kalamaki, Mary S.

    2004-01-01

    of a GalLDH full-length cDNA from melon (Cucumis melo L.) are described. Melon genomic DNA Southern analysis indicated that CmGalLDH was encoded by a single gene. CmGalLDH mRNA accumulation was detected in all tissues studied, but differentially expressed during fruit development and seed germination....... It is hypothesized that induction of CmGalLDH gene expression in ripening melon fruit contributes to parallel increases in the AA content and so playing a role in the oxidative ripening process. Higher CmGalLDH message abundance in light-grown seedlings compared with those raised in the dark suggests that Cm......GalLDH expression is regulated by light. Finally, various stresses and growth regulators resulted in no significant change in steady state levels of CmGalLDH mRNA in 20-d-old melon seedlings. To the authors' knowledge, this is the first report of GalLDH transcript induction in seed germination and differential gene...

  3. Determination of changes in tastes of İpsala and Kırkağaç melons against Melon fly [Myiopardalis pardalina (Bigot, 1891

    Directory of Open Access Journals (Sweden)

    Aydemir BARIŞ

    2016-06-01

    Full Text Available Melon fly [Myiopardalis pardalina (Bigot, 1891 (Diptera: Tephritidae] is the most important pest of the melons (Cucumis melo L. (Cucurbitaceae: Cucurbitales. The larvae cause to damage by feeding in seed cavity. Also, the tissues damaged by larvae turn brown and occurring scent spread in melon. This study aims to determine change in the taste of melon tissues damaged by larvae for the first time in Turkey. For this purpose, Kırkağaç and İpsala variety melons widely utilized in the province Ankara were selected in this study. Fruit taste (points, water-soluble dry matter, titratable acidity (TA and pH measurements were included in analysis of melon. Statistical differences were determined in Kırkağaç melon with melon fly with respect to control in terms of all of the features discussed in the fruit analysis. A statistically significant difference was observed compared to the control in the other measurements excluding the only titratable acidity in İpsala melon with melon fly.

  4. Nitrogen uptake dynamics, yield and quality as influenced by nitrogen fertilization in Piel de sapo melon

    Energy Technology Data Exchange (ETDEWEB)

    Castellanos, M. T.; Cabello, M. J.; Cartagena, M. C.; Tarquis, A. M.; Arce, A.; Ribas, F.

    2012-11-01

    The need to reduce nitrogen (N) fertilizer pollution strengthens the importance of improving the utilization efficiency of applied N to crops. This requires knowledge of crop N uptake characteristics and how fertilization management affects it. A three-year field experiment was conducted from May to September in central Spain to investigate the influence of different N rates, which ranged from 11 to 393 kg ha{sup -}1, applied through drip irrigation, on the dynamics of N uptake, nitrogen use efficiency (NUE), fruit yield and quality of a Piel de sapo melon crop (Cucumis melo L. cv. Sancho). Both N concentration and N content increased in different plant parts with the N rate. Leaves had the highest N concentration, which declined by 40-50% from 34-41 days after transplanting (DAT), while the highest N uptake rate was observed from 30-35 to 70-80 DAT, coinciding with fruit development. In each year, NUE declined with increasing N rate. With N fertilizer applications close to the optimum N rate of 90-100 kg ha -1, the fruits removed approximately 60 kg N ha -1, and the amount of N in the crop residue was about 80 kg N ha -1; this serves to replenish the organic nutrient pool in the soil and may be used by subsequent crops following mineralization. (Author) 36 refs.

  5. Effect of Freeze-Drying on the Antioxidant Compounds and Antioxidant Activity of Selected Tropical Fruits

    Directory of Open Access Journals (Sweden)

    Muhammad Redzuan Hairuddin

    2011-07-01

    Full Text Available The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L., mango (Mangifera indica L., papaya (Carica papaya L., muskmelon (Cucumis melo L., and watermelon Citruluss lanatus (Thunb. were investigated. Significant (p < 0.05 differences, for the amounts of total phenolic compounds (TPC, were found between the fresh and freeze-dried fruit samples, except muskmelon. There was no significant (p > 0.05 change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p < 0.05 higher levels were detected in the fresh samples. The results of DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging and reducing power assays revealed that fresh samples of starfruit and mango had relatively higher antioxidant activity. In case of linoleic acid peroxidation inhibition measurement, a significant (p < 0.05 but random variation was recorded between the fresh and freeze-dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested.

  6. Development of a Novel, Sensitive, Selective, and Fast Methodology to Determine Malondialdehyde in Leaves of Melon Plants by Ultra-High-Performance Liquid Chromatography-Tandem Mass Spectrometry

    Directory of Open Access Journals (Sweden)

    Melisa E. Yonny

    2017-01-01

    Full Text Available Early production of melon plant (Cucumis melo is carried out using tunnels structures, where extreme temperatures lead to high reactive oxygen species production and, hence, oxidative stress. Malondialdehyde (MDA is a recognized biomarker of the advanced oxidative status in a biological system. Thus a reliable, sensitive, simple, selective, and rapid separative strategy based on ultra-high-performance liquid chromatography coupled to positive electrospray-tandem mass spectrometry (UPLC-(+ESI-MS/MS was developed for the first time to measure MDA, without derivatization, in leaves of melon plants exposed to stress conditions. The detection and quantitation limits were 0.02 μg·L−1 and 0.08 μg·L−1, respectively, which was demonstrated to be better than the methodologies currently reported in the literature. The accuracy values were between 96% and 104%. The precision intraday and interday values were 2.7% and 3.8%, respectively. The optimized methodology was applied to monitoring of changes in MDA levels between control and exposed to thermal stress conditions melon leaves samples. Important preliminary conclusions were obtained. Besides, a comparison between MDA levels in melon leaves quantified by the proposed method and the traditional thiobarbituric acid reactive species (TBARS approach was undertaken. The MDA determination by TBARS could lead to unrealistic conclusions regarding the oxidative stress status in plants.

  7. DNA fingerprinting of Chinese melon provides evidentiary support of seed quality appraisal.

    Science.gov (United States)

    Gao, Peng; Ma, Hongyan; Luan, Feishi; Song, Haibin

    2012-01-01

    Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs) are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines). Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC) were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines) were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR) codes of 471 melon varieties (lines) were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications.

  8. DNA Fingerprinting of Chinese Melon Provides Evidentiary Support of Seed Quality Appraisal

    Science.gov (United States)

    Gao, Peng; Ma, Hongyan; Luan, Feishi; Song, Haibin

    2012-01-01

    Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs) are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines). Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC) were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines) were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR) codes of 471 melon varieties (lines) were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications. PMID:23285039

  9. Evaluación del potencial antibacteriano de extractos de semillas de cinco frutas tropicales

    Directory of Open Access Journals (Sweden)

    Nirza de la Cruz Noguera Machado

    2017-07-01

    Full Text Available Las semillas y epicarpios de muchos frutos suelen ser descartados después del consumo directo y/o procesamiento industrial. Se ha descrito que estos subproductos son ricos en compuestos bioactivos, los cuales pueden ser utilizados como aditivos en la industria de alimentos y en otros procesos productivos. El objetivo de este trabajo fue producir extractos a partir de las semillas de cinco frutas tropicales: mango (Mangifera indica, papaya (Carica papaya, guayaba (Psidium guajava, parchita (Passiflora edulis y melón (Cucumis melo, y medir su efecto sobre el crecimiento de las bacterias Staphylococcus aureus ATCC 25923 y Escherichia coli ATCC 25922. La extracción se hizo por maceración a temperatura ambiental usando etanol al 90 %. Se tomaron 100 μL de los extractos y se adicionaron al medio de cultivo. Las bacterias fueron incubadas por 6 horas y su crecimiento se midió por turbidimetría a 600 nm, cada 30 minutos. Se encontró que las bacterias crecidas en presencia del extracto de parchita, exhibieron los menores valores de absorbancia, indicativo del potencial inhibitorio. Este efecto fue confirmado mediante contajes en placas y el método de difusión en agar, donde las concentraciones de 11,7 y 9,4 mg/mL fueron las que presentaron mejor efecto sobre S. aureus.

  10. EFFECT OF BAP AND IAA ON SHOOT REGENERATION IN COTYLEDONARY EXPLANTS OF COSTA RICAN MELON GENOTYPES

    Directory of Open Access Journals (Sweden)

    Marta Valdez Melara

    2009-01-01

    Full Text Available Para establecer una metodología para la regeneración del melón criollo (Cucumis melo L, se investigó la influencia del genotipo (OSO-1, OSO-2, OSO- 3, PQRG-1, PQRG-2, PQRG-3, y EM-1 y la interacción de N6-bencilaminopurina (BAP (0,1, 0,5 y 1,0 mg.l-1 con ácido indolacético (AIA (0, 0,05 y 0,5 mg.l-1 en la inducción de brotes y regeneración de plantas. Independientemente de la concentración de BAP y AIA, el mayor porcentaje de formación de brotes se obtuvo en EM-1>OSO-1>PQRG-3>OSO-2>PQRG-2>PQRG-1>OSO-3. Por otra parte, independientemente del genotipo, el mayor porcentaje de formación de brotes se obtuvo con 0,5 mg.l-1 BAP y 0,05 mg.l-1 AIA o 1 mg.l-1 BAP y 0 mg.l-1 AIA. El protocolo de cultivo in vitro establecido puede ser utilizado para la micropropagación de genotipos "criollos" de melón.

  11. Volatile emerging contaminants in melon fruits, analysed by HS-SPME-GC-MS.

    Science.gov (United States)

    Cincotta, Fabrizio; Verzera, Antonella; Tripodi, Gianluca; Condurso, Concetta

    2018-03-01

    The aim of this research was to develop and validate a headspace-solid phase micro-extraction-gas chromatography-mass spectrometry (HS-SPME-GC-MS) method for the determination of volatile emerging contaminants in fruit. The method showed good precision (RSD ≤ 14%) and satisfactory recoveries (99.1-101.7%) and LOD and LOQ values ranging between 0.011-0.033 μg kg -1 and 0.037-0.098 μg kg -1 , respectively. The method was applied to investigate the content of volatile emerging contaminants in two varieties of melon fruit (Cucumis melo L.) cultivated adjoining high-risk areas. Glycol ethers, BHT, BHA and BTEX (benzene, toluene, ethylbenzene and xylene) were determined in melon fruit pulps for the first time, with different sensitivities depending on sample and variety. Although the amount of the volatile contaminants in the melon samples were in the order of µg kg -1 , the safety of vegetable crops cultivated near risk areas should be more widely considered. The results showed that this accurate and reproducible method can be useful for routine safety control of fruits and vegetables.

  12. Influência do Uso de Imidacloprido na Qualidade das Águas e Sedimentos da Micro-bacia do Rio do Carmo

    Directory of Open Access Journals (Sweden)

    Luiz Di Souza

    2016-07-01

    Full Text Available The evaluation parameters such as heavy metals and pesticides molecules in aquatic environments, facilitates the determination of the level of pollution by subsidizing their identification and origin. The melon (Cucumis melo L. is one of the vegetable crops of greater economic importance in Brazil, especially in the Northeast, and the main factors contributing to its production, are associated with particular climatic conditions such as high temperatures, high luminosity and low soil moisture. The agricultural pole of the city of Mossoro is the largest melon producer in the region making it one of the largest consumers of imidacloprid (I of the country due to its use in pest control whitefly. Thus, in order to maintain the quality standards of water resources and due to deficiency of information on the presence of pesticides in the aquatic environment of the area surveyed and on the environmental liabilities generated by activity of melon for the rivers of the region, this work determined the concentration of I in the Carmo River water and sediment. The results found in water and sediments are high and influenced by human activities, especially monoculture melon and may be causing serious environmental problems of the river fauna. DOI: http://dx.doi.org/10.17807/orbital.v8i4.792 

  13. QUALIDADE FISIOLÓGICA E SANITÁRIA DE SEMENTES DE MELÃO UTILIZADAS NO PÓLO AGRÍCOLA ASSU-BARAÚNA-MOSSORÓ

    Directory of Open Access Journals (Sweden)

    Andreya Kalyana de Oliveira

    2008-01-01

    Full Text Available This research was conducted to evaluate the physiological and sanity quality of melon (Cucumis melo L. seeds used in agricultural region Assu-Baraúna-Mosssó in the Rio Grande do Norte. For seed lots each from the hybrids Goldex and Vereda were used. Research was conducted at the Seed Analysis Laboratory and Irrigation Agricultural of the Department of Crop Science of the UFERSA from August 2006 to July 2007. The physiological quality was evaluated by the germination, first count germination, accelerated aging, emergence speed index, electrical conductivity and seedling emergence, beyond the seed moisture content. The sanity was determinated by the method of filter paper with freezer, in four replications with 100 seeds per lot and completly randomized design. From the results obtained, it was concluded that first count germination, accelerated aging, electrical conductivity and seedling emergence tests only identified low and high seed lot from the hybrids Goldex and Vereda. The electrical conductivity test is most indicated to estimation of melon seed physiological potential, it was also possible to reduce the imbibition period of seeds prior this test. The pathogens associated with melon seeds were Aspergillus spp., Fusarium sp. and Macrophomina sp. and the physiological quality of seeds was not affected with the microrganisms presence.

  14. Novel edible oil sources: Microwave heating and chemical properties.

    Science.gov (United States)

    Hashemi, Seyed Mohammad Bagher; Mousavi Khaneghah, Amin; Koubaa, Mohamed; Lopez-Cervantes, Jaime; Yousefabad, Seyed Hossein Asadi; Hosseini, Seyedeh Fatemeh; Karimi, Masoumeh; Motazedian, Azam; Asadifard, Samira

    2017-02-01

    The aim of this work was to investigate the effect of various microwave heating times (1, 3, 5, 10, and 15min) on the chemical properties of novel edible oil sources, including Mashhadi melon (Cucumis melo var. Iranians cv. Mashhadi), Iranian watermelon (Citrullus lanatus cv. Fire Fon), pumpkin (Cucurbita pepo subsp. pepo var. Styriaca), and yellow apple (Malus domestica cv. Golden Delicious) seed oils. The evaluated parameters were peroxide value (PV), conjugated diene (CD) and triene (CT) values, carbonyl value (CV), p-anisidine value (AnV), oil stability index (OSI), radical scavenging activity (RSA), total tocopherols, total phenolics, as well as chlorophyll and carotenoid contents. Results showed that extended microwave heating involves decreased quality of the seed oils, mainly due to the formation of primary and secondary oxidation products. Microwave heating time also affects the total contents of chlorophylls, carotenoids, phenolics and tocopherols, which clearly decrease by increasing the exposure time. The order of oxidative stability of the analyzed edible oils was pumpkin>Mashhadi melon>Iranian watermelon>yellow apple. The obtained results demonstrated the promising potential of these novel edible oils for different food applications. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. TOXICITY OF INSECTICIDES USED IN MUSKMELON ON FIRST-INSTAR LARVAE OF Chrysoperla genanigra FREITAS (NEUROPTERA: CHRYSOPIDAE

    Directory of Open Access Journals (Sweden)

    BÁRBARA KARINE DE ALBUQUERQUE SILVA

    2017-01-01

    Full Text Available Brazil is one of the world's largest producers of melon (Cucumis melo L., and Rio Grande do Norte and Ceará are the largest producers states of the country (99% of exports. This crop had great socio- economic importance in the Brazilian Northeast, however, it is affected by insect pests and consequently, large amounts of pesticides are applied to it, which greatly affect beneficial organisms, such as Chrysopidae. This bioassay evaluated the toxicity of nine insecticides used in commercial crops of muskmelon, applied to first- instar larvae of Chrysoperla genanigra of up to 24-hour-old, from mass rearing cultures. Sublethal effects were evaluated, classifying the insecticides into the toxicity classes recommended by the IOBC. A completely randomized design was used, consisting of ten treatments (clothianidin, pymetrozine, lambda-cyhalothrin, chlorantraniliprole, indoxacarb, pyriproxyfen, beta-cyfluthrin+imidacloprid, imidacloprid, beta-cypermethrin and a control consisted of distilled water. The treatments consisted of exposure of thirty larvae to dry residues of each product in Petri dishes, assessing their mortality, duration of instars, sex ratio, fecundity and viability of eggs from adults of the insects evaluated. The products were classified in toxicity classes as harmful (Class 4 (clothianidin, pymetrozine, indoxacarb, lambda-cyhalothrin, beta-cyfluthrin+imidacloprid, imidacloprid, beta- cypermethrin and pyriproxyfen and innocuous (Class 1 (chlorantraniliprole to first -instar larvae of C. genanigra, by calculate their total effect. Based on this work, chlorantraniliprole is the only recommended insecticide for use in integrated pest management (IPM programs in muskmelon crops.

  16. Sensory and quality analysis of different melon cultivars after prolonged storage.

    Science.gov (United States)

    Hoberg, Edelgard; Ulrich, Detlef; Schulz, Hartwig; Tuvia-Alkali, Sharon; Fallik, Elazar

    2003-10-01

    The purpose of this work was to evaluate the sensory and general quality of four different melon cultivars (Cucumis melo L.) immediately after harvest and at the end of storage and marketing simulation. After 16 days of storage at 5 degrees C and additional 3 days at 20 degrees C, only cultivar 'C-8' had a poor general appearance due to significant low firmness and relatively high decay incidence compared to the cultivars '5080', 'Ideal' and '7302'. The cultivar '7302' was found to have the higher overall quality. The human-sensory and organoleptic analyses revealed that the cultivars can be differentiated on the basis of retronasal odour. The texture of the melons seems to be dependent on the genotype. All the complex perceptions analysed in this work contribute to the acceptability, which is in the fresh fruits of '7302' the best and in 'Ideal' the worst. After storage and marketing simulation 'Ideal' and 'C-8' are no longer favoured, but '5080' and '7302', despite different characters, were found to be similarly accepted. It can be concluded that with the aid of the human-sensory method developed to characterize the melon varieties it is possible to distinguish the different genotypes.

  17. The Diaporthe sojae species complex: Phylogenetic re-assessment of pathogens associated with soybean, cucurbits and other field crops.

    Science.gov (United States)

    Udayanga, Dhanushka; Castlebury, Lisa A; Rossman, Amy Y; Chukeatirote, Ekachai; Hyde, Kevin D

    2015-05-01

    Phytopathogenic species of Diaporthe are associated with a number of soybean diseases including seed decay, pod and stem blight and stem canker and lead to considerable crop production losses worldwide. Accurate morphological identification of the species that cause these diseases has been difficult. In this study, we determined the phylogenetic relationships and species boundaries of Diaporthe longicolla, Diaporthe phaseolorum, Diaporthe sojae and closely related taxa. Species boundaries for this complex were determined based on combined phylogenetic analysis of five gene regions: partial sequences of calmodulin (CAL), beta-tubulin (TUB), histone-3 (HIS), translation elongation factor 1-α (EF1-α), and the nuclear ribosomal internal transcribed spacers (ITS). Phylogenetic analyses revealed that this large complex of taxa is comprised of soybean pathogens as well as species associated with herbaceous field crops and weeds. Diaporthe arctii, Diaporthe batatas, D. phaseolorum and D. sojae are epitypified. The seed decay pathogen D. longicolla was determined to be distinct from D. sojae. D. phaseolorum, originally associated with stem and leaf blight of Lima bean, was not found to be associated with soybean. A new species, Diaporthe ueckerae on Cucumis melo, is introduced with description and illustrations. Published by Elsevier Ltd.

  18. Polyphasic analysis of Acidovorax citrulli strains from northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Kirley Michele Marques Silva

    2016-06-01

    Full Text Available ABSTRACT Bacterial fruit blotch (BFB of cucurbit plants is caused by Acidovorax citrulli and represents a serious concern to melon (Cucumis melo L. growers worldwide, including those in Brazil. Thirty-four A. citrulli strains from different melon production areas of northeastern Brazil were characterized for their virulence on melon fruits and their substrate utilization and molecular profiles. Based on the analysis of BFB severity on melon fruits, the A. citrulli strains were divided into three groups, classified as mildly, moderately or highly virulent. Although host-related groups were not observed, the watermelon and ‘melão-pepino’ strains exhibited only low or moderate virulence on melon fruit. Substrate utilization profiles revealed that 94 % of the 95 tested compounds were used by A. citrulli strains as a carbon source. Overall, based on substrate utilization, low variability was observed with no relationship to host of origin. The formation of one group of A. citrulli strains based on Repetitive Sequence-based PCR (rep-PCR analysis confirmed the low variability observed in the substrate utilization analyses. Bayesian inference based on the analysis of 23S rDNA partial sequence data resulted in one well-supported clade and clustered the strains with the A. citrulli-type species with high posterior probability support. Based on the markers used, the Brazilian A. citrulli strains belong to a single group, which corresponds to the previously described Group I for this bacterium in the United States.

  19. Cascade Cropping System with Horticultural and Ornamental Plants under Greenhouse Conditions

    Directory of Open Access Journals (Sweden)

    Pedro García-Caparrós

    2018-01-01

    Full Text Available The blending of drainage with water of low electrical conductivity and the sequential reuse of the drainage water are innovative technologies to manage salts in agricultural drainage. Plants of Cucumis melo were grown in coir grow bags, and Rosmarinus officinalis and Cacti spp. were grown in pots with a mixture of sphagnum peat-moss and perlite. In order to assess the effect and evolution over time of these water treatments on plant growth and water management and removal of nutrients, three water treatments were applied over a period of eight weeks. These were: (1 standard nutrient solution; (2 blended water treatment (drainage water blended with water of low electrical conductivity (EC and (3 sequential reuse of drainage water treatment. During the experimental growing period, samples of water supplies and drainages generated in each water treatment were collected weekly and from these data water volume and nutrient loads were calculated. At the end of the experiment, leaf fresh weight of rosemary plants decreased under the fertigation with the blended and sequential reuse water treatments. Nevertheless, the application of blended and sequentially reused water allowed for the saving of significant amounts of water and nutrients in comparison to the standard nutrient solution treatment. Considering these advantages, we strongly recommend the setting-up of these water treatments in areas with water scarcity such as in the Mediterranean Basin.

  20. Effect of Freeze-Drying on the Antioxidant Compounds and Antioxidant Activity of Selected Tropical Fruits

    Science.gov (United States)

    Shofian, Norshahida Mohamad; Hamid, Azizah Abdul; Osman, Azizah; Saari, Nazamid; Anwar, Farooq; Dek, Mohd Sabri Pak; Hairuddin, Muhammad Redzuan

    2011-01-01

    The effects of freeze-drying on antioxidant compounds and antioxidant activity of five tropical fruits, namely starfruit (Averrhoa carambola L.), mango (Mangifera indica L.), papaya (Carica papaya L.), muskmelon (Cucumis melo L.), and watermelon Citruluss lanatus (Thunb.) were investigated. Significant (p 0.05) change, however, observed in the ascorbic acid content of the fresh and freeze-dried fruits. Similarly, freeze-drying did not exert any considerable effect on β-carotene concentration of fruits, except for mango and watermelon, where significantly (p < 0.05) higher levels were detected in the fresh samples. The results of DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging and reducing power assays revealed that fresh samples of starfruit and mango had relatively higher antioxidant activity. In case of linoleic acid peroxidation inhibition measurement, a significant (p < 0.05) but random variation was recorded between the fresh and freeze-dried fruits. Overall, in comparison to β-carotene and ascorbic acid, a good correlation was established between the result of TPC and antioxidant assays, indicating that phenolics might have been the dominant compounds contributing towards the antioxidant activity of the fruits tested. PMID:21845104

  1. Effects of 20 Selected Fruits on Ethanol Metabolism: Potential Health Benefits and Harmful Impacts.

    Science.gov (United States)

    Zhang, Yu-Jie; Wang, Fang; Zhou, Yue; Li, Ya; Zhou, Tong; Zheng, Jie; Zhang, Jiao-Jiao; Li, Sha; Xu, Dong-Ping; Li, Hua-Bin

    2016-04-01

    The consumption of alcohol is often accompanied by other foods, such as fruits and vegetables. This study is aimed to investigate the effects of 20 selected fruits on ethanol metabolism to find out their potential health benefits and harmful impacts. The effects of the fruits on ethanol metabolism were characterized by the concentrations of ethanol and acetaldehyde in blood, as well as activities of alcohol dehydrogenase and acetaldehyde dehydrogenase in liver of mice. Furthermore, potential health benefits and harmful impacts of the fruits were evaluated by biochemical parameters including aspartate transaminase (AST), alanine transferase (ALT), malondialdehyde, and superoxide dismutase. Generally, effects of these fruits on ethanol metabolism were very different. Some fruits (such as Citrus limon (yellow), Averrhoa carambola, Pyrus spp., and Syzygium samarangense) could decrease the concentration of ethanol in blood. In addition, several fruits (such as Cucumis melo) showed hepatoprotective effects by significantly decreasing AST or ALT level in blood, while some fruits (such as Averrhoa carambola) showed adverse effects. The results suggested that the consumption of alcohol should not be accompanied by some fruits, and several fruits could be developed as functional foods for the prevention and treatment of hangover and alcohol use disorder.

  2. DNA fingerprinting of Chinese melon provides evidentiary support of seed quality appraisal.

    Directory of Open Access Journals (Sweden)

    Peng Gao

    Full Text Available Melon, Cucumis melo L. is an important vegetable crop worldwide. At present, there are phenomena of homonyms and synonyms present in the melon seed markets of China, which could cause variety authenticity issues influencing the process of melon breeding, production, marketing and other aspects. Molecular markers, especially microsatellites or simple sequence repeats (SSRs are playing increasingly important roles for cultivar identification. The aim of this study was to construct a DNA fingerprinting database of major melon cultivars, which could provide a possibility for the establishment of a technical standard system for purity and authenticity identification of melon seeds. In this study, to develop the core set SSR markers, 470 polymorphic SSRs were selected as the candidate markers from 1219 SSRs using 20 representative melon varieties (lines. Eighteen SSR markers, evenly distributed across the genome and with the highest contents of polymorphism information (PIC were identified as the core marker set for melon DNA fingerprinting analysis. Fingerprint codes for 471 melon varieties (lines were established. There were 51 materials which were classified into17 groups based on sharing the same fingerprint code, while field traits survey results showed that these plants in the same group were synonyms because of the same or similar field characters. Furthermore, DNA fingerprinting quick response (QR codes of 471 melon varieties (lines were constructed. Due to its fast readability and large storage capacity, QR coding melon DNA fingerprinting is in favor of read convenience and commercial applications.

  3. Non-Destructive Assessment of Aroma Volatiles from a Climacteric Near-Isogenic Line of Melon Obtained by Headspace Stir-Bar Sorptive Extraction

    Directory of Open Access Journals (Sweden)

    Juan Pablo Fernández-Trujillo

    2013-08-01

    Full Text Available A climacteric aromatic near-isogenic line (NIL of melon (Cucumis melo L. SC3-5-1 contained an introgression of the non-climacteric Korean cultivar “Shongwan Charmi” accession PI 161375 (SC in the genetic background of the non-climacteric cultivar “Piel de Sapo” (PS. The aroma production was monitored during ripening at 21 °C in intact fruit using headspace sorptive bar extraction (HSSE. Bars were composed of polydimethylsiloxane (PDMS and aromas were desorbed and analyzed by gas-chromatography mass-spectrometry. The aromatic profile was composed of 70 aromatic compounds plus 21 alkanes with a predominance of esters, particularly acetate (2-methylbutyl acetate, 2-methylpropyl acetate, hexyl acetate, and phenylmethyl acetate. Some compounds were severely affected by postharvest time. The acetate esters (3-methylbutyl acetate, butan-2-yl acetate and phenylmethyl acetate decreased with ripening and sulfur-derived compounds (S-methyl butanethioate and S-methyl 3-methylbutanethioate increased gradually with ripening. A few compounds increased at the senescence phase (propyl ethanoate. Other compounds such as hexadecanoic acid showed a marked decrease after harvest, some decreasing from a relative maximum at harvest (2-methylpropyl hexanoate; n-hexanoic acid; nonanoic acid.

  4. Antisense repression of sucrose phosphate synthase in transgenic muskmelon alters plant growth and fruit development

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Hongmei; Ma, Leyuan; Zhao, Cong; Hao, Hui; Gong, Biao [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China); Yu, Xiyan, E-mail: yuxiyan@sdau.edu.cn [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China); Wang, Xiufeng, E-mail: xfwang@sdau.edu.cn [College of Horticulture Science and Engineering, State Key Laboratory of Crop Biology, Shandong Agricultural University, Tai' an, Shandong 271018 (China)

    2010-03-12

    To unravel the roles of sucrose phosphate synthase (SPS) in muskmelon (Cucumis melo L.), we reduced its activity in transgenic muskmelon plants by an antisense approach. For this purpose, an 830 bp cDNA fragment of muskmelon sucrose phosphate synthase was expressed in antisense orientation behind the 35S promoter of the cauliflower mosaic virus. The phenotype of the antisense plants clearly differed from that of control plants. The transgenic plant leaves were markedly smaller, and the plant height and stem diameter were obviously shorter and thinner. Transmission electron microscope observation revealed that the membrane degradation of chloroplast happened in transgenic leaves and the numbers of grana and grana lamella in the chloroplast were significantly less, suggesting that the slow growth and weaker phenotype of transgenic plants may be due to the damage of the chloroplast ultrastructure, which in turn results in the decrease of the net photosynthetic rate. The sucrose concentration and levels of sucrose phosphate synthase decreased in transgenic mature fruit, and the fruit size was smaller than the control fruit. Together, our results suggest that sucrose phosphate synthase may play an important role in regulating the muskmelon plant growth and fruit development.

  5. Características físico-químicas e compostos aromáticos do suco de melão clarificado por microfiltração tangencial

    Directory of Open Access Journals (Sweden)

    Raimundo Marcelino Silva Neto

    2016-10-01

    Full Text Available Polpa e suco de melão clarificado por microfiltração tangencial foram avaliados com relação as suas características físico-químicas e compostos aromáticos. A polpa do melão (Cucumis melo var inodorus foi extraída, tratada com as enzimas Pectinex Ultra SP-L e Celuclast e clarificada por microfiltração à pressão média de 3,0 bar. O suco clarificado apresentou-se incolor com uma leve tonalidade esverdeada. As características físico-químicas da polpa e do suco clarificado, como pH, brix, acidez titulável, turbidez, glicose, frutose, sacarose, foram identificadas, assim como seu perfil aromático por meio de micro-extração em fase sólida (SPME e cromatografia gasosa acoplada com espectrometria de massa (CG-EM. A microfiltração permitiu obter uma bebida de valor agregado partindo de uma matéria-prima de descarte do mercado externo, preservando suas características físico-químicas iniciais, indicando seu potencial de uso em blends de sucos de frutas tropicais. Adicionalmente, a fração retida poderá ser incorporada na polpa do melão e direcionada ao mercado de bebidas funcionais.

  6. Draft genome sequence of bitter gourd (Momordica charantia), a vegetable and medicinal plant in tropical and subtropical regions.

    Science.gov (United States)

    Urasaki, Naoya; Takagi, Hiroki; Natsume, Satoshi; Uemura, Aiko; Taniai, Naoki; Miyagi, Norimichi; Fukushima, Mai; Suzuki, Shouta; Tarora, Kazuhiko; Tamaki, Moritoshi; Sakamoto, Moriaki; Terauchi, Ryohei; Matsumura, Hideo

    2017-02-01

    Bitter gourd (Momordica charantia) is an important vegetable and medicinal plant in tropical and subtropical regions globally. In this study, the draft genome sequence of a monoecious bitter gourd inbred line, OHB3-1, was analyzed. Through Illumina sequencing and de novo assembly, scaffolds of 285.5 Mb in length were generated, corresponding to ∼84% of the estimated genome size of bitter gourd (339 Mb). In this draft genome sequence, 45,859 protein-coding gene loci were identified, and transposable elements accounted for 15.3% of the whole genome. According to synteny mapping and phylogenetic analysis of conserved genes, bitter gourd was more related to watermelon (Citrullus lanatus) than to cucumber (Cucumis sativus) or melon (C. melo). Using RAD-seq analysis, 1507 marker loci were genotyped in an F2 progeny of two bitter gourd lines, resulting in an improved linkage map, comprising 11 linkage groups. By anchoring RAD tag markers, 255 scaffolds were assigned to the linkage map. Comparative analysis of genome sequences and predicted genes determined that putative trypsin-inhibitor and ribosome-inactivating genes were distinctive in the bitter gourd genome. These genes could characterize the bitter gourd as a medicinal plant. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  7. Gamma-ray-induced changes in hypodermal mesocarp tissue plasma membrane of pre- and post-storage muskmelon

    International Nuclear Information System (INIS)

    Lester, G.E.; Whitaker, B.D.

    1996-01-01

    Gamma irradiation (1.0 kGy) of intact, newly harvested, mature muskmelon fruit (Cucumis melo L. var. reticulatus Naud.) appears to have an immediate deleterious effect, but also a long-term beneficial effect, on the integrity and function of the plasma membrane (PM) of hypodermal mesocarp tissue. The initial consequences of gamma irradiation included an increase in the free sterol:phospholipid ratio, resulting at least in part from deglycosylation of steryl glycosides, a decrease in the spinasterol:7-stigmastenol ratio in each of the PM steryl lipids (free sterols, steryl glycosides, and acylated steryl glycosides), and a decrease in H+-ATPase activity. Irradiation did not increase protein loss, suggesting that the decrease in H+-ATPase activity resulted from either direct inactivation of the enzyme or altered PM ordering caused by the steryl lipid modifications. The long-term beneficial effects of irradiation, observed following 10 days of commercial storage, included greater retention of total PM protein, a diminished decline in total PM phospholipids (PL) and in the PL:protein ratio, and maintenance of greater overall H-ATPase activity (activity was the same as in controls on a per mg protein basis, but there was gt 30% more protein in the PM of stored irradiated fruit). These results indicate that 1 kGy gamma irradiation administered prior to storage slowes the progression of two key parameters of senescence, PM protein loss and PL catabolism

  8. Produtividade e qualidade do melão cantaloupe, cultivado em ambiente protegido, variando o número e a posição dos frutos na planta Fruit yield and quality of cantaloupe melon, under greenhouse conditions, as affected by number of fruits and position in the plant

    Directory of Open Access Journals (Sweden)

    Roberto Cleiton Fernandes de Queiroga

    2008-12-01

    Full Text Available Os frutos do meloeiro são considerados fortes drenos que alteram a distribuição de fotoassimilados entre os órgãos da planta. Objetivou-se nesse trabalho determinar a produção e a qualidade de frutos de meloeiro em ambiente protegido em função do número e da posição de fixação dos frutos na planta. O experimento foi desenvolvido em fatorial 2 x 2 em blocos ao acaso, com cinco repetições, provenientes da combinação de número de frutos por planta (1 e 2 e posição de fixação dos frutos na planta (entre 5.º e 8.° nós e entre 15.° e 18.° nós. O melão cultivar 'Torreon', do grupo Cantalupensis, foi plantado em vasos de 11,5 dm³ contendo como substrato apenas fibra de coco adubada com macro e micronutrientes. Comparado a plantas com dois frutos, nas plantas com apenas um fruto ocorreram os maiores valores de: massa dos frutos (MF, reticulação da casca (RC, comprimento, índice de formato, espessura da polpa, índice de maturação (IM, sólidos solúveis (SS, açúcares solúveis totais, açúcares não redutores. Em plantas com apenas um fruto, ocorreu redução na produtividade comercial (PC de 21,4% em frutos fixados especificamente entre o 5.° e 8.° nós e 24,9% em frutos do 15.° e 18.° nós comparada a plantas com dois frutos. Em frutos fixados na posição do 15.° e 18.° nós ocorreram maiores MF, IM, PC e ciclo da cultura, bem como, menores RC e acidez total titulável. Foram obtidas correlações significativas para área foliar por fruto (AF x MF de 0,81, AF x SS de 0,79, MF x SS de 0,68, MF x RC de 0,72 e RC x SS de 0,51.Muskmelon fruits are strong sink affecting assimilate distribution among the plant organs. This experiment aimed at to determine yield and quality of 'Torreon' cultivar in greenhouse conditions as affected by fruit number and position in the plant. A 2 x 2 factorial was set in randomized block design, with five replications. Treatments combined fruit number per plant (1 and 2 and position in the vine (among 5th - 8th node and among 15th - 18th node, planted in 11, 5 dm3 pot with coconut fiber fertilized with macro and micronutrients. Compared to plants with two fruits, in plants with only one fruit there were the highest values of fruits mass (MF, netted rind (RC, fruit length, format index, flesh thickness, maturation index (IM, soluble solids (SS, total soluble sugars and no reducing sugars. Compared to plants with two fruits in plants with one fruit there was a reduction in the commercial productivity (PC of 21.4% in fruits between 5th and 8th nodes had 24.9% in fruits of 15th and 18th nodes. Fruits of the 15th and 18th nodes presented higher MF, IM, PC and culture cycle, as well as lower RC and total titratable acidity. Positive and significant correlations were obtained for leaf area per fruit (AF x MF of 0.81, AF x SS of 0.79, MF x SS of 0.68, MF x RC of 0.72 and RC x SS of 0.51.

  9. Potencial de rizobactérias no controle de Fusarium solani (Mart. Sacc. em pepino (Cucumis sativum L. Potential of rhizobacteria in the control of Fusarium solani (Mart. Sacc. in cucumber (Cucumis sativum L.

    Directory of Open Access Journals (Sweden)

    I S. de Melo

    1995-08-01

    Full Text Available Rizobactérias, isoladas da rizosfera de diferentes hospedeiros foram selecionadas in vitro quanto ao antagonismo contra Fusarium solam agente causai da podridão radicular. In vitro, foram selecionadas 18 bactérias isoladas da rizosfera de plantas sadias de pepino e, destas, somente três foram eficientes em inibir consideravelmente o crescimento micelial do patógeno. Dois isolados de Bacillus subtilis e dois de Pseudomonas sp., antagônicos a outros fungos fitopatogênicos foram incluidos nos testes, os quais mostraram-se capazes de antagonizar F. solani. Em condições de casa-de-vegetação, B. subtilis, linhagem 0G, controlou totalmente o patógeno em todos os ensaios realizados. Promoção do crescimento de plantas foi verificada pela inoculação com linhagens 0G (B. subtilis, St. Barb. e CBPN (Pseudomonas sp.Rhizobacteria, isolated from the rhizosphere of different hosts were selected in vitro, based on the antagonism against Fusarium solani, agent of root rot. In vitro, 18 bacterias were selected from rhizosphere of healthy plants of cucumber and, from those, only three were efficient in inhibiting the micelial growth of the pathogen. In these tests two isolates of Bacillus subtilis (0G and 5G, and two of Pseudomonas (CBPN and St Barb., antagonistic to some pathogenic fungi, were included. These bolates also inhibited the growth of F solani. The bolate OG of B. subtilis reduced significantly the root rot of cucumber. Beneficial effects were obtained with the bolates St Barb., 0G and CBPN in relation to plant growth.

  10. DIFFERENTIAL BIOAVAILABILITY OF FIELD-WEATHERED P,P'-DDE TO PLANTS OF THE CUCURBITA AND CUCUMIS GENERA. (R829405)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  11. Arsenate impact on the metabolite profile, production and arsenic loading of xylem sap in cucumbers (Cucumis sativus L.

    Directory of Open Access Journals (Sweden)

    Kalle eUroic

    2012-04-01

    Full Text Available Arsenic uptake and translocation studies on xylem sap focus generally on the concentration and speciation of arsenic in the xylem. Arsenic impact on the xylem sap metabolite profile and its production during short term exposure has not been reported in detail. To investigate this, cucumbers were grown hydroponically and arsenate (AsV and DMA were used for plant treatment for 24 h. Total arsenic and arsenic speciation in xylem sap was analysed including a metabolite profiling under arsenate stress. Produced xylem sap was quantified and absolute arsenic transported was determined. AsV exposure has a significant impact on the metabolite profile of xylem sap. Four m/z values corresponding to four compounds were up regulated, one compound down regulated by arsenate exposure. The compound down regulated was identified to be isoleucine. Furthermore, arsenate has a significant influence on sap production, leading to a reduction of up to 96 % sap production when plants are exposed to 1000 μg kg-1 arsenate. No difference to control plants was observed when plants were exposed to 1000 μg kg-1 DMA. Absolute arsenic amount in xylem sap was the lowest at high arsenate exposure. These results show that AsV has a significant impact on the production and metabolite profile of xylem sap. The physiological importance of isoleucine needs further attention.

  12. Evaluation of some engineering properties of cucumber (Cucumis sativus L. seeds and kernels based on image processing

    Directory of Open Access Journals (Sweden)

    Amir Hossein Mirzabe

    2017-12-01

    Full Text Available In this study, a method based on digital image processing was employed to investigate effect of the moisture content on gravimetrical and frictional properties of the cucumber seeds and kernels. This research indicated that the application of visual machines and the image processing could be a rapid method that enables accurate measurement of the dimensional parameters of two varieties of this product meticulously. The length, width, and thickness of the seeds of Rashid variety ranged from 6.40 to 9.07, 2.91 to 4.21 and 0.65 to1.50 mm, respectively; the corresponding value of Negin variety ranged from 6.89 to 9.07, 2.49 to 4.21, and 0.69 to 1.68 mm, respectively. Kernel and shell ratios of the Rashid variety were found to be 69.811 and 30.189%, respectively; the corresponding values of the Negin variety were found to be 72.727 and 27.273%, respectively. Despite the bulk densities of the two varieties of cucumber seeds and kernels that decreased with the moisture content, true density and porosity of the two varieties of cucumber seeds and kernels increased. As the moisture content increased from 5.04 to 21.12% (d.b, the angle of the static friction of the seeds of Negin variety increased from 30.39° to 37.18°, 28.83° to 34.99°, 24.37° to 30.04°, and 15.77° to 19.57° for wood, rubber, iron, and galvanized, respectively,; the corresponding value of the Negin variety increased from 21.12° to 27.16°, 24.43° to 31.41°, 19.90° to 25.59° and 14.09° to 18.12° as the moisture content increased from 5.02 to 21.02% (d.b. Keywords: Image processing, Physical and mechanical properties, Cucumber

  13. Effect of silver nanoparticles on concentration of silver heavy element and growth indexes in cucumber (Cucumis sativus L. negeen)

    International Nuclear Information System (INIS)

    Shams, Gholamabbas; Ranjbar, Morteza; Amiri, Aliasghar

    2013-01-01

    The tremendous progress on nanoparticle research area has been made significant effects on the economy, society, and the environment. Silver nanoparticle is one of the most important particles in these categories. Silver nanoparticles can be converted to the heavy silver metal in water by oxidation. Moreover, in the high amounts of silver concentration, they will be accumulated in different parts of the plant. However, by changing the morphology of the plant, the production will be harmful for human consumptions. In this study, nano-powders with average 50 nm silver particles are mixed with deionized distilled water in a completely randomized design. Seven treatments with various concentrations of suspension silver nanoparticles were prepared and repeated in four different parts of the plant in a regular program of spraying. Samples were analyzed to study the growth indexes and concentration of silver in different parts of the plant. It was observed that with increasing concentration of silver nanoparticles on cucumber, the growth indexes (except pH fruit), and the concentration of silver heavy metal are increased significantly. The incremental concentration had the linear relationship with correlation coefficient 0.95 and an average of 0.617 PPM by increasing of each unit in one thousand concentration of nanosilver. Although, by increasing concentration of silver nanoparticles as spraying form, the plant morphological characteristics were improved, the concentration of silver heavy metal in various plant organs was increased. These results open a new pathway to consider the effect of nanoparticles on plant’s productions for human consumptions.

  14. Leaf Volatile Compounds and Associated Gene Expression during Short-Term Nitrogen Deficient Treatments in Cucumis Seedlings

    Directory of Open Access Journals (Sweden)

    Jie Deng

    2016-11-01

    Full Text Available Nitrogen (N is an important macronutrient for plant growth and development, but the regulatory mechanism of volatile compounds in response to N deficiency is not well understood, especially in cucumber, which consumes excessive N during growth. In this study, the major volatile compounds from cucumber leaves subjected to N deficiency were analyzed by GC-MS. A total of 24 volatile components were identified including 15 aldehydes, two ketones, two alkenes, and five other volatile compounds in 9930 leaves. Principal component analysis using volatile compounds from cucumber leaves provided good separation between N-sufficient and N-deficient treatments. The main volatiles in cucumber leaves were found to be C6 and C9 aldehydes, especially (E-2-hexanal and (E,Z-2,6-nonadienal. (E-2-hexanal belonged to the C6 aldehyde and was the most abundant compound, whereas (E,Z-2,6-nonadienal was the chief component of C9 aldehydes. During N-deficient treatment, short-chain volatile content was significantly improved at 5 day, other volatiles displayed significant reduction or no significantly changes in all sampling points. Improvement of short-chain volatiles was confirmed in the six other inbred lines at 5 day after N-deficient treatments. The expression analysis of 12 cucumber LOX genes and two HPL genes revealed that CsLOX19, CsLOX20, and CsLOX22 had common up-regulated expression patterns in response to N-deficient stress in most inbred lines; meanwhile, most sample points of CsHPL1 also had significant up-regulated expression patterns. This research focused on the relationship between volatiles in cucumber and different nitrogen environments to provide valuable insight into the effect of cultivation and management of the quality of cucumber and contributes to further research on volatile metabolism in cucumber.

  15. Arsenate Impact on the Metabolite Profile, Production, and Arsenic Loading of Xylem Sap in Cucumbers (Cucumis sativus L.)

    Science.gov (United States)

    Uroic, M. Kalle; Salaün, Pascal; Raab, Andrea; Feldmann, Jörg

    2012-01-01

    Arsenic uptake and translocation studies on xylem sap focus generally on the concentration and speciation of arsenic in the xylem. Arsenic impact on the xylem sap metabolite profile and its production during short term exposure has not been reported in detail. To investigate this, cucumbers were grown hydroponically and arsenate (AsV) and DMA were used for plant treatment for 24 h. Total arsenic and arsenic speciation in xylem sap was analyzed including a metabolite profiling under AsV stress. Produced xylem sap was quantified and absolute arsenic transported was determined. AsV exposure had a significant impact on the metabolite profile of xylem sap. Four m/z values corresponding to four compounds were up-regulated, one compound down-regulated by AsV exposure. The compound down-regulated was identified to be isoleucine. Furthermore, AsV exposure had a significant influence on sap production, leading to a reduction of up to 96% sap production when plants were exposed to 1000 μg kg−1 AsV. No difference to control plants was observed when plants were exposed to 1000 μg kg−1 DMA. Absolute arsenic amount in xylem sap was the lowest at high AsV exposure. These results show that AsV has a significant impact on the production and metabolite profile of xylem sap. The physiological importance of isoleucine needs further attention. PMID:22536187

  16. Effect of silver nanoparticles on concentration of silver heavy element and growth indexes in cucumber (Cucumis sativus L. negeen)

    Energy Technology Data Exchange (ETDEWEB)

    Shams, Gholamabbas, E-mail: ghs@iaushiraz.net; Ranjbar, Morteza [Shiraz Branch, Islamic Azad University, Department of Physics (Iran, Islamic Republic of); Amiri, Aliasghar [Shiraz Branch, Islamic Azad University, Department of Chemistry (Iran, Islamic Republic of)

    2013-05-15

    The tremendous progress on nanoparticle research area has been made significant effects on the economy, society, and the environment. Silver nanoparticle is one of the most important particles in these categories. Silver nanoparticles can be converted to the heavy silver metal in water by oxidation. Moreover, in the high amounts of silver concentration, they will be accumulated in different parts of the plant. However, by changing the morphology of the plant, the production will be harmful for human consumptions. In this study, nano-powders with average 50 nm silver particles are mixed with deionized distilled water in a completely randomized design. Seven treatments with various concentrations of suspension silver nanoparticles were prepared and repeated in four different parts of the plant in a regular program of spraying. Samples were analyzed to study the growth indexes and concentration of silver in different parts of the plant. It was observed that with increasing concentration of silver nanoparticles on cucumber, the growth indexes (except pH fruit), and the concentration of silver heavy metal are increased significantly. The incremental concentration had the linear relationship with correlation coefficient 0.95 and an average of 0.617 PPM by increasing of each unit in one thousand concentration of nanosilver. Although, by increasing concentration of silver nanoparticles as spraying form, the plant morphological characteristics were improved, the concentration of silver heavy metal in various plant organs was increased. These results open a new pathway to consider the effect of nanoparticles on plant's productions for human consumptions.

  17. In vitro plant regeneration of two cucumber (Cucumis sativum L. genotypes: Effects of explant types and culture medium

    Directory of Open Access Journals (Sweden)

    Grozeva Stanislava

    2014-01-01

    Full Text Available The effect of different phytohormone concentrations on callusogenesis and organogenesis in two cucumber genotypes were studied. It was established that the rate of plant regeneration depends on genotype, explant type and culture medium. Hypocotyls were found to be more responsive than cotyledons in morphogenesis. In vitro planlet-regenerants have been obtained in hypocotyls explants on culture medium with 1.0 and 2.0 mgL-1 BA for cultivar Gergana and in 1.0 and 3.0 mgL-1K-line 15B. Induction of regeneration in cotyledons were established only in cultivar Gergana on culture medium supplemented with 3.0 mgL-1 BA and in combination of 0.5 mgL-1IAA.

  18. Proteomic Analysis of Differentially Accumulated Proteins in Cucumber (Cucumis sativus) Fruit Peel in Response to Pre-storage Cold Acclimation.

    Science.gov (United States)

    Wang, Bin; Shen, Fei; Zhu, Shijiang

    2017-01-01

    Harvested fruits are still living organs and respond to environmental stimuli. Low temperature storage is effective in extending life of harvested fruit, but it may also cause chilling injury. Cold acclimation has been shown to induce chilling tolerance in plants, but what proteomic changes caused by cold acclimation are related to defense against chilling stress remains largely unclear. Here, 3 d of pre-storage cold acclimation (PsCA) at 10°C reduced chilling injury and secondary disease severity in cucumber stored at 5°C by 51 and 94%, respectively, compared with the control which was directly stored at 5°C. Proteomic analysis of cucumber peel identified 21 significant differentially-accumulated proteins (SDAPs) right after PsCA treatment and 23 after the following cold storage (PsCA+CS). These proteins are mainly related to stress response and defense (SRD), energy metabolism, protein metabolism, signal transduction, primary metabolism, and transcription. The SRD proteins, which made up 37% of the 21 and 47% of the 23, respectively, represented the largest class of SDAPs, and all but one protein were up-regulated, suggesting accumulation of proteins involved in defense response is central feature of proteomic profile changes brought about by PsCA. In fruit just after PsCA treatment, the identified SDAPs are related to responses to various stresses, including chilling, salt stress, dehydration, fungi, bacteria, insects, and DNA damage. However, after prolonged cold storage, the targeted proteins in acclimated fruit were narrowed down in scope to those involved in defense against chilling and pathogens. The change patterns at the transcription level of the majority of the up-regulated differentially-accumulated proteins were highly consistent with those at protein level. Taken all, the results suggest that the short-time cold acclimation initiated comprehensive defense responses in cucumber fruit at first, while the long term storage thereafter altered the responses more specifically to chilling. These findings add to the understanding of plants' molecular responses to cold acclimation.

  19. Co-Expression analysis of miRNAs and target NBS-LRR genes in Cucumis sativus

    Science.gov (United States)

    Plants react against their biological enemies by activating the innate immune system. Their defense system comprises of various R-protein, which usually contain NBS-LRR domain. MicroRNAs (miRNAs) are important molecules of 2nd layer of plant defense and play pivotal role behind the scene. To support...

  20. Proteomic Analysis of Differentially Accumulated Proteins in Cucumber (Cucumis sativus Fruit Peel in Response to Pre-storage Cold Acclimation

    Directory of Open Access Journals (Sweden)

    Bin Wang

    2018-01-01

    Full Text Available Harvested fruits are still living organs and respond to environmental stimuli. Low temperature storage is effective in extending life of harvested fruit, but it may also cause chilling injury. Cold acclimation has been shown to induce chilling tolerance in plants, but what proteomic changes caused by cold acclimation are related to defense against chilling stress remains largely unclear. Here, 3 d of pre-storage cold acclimation (PsCA at 10°C reduced chilling injury and secondary disease severity in cucumber stored at 5°C by 51 and 94%, respectively, compared with the control which was directly stored at 5°C. Proteomic analysis of cucumber peel identified 21 significant differentially-accumulated proteins (SDAPs right after PsCA treatment and 23 after the following cold storage (PsCA+CS. These proteins are mainly related to stress response and defense (SRD, energy metabolism, protein metabolism, signal transduction, primary metabolism, and transcription. The SRD proteins, which made up 37% of the 21 and 47% of the 23, respectively, represented the largest class of SDAPs, and all but one protein were up-regulated, suggesting accumulation of proteins involved in defense response is central feature of proteomic profile changes brought about by PsCA. In fruit just after PsCA treatment, the identified SDAPs are related to responses to various stresses, including chilling, salt stress, dehydration, fungi, bacteria, insects, and DNA damage. However, after prolonged cold storage, the targeted proteins in acclimated fruit were narrowed down in scope to those involved in defense against chilling and pathogens. The change patterns at the transcription level of the majority of the up-regulated differentially-accumulated proteins were highly consistent with those at protein level. Taken all, the results suggest that the short-time cold acclimation initiated comprehensive defense responses in cucumber fruit at first, while the long term storage thereafter altered the responses more specifically to chilling. These findings add to the understanding of plants' molecular responses to cold acclimation.

  1. P depletion and activity of phosphatases in the rhizosphere of mycorrhizal and non-mycorrhizal cucumber (Cucumis Sativus L.)

    DEFF Research Database (Denmark)

    Joner, E.J.; Magid, J.; Gahoonia, T.S.

    1995-01-01

    An experiment was set up to test the ability of arbuscular mycorrhizal (AM) roots and hyphae to produce extracellular phosphatases and to study the relationship between phosphatase activity and soil organic P (P-o). Non-mycorrhizal cucumber and cucumber in symbiosis with either of two mycorrhizal...... fungi were grown in a sandy loam-sand mixture in three-compartment pots. Plant roots were separated from two consecutively adjoining compartments, first by a 37 m mesh excluding roots and subsequently by a 0.45 m membrane excluding mycorrhizal hyphae. Soil from the two root-free compartments...... was sectioned in a freezing microtome and analyzed for extracellular acid (pH 5.2) and alkaline (pH 8.5) phosphatase activity as well as depletion of NaHCO-3-extractable inorganic P (P-i) and P-o. Roots and mycorrhizal hyphae depleted the soil of P-i but did not influence the concentration of P-o in spite...

  2. Identification of differentially expressed genes in cucumber (Cucumis sativus L.) root under waterlogging stress by digital gene expression profile.

    Science.gov (United States)

    Qi, Xiao-Hua; Xu, Xue-Wen; Lin, Xiao-Jian; Zhang, Wen-Jie; Chen, Xue-Hao

    2012-03-01

    High-throughput tag-sequencing (Tag-seq) analysis based on the Solexa Genome Analyzer platform was applied to analyze the gene expression profiling of cucumber plant at 5 time points over a 24h period of waterlogging treatment. Approximately 5.8 million total clean sequence tags per library were obtained with 143013 distinct clean tag sequences. Approximately 23.69%-29.61% of the distinct clean tags were mapped unambiguously to the unigene database, and 53.78%-60.66% of the distinct clean tags were mapped to the cucumber genome database. Analysis of the differentially expressed genes revealed that most of the genes were down-regulated in the waterlogging stages, and the differentially expressed genes mainly linked to carbon metabolism, photosynthesis, reactive oxygen species generation/scavenging, and hormone synthesis/signaling. Finally, quantitative real-time polymerase chain reaction using nine genes independently verified the tag-mapped results. This present study reveals the comprehensive mechanisms of waterlogging-responsive transcription in cucumber. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. Some physiological and biochemical responses to copper of detached cucumber (cucumis sativus l.) cotyledons pre-floated in salicylic acid

    International Nuclear Information System (INIS)

    Gulengul, S.C.; Yildiz, T.; Deveci, D.

    2017-01-01

    Salicylic acid (SA) is a growth regulator that promotes growth of plants under stress and non-stress conditions. In the present investigation we studied the role of salicylic acid in copper induced physiological and biochemical changes and the possible induction of oxidative stress in detached cucumber cotyledons. Detached cotyledons of young cucumber seedlings were floated in 150 ppm SA. Then, the responses of these cotyledons to different concentrations (0, 10, 20 ve 50 mM) of copper (CuCl2. H2O) were investigated. In detached cucumber cotyledons exposed to increasing Cu concentrations, the fresh weight accumulation and the photosynthetic pigment content were decreased. Furthermore, the levels of some important parameters regarding oxidative stress in the cotyledons, namely lipid peroxidation (MDA), glutathione (GSH) and proline were increased. In the detached cucumber cotyledons pre-floation process with SA alleviated the negative effect of Cu ( 20 mM and 50 mM Cu) on growth parameters. (author)

  4. Reduction of bacterial growth by a vesicular-arbuscular mycorrhizal fungus in the rhizosphere of cucumber (Cucumis sativus L.)

    DEFF Research Database (Denmark)

    Christensen, H.; Jakobsen, I.

    1993-01-01

    Cucumber was grown in a partially sterilized sand-soil mixture with the vesicular-arbuscular mycorrhizal (VAM) fungus Glomus fasciculatum or left uninoculated. Fresh soil extract was places in polyvinyl chloride tubes without propagules of mycorrhizal fungi. Root tips and root segments...... and top of tubes, and of cocci with a diameter of 0.55-0.78 mum in the bulk soil in the center of tubes, were significantly reduced by VAM fungi. The extremely high bacterial biomass (1-7 mg C g-1 dry weight soil) was significant reduced by mycorrhizal colonization on root segments and in bulk soil...... biomass, and changed the spatial pattern of bacterial growth compared to non-mycorrhizal cucumbers. The [H-3]-thymidine incorporation was significantly higher on root tips in the top of tubes, and on root segments and bulk soil in the center of tubes on non-mycorrhizal plants compared to mycorrhizal...

  5. The uptake and metabolism of 3H-benzylaminopurine in tobacco (Nicotiana tabacum L.) and cucumber (Cucumis satfvus L.) explants

    Czech Academy of Sciences Publication Activity Database

    Klemš, M.; Balla, J.; Macháčková, Ivana; Eder, Josef; Procházka, S.

    2000-01-01

    Roč. 31, - (2000), s. 135-142 ISSN 0167-6903 R&D Projects: GA ČR GV206/96/K188; GA MŠk VS96082 Institutional research plan: CEZ:AV0Z5038910 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.837, year: 2000

  6. Long-term in vitro system for maintenance and amplification of root-knot nematodes in Cucumis sativus roots

    Directory of Open Access Journals (Sweden)

    Fernando E. eDíaz-Manzano

    2016-02-01

    Full Text Available Root-knot nematodes (RKN are polyphagous plant-parasitic roundworms that produce large crop losses, representing a relevant agricultural pest worldwide. After infection, they induce swollen root structures called galls containing giant cells (GCs indispensable for nematode development. Among efficient control methods are biotechnology-based strategies that require a deep knowledge of underlying molecular processes during the plant-nematode interaction. Methods of achieving this knowledge include the application of molecular biology techniques such as transcriptomics (massive sequencing or microarray hybridization, proteomics or metabolomics. These require aseptic experimental conditions, as undetected contamination with other microorganisms could compromise the interpretation of the results. Herein, we present a simple, efficient and long-term method for nematode amplification on cucumber roots grown in vitro. Amplification of juveniles (J2 from the starting inoculum is around 40-fold. The method was validated for three Meloidogyne species (M. javanica, M. incognita and M. arenaria, producing viable and robust freshly hatched J2s. These can be used for further in vitro infection of different plant species such as Arabidopsis, tobacco and tomato, as well as enough J2s to maintain the population. The method allowed maintenance of around 90 Meloidogyne spp. generations (one every two months from a single initial female over 15 years.

  7. A unique approach to demonstrating that apical bud temperature specifically determines leaf initiation rate in the dicot Cucumis sativus

    NARCIS (Netherlands)

    Savvides, Andreas; Dieleman, Anja; Ieperen, van Wim; Marcelis, Leo F.M.

    2016-01-01

    Main conclusion: Leaf initiation rate is largely determined by the apical bud temperature even when apical bud temperature largely deviates from the temperature of other plant organs.We have long known that the rate of leaf initiation (LIR) is highly sensitive to temperature, but previous studies

  8. Water Status Related Root-to-Shoot Communication Regulates the Chilling Tolerance of Shoot in Cucumber (Cucumis sativus L.) Plants.

    Science.gov (United States)

    Zhang, Zi-Shan; Liu, Mei-Jun; Gao, Hui-Yuan; Jin, Li-Qiao; Li, Yu-Ting; Li, Qing-Ming; Ai, Xi-Zhen

    2015-10-16

    Although root-to-shoot communication has been intensively investigated in plants under drought, few studies have examined root-to-shoot communication under chilling. Here we explored whether root-to-shoot communication contributes to the chilling-light tolerance of cucumber shoots and clarified the key signal involves in this communication. After leaf discs chilling-light treatment, the photoinhibitions of Photosystem I (PSI) and Photosystem II (PSII) were similar in leaf discs of two cucumber varieties (JY-3 and JC-4). When the whole plants, including roots, were chilled under light, the photosynthetic performances in JC-4 leaves decreased more seriously than that in JY-3 leaves. However, when the water status of leaves was maintained by warming roots or floating the attached leaves on water, the PSII activity and amount of PSI in the leaves of the two varieties were similar after chilling-light treatment. In addition, the differences of PSII activities and amount of PSI between the two varieties under whole plant chilling-light treatment were independent of ABA pretreatment. Above results indicate that (1) the better water status in leaves under chilling contributes to the higher chilling tolerance of JY-3; (2) the water status, rather than an ABA signal, dominates root-to-shoot communication under chilling and the chilling tolerance of cucumber shoot.

  9. Effects of Heat Shock on Photosynthetic Properties, Antioxidant Enzyme Activity, and Downy Mildew of Cucumber (Cucumis sativus L..

    Directory of Open Access Journals (Sweden)

    Xiaotao Ding

    Full Text Available Heat shock is considered an abiotic stress for plant growth, but the effects of heat shock on physiological responses of cucumber plant leaves with and without downy mildew disease are still not clear. In this study, cucumber seedlings were exposed to heat shock in greenhouses, and the responses of photosynthetic properties, carbohydrate metabolism, antioxidant enzyme activity, osmolytes, and disease severity index of leaves with or without the downy mildew disease were measured. Results showed that heat shock significantly decreased the net photosynthetic rate, actual photochemical efficiency, photochemical quenching coefficient, and starch content. Heat shock caused an increase in the stomatal conductance, transpiration rate, antioxidant enzyme activities, total soluble sugar content, sucrose content, soluble protein content and proline content for both healthy leaves and downy mildew infected leaves. These results demonstrate that heat shock activated the transpiration pathway to protect the photosystem from damage due to excess energy in cucumber leaves. Potential resistance mechanisms of plants exposed to heat stress may involve higher osmotic regulation capacity related to an increase of total accumulations of soluble sugar, proline and soluble protein, as well as higher antioxidant enzymes activity in stressed leaves. Heat shock reduced downy mildew disease severity index by more than 50%, and clearly alleviated downy mildew development in the greenhouses. These findings indicate that cucumber may have a complex physiological change to resist short-term heat shock, and suppress the development of the downy mildew disease.

  10. Evaluation of a integral systems greenhouse - solar dryer for small growers; Evaluacion de un sistema integral invernadero - secadero solar para pequenos productores

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Victor O; Iriarte, Adolfo A [INENCO, Universidad Nacional de Catamarca, Catamarca (Argentina); Carabajal, Dante; Sabadzija, Gabriela; Tomalino, Luis [E.E.A. INTA, Catamarca, Catamarca (Argentina)

    2000-07-01

    Due to poor yielding capacity in the province of Catamarca, Argentina, it is necessary to improve solar drying systems in order to have a better quality final product. It is also essential to divide the costs of infrastructure with other complementary activities because of the need to make drying methods profitable. The system proposed in this work is a dryer-greenhouse with a double purposed macrotunnel greenhouse: during Winter it is used as a yielding system, and in Summer it is prepared to fulfill the functions of a solar dryer. The crops evaluated in winter were: small vegetable marrow (Curcubita maxima L), melon (Cucumis melo), ad cucumber (Cucuis sativus). Crop cycle, harvest time and tield in Kg/m were determined for each species. The assessment of the dryer was made using pepper for paprika observation of the thermal behavior of the product during drying and its final quality. The product obtained had a very good quality in color, taste and aroma with a classification of extra quality according to the Argentine Nutritional Code and the 7541 ISO Standard. Drying time decreased considerably compared to that observed in open air drying, 1995, 1996 and 1997 campaigns were economically assessed, and an evaluation of investments in five years was also conducted obtaining a positive VAN and a TIR above the cost of the best alternative for money expenditure. This integrated system is valid alternative in a sustainable production for small growers. [Spanish] Debido a las caracteristicas productivas de la Provincia de Catamarca Argentina, es necesario optimizar los procesos del secado solar teniendo en cuenta la calidad final del producto. Ademas, debido a la necesidad de rentabilizar los metodos de secado, imprescindible repartir los costos de infraestructura con otro tipo de actividad complementaria. El sistema propuesto en este trabajo es un invernadero secadero que utiliza un invernadero macrotunel que cumple una doble funcion, durante el invierno se usa como

  11. Control biológico de enfermedades mediante el tratamiento de semillas de cucurbitáceas con rizobacterias promotoras del crecimiento de las plantas (PGPR./Biological control of diseases by cucurbits seeds treatment with rhizobacteria plant growth promoting (PGPR.

    Directory of Open Access Journals (Sweden)

    Gilda Jiménez Montejo

    2014-01-01

    Full Text Available Resumen:Las regulaciones sobre la producción de alimentos sanos limitan actualmente el uso de fungicidas sintéticos para el tratamiento de semillas y, por otra parte, no se dispone de bactericidas efectivos. Se condujeron experimentos en condiciones controladas para evaluar el efecto de las cepas de rizobacterias antagonistas Bacillus subtilis F16/95, B. subtilis Xph y Pseudomonas putida 14A en el control biológico de la Mancha bacteriana de las cucurbitáceas, la Mancha bacteriana del fruto de melón y la pudrición de la raíz, provocadas por Xanthomonas cucurbitae, Acidovorax avenae subsp. citrulli y Fusarium oxysporum, respectivamente. Se realizó el tratamiento de semillas de pepino (C. sativus, L. var. Poinsett, calabaza (Cucurbita moschata, Duch. var. INIVIT C-88, y melón de Castilla (Cucumis melo, L. var. Hale’s Best. Los tratamientos biológicos mostraron una reducción en la incidencia de las enfermedades e incrementos de longitud del tallo y peso fresco de hojas y raíces, en todas las interacciones planta-patógeno-antagonista. La colonización de raíces alcanzó rangos de 8,9-8,0 y 7,8-7,0 log (ufc cm-1 de raíz a los 4 y 15 días después de la siembra. Estos resultados caracterizaron las cepas aplicadas como rizobacterias promotoras del crecimiento vegetal (PGPR y aconsejan la realización de ensayos de campo./Abstract:Nowadays the regulations about the production of healthy foods limit the use of synthetic fungicides for seeds treatment and, on the other hand, effective bactericides are not available. Experiments under controlled conditions were conducted to evaluate the effect of rhizobacterial antagonistic strains Bacillus subtilis F16/95, B. subtilis Xph and Pseudomonas putida 14A on the biological control of Cucurbits bacterial spot, Watermelon bacterial fruit blotch and Fusarium root rot caused by Xanthomonas cucurbitae, Acidovorax avenae subsp. citrulli and Fusarium oxysporum, respectively. Cucumber (Cucumis sativus

  12. Mapping and Introgression of QTL Involved in Fruit Shape Transgressive Segregation into ‘Piel de Sapo’ Melon (Cucucumis melo L.)

    Science.gov (United States)

    Díaz, Aurora; Zarouri, Belkacem; Fergany, Mohamed; Eduardo, Iban; Álvarez, José M.; Picó, Belén; Monforte, Antonio J.

    2014-01-01

    A mapping F2 population from the cross ‘Piel de Sapo’ × PI124112 was selectively genotyped to study the genetic control of morphological fruit traits by QTL (Quantitative Trait Loci) analysis. Ten QTL were identified, five for FL (Fruit Length), two for FD (Fruit Diameter) and three for FS (Fruit Shape). At least one robust QTL per character was found, flqs8.1 (LOD = 16.85, R2 = 34%), fdqs12.1 (LOD = 3.47, R2 = 11%) and fsqs8.1 (LOD = 14.85, R2 = 41%). flqs2.1 and fsqs2.1 cosegregate with gene a (andromonoecious), responsible for flower sex determination and with pleiotropic effects on FS. They display a positive additive effect (a) value, so the PI124112 allele causes an increase in FL and FS, producing more elongated fruits. Conversely, the negative a value for flqs8.1 and fsqs8.1 indicates a decrease in FL and FS, what results in rounder fruits, even if PI124112 produces very elongated melons. This is explained by a significant epistatic interaction between fsqs2.1 and fsqs8.1, where the effects of the alleles at locus a are attenuated by the additive PI124112 allele at fsqs8.1. Roundest fruits are produced by homozygous for PI124112 at fsqs8.1 that do not carry any dominant A allele at locus a (PiPiaa). A significant interaction between fsqs8.1 and fsqs12.1 was also detected, with the alleles at fsqs12.1 producing more elongated fruits. fsqs8.1 seems to be allelic to QTL discovered in other populations where the exotic alleles produce elongated fruits. This model has been validated in assays with backcross lines along 3 years and ultimately obtaining a fsqs8.1-NIL (Near Isogenic Line) in ‘Piel de Sapo’ background which yields round melons. PMID:25126852

  13. Download this PDF file

    African Journals Online (AJOL)

    SAM

    Pangalo with sericeous ovaries, and C. melo ssp. melo with pilose ones. At present, the most adopted classification of melon is that of Munger and Robinson. (1991) who divided the species into a single wild variety,. C. melo var. agrestis Naud., and six cultivated ones: var. cantalupensis Naud. also including former var.

  14. Detection of viruses and the spatial and temporal spread patterns of viral diseases of cucurbits (Cucurbitaceae spp.) in the coastal savannah zone of Ghana

    International Nuclear Information System (INIS)

    Gyamena, A. E

    2013-07-01

    Cucurbits are susceptible to over 35 plant viruses; each of these viruses is capable of causing total crop failure in a poorly managed virus pathosystem. The objectives of this study were to detect the viruses that infect six cucurbit species in the coastal savannah zone of Ghana and to describe the spatial and temporal spread patterns of virus epidemics in zucchini squash (Cucurbita pepo L.) by the use of mathematical and geostatistical models. Cucumber (Cucumis sativus L.), watermelon (Citrullus lanatus Thunb.), zucchini squash (Cucurbita pepo L.), butternut squash (Cucurbita moschata Duchesne), egushi (Citrullus colocynthis L. Schrad.) and melon (Cucumis melo L.) were grown on an experimental field in the coastal savannah zone of Ghana and were monitored for the expression of virus and virus-like symptoms. The observed symptoms were further confirmed by Double Antibody Sandwich Enzyme-Linked Immunosorbent Assay (DAS ELISA) and mechanical inoculation of indicator plants. The temporal spread patterns of virus disease in zucchini squash were analyzed by exponential logistic, monomolecular and gompertz mechanistic models. The spatial patterns of virus disease spread in zucchini squash field were analyzed by semivariograms and inverse distance weighing (IDW) methods. Cucumber, zucchini squash, melon and butternut squash were infected by both Cucumber mosaic virus (CMW) and Papaya ringspot virus (PRSV-W). Egushi was infected by CMW but not PRSV-W. None of the six cucurbit species were infected by Watermelon mosaic virus (WMV) or Zucchini yellow mosaic virus (ZYMV). The temporal pattern of disease incidence in the zucchini squash field followed the gompertz function with an average apparent infection rate of 0.026 per day. The temporal pattern of disease severity was best described by the exponential model with coefficient of determination of 94.38 % and rate of progress disease severity of 0.114 per day. As at 49 days after planting (DAP), disease incidence and

  15. An ethnomedicinal survey of cucurbitaceae family plants used in the folk medicinal practices of Bangladesh 1

    Directory of Open Access Journals (Sweden)

    Mohammed Rahmatullah

    2012-01-01

    Full Text Available Background: The Cucurbitaceae family comprising about 125 genera and 960 species is a family that is further characterized by commonly having five-angled stems and coiled tendrils and is also known as gourd family of flowering plants. Plant species belonging to this family have a worldwide distribution, but most species can be found in tropical and subtropical countries. A number of the plants belonging to this family have reported important pharmacological activities. Cucurbitaceae family plants are also in use in the folk medicinal system of Bangladesh-a traditional medicinal system, which mainly relies on medicinal plants for treatment of diverse ailments. Aims: Since folk medicinal practitioners form the first tier of primary health care in Bangladesh, the objective of this study was to conduct ethnomedicinal surveys among 75 folk medicinal practitioners (Kavirajes practicing among the mainstream Bengali-speaking population of randomly selected 75 villages in 64 districts of Bangladesh and 8 tribal practitioners (1 each from 8 major indigenous communities or tribes, namely, Bede, Chakma, Garo, Khasia, Marma, Murong, Santal, and Tripura of the country. Materials and Methods: Surveys were carried out with the help of a semi-structured questionnaire and the guided field-walk method. Results: It was observed that the folk and tribal medicinal practitioners use a total of 19 Cucurbitaceae family species for treatment of ailments such as dysentery, diabetes, edema, skin disorders, leukoderma, hypertension, jaundice, typhoid, spleen disorders, respiratory problems, leprosy, rheumatoid arthritis, chicken pox, and cancer. The 19 species of Cucurbitaceae family plants in use were Benincasa hispida, Bryonopsis laciniosa, Citrullus colocynthis, Citrullus lanatu, Coccinia grandis, Cucumis melo, Cucumis sativus, Cucurbita maxima, Cucurbita pepo, Hodgsonia macrocarpa, Lagenaria vulgaris, Luffa acutangula, Luffa cylindrica, Momordica charantia, Momordica

  16. Genome wide characterization of simple sequence repeats in watermelon genome and their application in comparative mapping and genetic diversity analysis.

    Science.gov (United States)

    Zhu, Huayu; Song, Pengyao; Koo, Dal-Hoe; Guo, Luqin; Li, Yanman; Sun, Shouru; Weng, Yiqun; Yang, Luming

    2016-08-05

    Microsatellite markers are one of the most informative and versatile DNA-based markers used in plant genetic research, but their development has traditionally been difficult and costly. The whole genome sequencing with next-generation sequencing (NGS) technologies provides large amounts of sequence data to develop numerous microsatellite markers at whole genome scale. SSR markers have great advantage in cross-species comparisons and allow investigation of karyotype and genome evolution through highly efficient computation approaches such as in silico PCR. Here we described genome wide development and characterization of SSR markers in the watermelon (Citrullus lanatus) genome, which were then use in comparative analysis with two other important crop species in the Cucurbitaceae family: cucumber (Cucumis sativus L.) and melon (Cucumis melo L.). We further applied these markers in evaluating the genetic diversity and population structure in watermelon germplasm collections. A total of 39,523 microsatellite loci were identified from the watermelon draft genome with an overall density of 111 SSRs/Mbp, and 32,869 SSR primers were designed with suitable flanking sequences. The dinucleotide SSRs were the most common type representing 34.09 % of the total SSR loci and the AT-rich motifs were the most abundant in all nucleotide repeat types. In silico PCR analysis identified 832 and 925 SSR markers with each having a single amplicon in the cucumber and melon draft genome, respectively. Comparative analysis with these cross-species SSR markers revealed complicated mosaic patterns of syntenic blocks among the genomes of three species. In addition, genetic diversity analysis of 134 watermelon accessions with 32 highly informative SSR loci placed these lines into two groups with all accessions of C.lanatus var. citorides and three accessions of C. colocynthis clustered in one group and all accessions of C. lanatus var. lanatus and the remaining accessions of C. colocynthis

  17. Efeito do ambiente protegido cultivado com melão sobre os elementos meteorológicos e sua relação com as condições externas Effect of greenhouse cultivated with melon crop under meteorological elements and its relationship with external conditions

    Directory of Open Access Journals (Sweden)

    Manuel A. N. Vásquez

    2005-04-01

    Full Text Available O objetivo deste trabalho foi estudar o efeito do ambiente protegido cultivado com melão (Cucumis melo L. sobre os elementos meteorológicos e sua relação com as condições externas. O experimento foi conduzido no período de 5-10-2001 a 7-1-2002, em estufa plástica de 420 m², construída com estrutura metálica galvanizada, com dois vãos de altura central de 4,6 m e lateral de 3,0 m, composto de quatro janelas frontais, cobertas com filme de polietileno transparente de alta densidade, com aditivo ultravioleta e espessura de 150 µm. A irrigação foi efetuada por gotejamento, com lâmina total de 279,6 mm, manejada utilizando um minitanque instalado no interior do ambiente. Os elementos meteorológicos foram obtidos por sistema de aquisição automático instalado no interior do ambiente protegido e, externamente, com medidas da radiação global, temperatura e umidade relativa do ar. Verificou-se que a radiação solar global e a umidade relativa no ambiente protegido foram, em média, inferiores às condições externas, enquanto a temperatura foi superior no período analisado. A relação entre os elementos meteorológicos medidos externamente e no interior do ambiente protegido foi expressa por meio de equações de regressão linear e quadrática.The objective of this research was to study the effect of greenhouse cultivated with melon (Cucumis melo L. under meteorological elements and its relationship with external conditions. The study was carried out during the period of October 5, 2001 to January 7, 2002. The greenhouse had 420 m², constructed in galvanized metallic structure with two voids, height in the central part of 4.6 m and lateral of 3.0 m, having four front windows covered with a film of transparent polyethylene of high density with addictive ultraviolet and thickness of 150 µm. A drip irrigation system was used with a total water depth of 279.6 mm applied. The irrigation management was done through a small

  18. Armazenamento sob condições ambiente e aceitabilidade do melão 'F1 Jangada' produzido em sistema hidropônico Storage under atmosphere conditions and acceptability of the melon 'F1 Jangada' croped in hydroponic system

    Directory of Open Access Journals (Sweden)

    Maria M. Rinaldi

    2006-12-01

    Full Text Available O objetivo deste trabalho foi determinar o período de armazenamento pós-colheita e a aceitabilidade pelo consumidor de melão híbrido 'F1 Jangada' (Cucumis melo L., produzido em sistema hidropônico, mantido em condições ambiente (22 ± 2 ºC e umidade relativa de 40 ± 5%. O experimento compreendeu o período de 21-6-2005 a 2-8-2005. Foi utilizado o esquema fatorial 5 x 2, em delineamento experimental inteiramente casualizado, com cinco períodos de armazenamento (0; 7; 21; 28 e 42 dias e dois tipos de substrato (areia e fibra de coco, com três repetições, em que cada repetição consistiu em cinco frutos de meloeiro. Foram avaliados o pH, a acidez titulável, os sólidos solúveis, a perda de massa fresca, a análise sensorial e a decisão de compra dos melões. Foram verificados efeitos do tipo de substrato e tempo de armazenamento sobre os valores de pH dos melões. A acidez titulável dos melões diminuiu significativamente nos primeiros sete dias de armazenamento, em ambos os substratos. Não foram verificados efeitos do tipo de substrato e tempo de armazenamento nos sólidos solúveis dos melões durante o armazenamento. Não houve diferença de perda de massa fresca dos frutos produzidos nos dois substratos, sendo de 7,1 ± 0,2%, durante os 42 dias de armazenamento. O tipo de substrato não interferiu na aparência geral, cor, textura e sabor dos melões. Aos 42 dias de armazenamento, os melões produzidos nos dois tipos de substrato apresentaram-se aceitáveis pelo consumidor. No entanto, os produzidos no substrato com areia apresentaram melhor aceitabilidade e decisão de compra ao longo do armazenamento.The objective of this work was to evaluate the storage period postharvest and acceptability by consumer of hybrid melon 'F1 Jangada' (Cucumis melo L., produced in hydroponic system, stored in atmosphere conditions (22 ± 2 ºC and 40 ± 5% relative humidity. The research was carried from June 21st to August 2nd, 2005. It was

  19. Efeito da concentração de nitrogênio na solução nutritiva e do número de frutos por planta sobre a produção do meloeiro Effect of nitrogen concentration in nutrient solution and number of fruits per plant on yield of melon

    Directory of Open Access Journals (Sweden)

    Luis Felipe V. Purquerio

    2003-06-01

    Full Text Available O trabalho foi conduzido em casa de vegetação, na UNESP em Jaboticabal (SP, de junho a novembro de 2001, com o objetivo de avaliar a produção do melão (Cucumis melo var. reticulatus, híbrido Bônus nº2, cultivado em sistema hidropônico NFT, em função da concentração de nitrogênio na solução nutritiva (80, 140, 200 e 300 mg L-1 e número de frutos por planta (2, 3, 4 e livre. O delineamento experimental utilizado foi o de blocos ao acaso, em parcelas subdivididas, com seis repetições. Aos 80 dias após o transplantio, foram observados 2, 3, 4 e 5,1 frutos por planta e, posteriormente na colheita, 2, 2,9, 3,0 e 3,4 frutos por planta, respectivamente para os tratamentos com 2, 3, 4 e fixação livre, sendo esta redução atribuída ao abortamento de frutos. Houve redução no peso médio do 1º, 2º e 3º fruto colhido, com o aumento da concentração de nitrogênio. Plantas com o menor número de frutos, apresentaram maior peso médio dos mesmos, porém com menor produção por planta. A maior produção (2.474 g/planta foi obtida com 80 mg L-1 de nitrogênio na solução nutritiva.The effects of different nitrogen concentrations (80; 140; 200 and 300 mg L-1 and fruit number per plant (2; 3; 4 and free setting, were investigated on net melon production (Cucumis melo var. reticulatus, Bonus nº 2 hybrid. The experiment was carried out in Jaboticabal, São Paulo State, Brazil, in NFT hydroponic system, from June to November, 2001. The experimental design was of randomized split plots, replicated six times. At 80 days after seedling transplant 2; 3; 4 and 5.1 fruits per plant were found. However, at harvest there were 2; 2.9; 3.0 and 3.4 fruits per plant, relative to 2; 3; 4 and free setting per plant treatment. This observed fruit reduction was attributed to fruit abortion. With the increase of nitrogen concentrations a reduction in first, second and third fruit weight was found. Plants with fewer fruits, produced higher average

  20. Qualidade final de melão osmoticamente desidratado em soluções de sacarose com adição de ácidos Quality of osmotically dehydrated melon in sucrose solutions with addition of acids

    Directory of Open Access Journals (Sweden)

    Eliana Janet Sanjinez Argandoña

    2002-12-01

    Full Text Available A desidratação osmótica associada à adição de ácidos fracos representa uma alternativa de processamento brando, resultando em um produto com características sensoriais praticamente inalteradas e apropriado para o consumo imediato. O objetivo deste estudo foi avaliar a influência dos ácidos cítrico e lático na obtenção de melão osmoticamente desidratado e na qualidade final do produto. Pedaços de melão (Cucumis melo inodorus, cultivar: Gold Mine, de 40x30x15 mm, foram imersos em três tipos de soluções (sacarose + ácido cítrico, sacarose + ácido lático e sacarose com diferentes concentrações de sacarose (50 a 70ºBrix. A desidratação osmótica foi realizada em temperatura controlada (30 a 50ºC por até três horas. A adição de ácidos não influenciou significativamente na variação da cromaticidade. No entanto, a concentração da solução desidratante e a temperatura tiveram efeitos significativos no aumento da luminosidade do produto. A tensão na ruptura foi menor nas amostras processadas em relação à fruta fresca, porém a deformação na ruptura foi significativamente mais alta nas amostras tratadas com ácido lático a 50ºC, fornecendo produtos mais viscoelásticos, porém mais firmes.The combination of osmotic dehydration and weak acids addition is a mild process that results in a final product with organoleptic characteristics very similar to fresh and "ready to eat" fruit, appropriate for immediate consumption. The purpose of this work was to evaluate the influence of citric and lactic acids on the production of osmotically dehydrated melon and on its final quality. Melon (Cucumis melo inodorus, cultivar Gold Mine pieces of 40x30x15 mm were immersed in three types of dehydrating solutions (sucrose + citric acid, sucrose + lactic acid and control of different concentrations (50 to 70ºBrix. Osmotic dehydration was carried out for up to three hours under controlled temperature (30 to 50ºC. The addition

  1. Fontes e métodos de aplicação de fósforo na cultura do melão Sources and application methods of phosphorus on the melon crop

    Directory of Open Access Journals (Sweden)

    Luiza Teixeira de Lima Brito

    1999-10-01

    Full Text Available Em Petrolina, PE, foi realizado um estudo com a cultura do melão (Cucumis melo L., cultivar Valenciano Amarelo, num Latossolo Vermelho-Amarelo, com o objetivo de avaliar o efeito de fontes de fósforo aplicadas convencionalmente (em fundação e via água de irrigação. O experimento consistiu de cinco tratamentos: 1. superfosfato simples; 2. MAP (fosfato monoamônico, aplicados pelo método convencional (em fundação; 3. MAP aplicado até 15 dias após a germinação; 4. MAP aplicado até 30 dias após a germinação e 5. MAP aplicado até 42 dias após a germinação. Nos tratamentos 3, 4 e 5 o MAP foi aplicado via água de irrigação. Os tratamentos receberam a mesma dosagem de fósforo (120 kg/ha de P2O5, conforme recomendado pela análise do solo. O delineamento experimental foi o de blocos casualizados, com quatro repetições. Constatou-se que as maiores produtividades de frutos comerciais foram obtidas com MAP (27,42 t/ha e com superfosfato simples (25,96 t/ha aplicados pelo método convencional, não diferindo do MAP aplicado via água de irrigação até 30 e 42 dias após a germinação, mas superando a produtividade de 19,47 t/ha obtida com o MAP aplicado via água de irrigação até 15 dias após a germinação. Verificou-se que as fontes de fósforo e os modos de aplicação não influenciaram no peso médio dos frutos (1,86 kg/fruto -- 89,40% dos frutos obtidos enquadraram-se nos tipos 6 e 8 -- e no teor de sólidos solúveis nos frutos por ocasião da colheita, cujos valores oscilaram entre 12,75 e 13,17º Brix.This study was carried out at Petrolina, PE, Brazil, with the objective of evaluating the effect of two sources of phosphorus applied conventionally and through trickle water irrigation on melon (Cucumis melo L., cv. Valenciano Amarelo. The experiment was run in a randomized complete blocks design, with four replications and five treatments: 1. simple superphosphate; 2. monoammonium phosphate (MAP applied

  2. Reaction of melon genotypes to the gummy stem blight and the downy mildew Reação de genótipos de melão ao crestamento gomoso e ao míldio

    Directory of Open Access Journals (Sweden)

    Gil R dos Santos

    2009-06-01

    Full Text Available The gummy stem blight (Didymella bryoniae and the downy mildew (Pseudoperonospora cubensis are two foremost melon (Cucumis melo diseases, considering their effects on yield and fruit quality. Despite the importance of such diseases, relatively few studies have been done so far on the identification of resistance sources to D. bryoniae and P. cubensis in Brazil. This work aimed at evaluating the resistance of commercial melon genotypes to the gummy stem blight and the downy mildew. Firstly, the most aggressive and representative D. bryoniae isolate was selected. Subsequently, the resistance of 86 melon genotypes to stem infection was studied upon greenhouse conditions by inoculating with the previously selected isolate. Afterwards, the resistance to mildew and leaf infection by D. bryoniae of 28 melon genotypes was evaluated in the field, under natural infection. In the greenhouse, all 86 melon genotypes were infected and showed stem infection symptoms caused by D. bryoniae four days after inoculation. Nevertheless, a significant variation on the resistance levels of the melon genotypes was found. Under field conditions and natural inoculation, genotypes Taslaki and Sary Juliabi were the most susceptible to leaf infection by D. bryoniae, significantly differing from the other genotypes. The lowest levels of susceptibility were identified in genotypes Perlita Busle S1, Valenciano Elíptico, Glaver, MR1, and 2526. All genotypes were susceptible to the downy mildew, albeit differing in susceptibility levels.O crestamento gomoso do caule (Didymella bryoniae e o míldio (Pseudoperonospora cubensis estão entre as principais doenças do meloeiro (Cucumis melo ocasionando redução da produtividade e da qualidade dos frutos. Apesar da importância dessas doenças, são poucos os trabalhos envolvendo a identificação de fontes de resistência a D. bryoniae e a P. cubensis no Brasil. O objetivo deste trabalho foi avaliar a resistência de gen

  3. Substrato e solução nutritiva desenvolvidos a partir de efluente de biodigestor para cultivo do meloeiro Substrate and nutrient solution developed using a biodigestor effluent for melon cultivation

    Directory of Open Access Journals (Sweden)

    Luiz V. E. Villela Jr.

    2007-04-01

    Full Text Available Buscando a sustentabilidade em uma pequena propriedade agrícola visou-se com o presente estudo, ao aproveitamento do efluente de biodigestor proveniente da fermentação anaeróbia de estrume bovino, no cultivo sem solo do meloeiro. O experimento foi conduzido em Jaboticabal, SP, Brasil, localizado na Latitude 21º 15- 22" S e Longitude 48º 18- 58" W. Cultivou-se o meloeiro (Cucumis melo L. cv. Bonus nº 2 em substrato, com semeadura realizada em outubro de 2003 e se utilizou delineamento experimental em blocos casualisados com 16 tratamentos e 5 repetições, em esquema fatorial 4 x 4 (4 substratos e 4 soluções nutritivas. Os 4 substratos se compunham de diferentes proporções da mistura entre a parte sólida do efluente de biodigestor e a areia grossa lavada; as 4 soluções nutritivas foram compostas pela parte líquida do efluente de biodigestor (biofertilizante em substituição a adubos minerais hidrossolúveis. A adição do efluente à areia proporcionou crescimento vegetativo mais rápido, maior precocidade na colheita, frutos mais pesados e maior produtividade à cultura do meloeiro. Adubos minerais hidrossolúveis utilizados no cultivo de plantas em substrato podem ser parcialmente substituídos pelo biofertilizante estudado.Looking for the sustainability of a small farming enterprise, the present study focused the benefit of the biodigestor effluent resulting from the anaerobic fermentation of the bovine manure in a soilless melon plant experiment. The research was conducted in Jaboticabal, in the State of Sao Paulo, Brazil, at latitude of 21° 15- 22-- S and a longitude of 48° 18- 58-- W. The melon plant (Cucumis melo L. cv Bonus n° 2 was grown with substrate, seedling obtained in 10/2003. An experimental design was adapted in a randomized block with 16 treatments and 5 replications in a factorial 4 x 4 (4 substrates and 4 nutrient solutions. The 4 substrates were made up of different proportions in volume of the blend

  4. Crescimento e acúmulo de N, P e K pelo meloeiro irrigado com água salina Growth and N, P and K accumulation by melon irrigated with saline water

    Directory of Open Access Journals (Sweden)

    José Francismar de Medeiros

    2008-12-01

    Full Text Available O uso de água salina na irrigação é muito comum em cultivos de melão em regiões semi-áridas, o que pode resultar na salinização do solo e redução de rendimento se o manejo da irrigação não for adequado. O presente trabalho teve como objetivo avaliar o crescimento e o acúmulo de N, P e K em plantas de melão (Cucumis melo, L. irrigadas com água salina. Os tratamentos estudados resultaram da combinação de dois fatores: salinidade da água de irrigação (1,1; 2,5 e 4,5 dS m-1 e materiais de melão (híbrido Trusty e cultivar Orange Flesh. O delineamento estatístico adotado foi de blocos inteiramente casualizados com quatro repetições, com tratamentos arranjados em esquema fatorial 3 x 2. A época de coleta de plantas foi analisado como outro fator e os resultados interpretados por análise multivariada. As plantas amostradas foram fracionadas em folhas + ramos e frutos, determinaram-se as produções de matérias secas e os conteúdos de N, P e K nestes materiais. Os acúmulos dos nutrientes nos frutos e de fitomassa seca na planta diminuíram com o incremento da salinidade da água de irrigação. Os frutos exportaram, em média, 57,1%, 67,1% e 70,0% dos totais de N, P, K, absorvidos pela planta e alocados na parte aérea, mostrando, portanto, que foram o principal dreno para estes nutrientes na planta.The use of saline water for irrigation is very common in cultivation of melon in semiarid zones, which can result in the soil salinization if irrigation management is not appropriate. The growth and accumulation of N, P and K by melon (Cucumis melo, L. irrigated with saline water was evaluated. Treatments resulted from the combination of the factors irrigation water salinity levels (1.1; 2.5 and 4.5 dS m-1 and melon materials (hybrid Trusty and cultivar Orange Flesh. Treatments were arranged following a completely randomized block design with four replications, arranged in 3 x 2 factorial. Another factor analyzed was time of

  5. Muskmelon seed germination and seedling development in response to seed priming Germinação de sementes e desenvolvimento de plântulas de melão em resposta ao condicionamento osmótico

    Directory of Open Access Journals (Sweden)

    Warley Marcos Nascimento

    2003-02-01

    Full Text Available Important factors affecting seed priming have not been extensively reported in muskmelon (Cucumis melo L. studies. The optimization of the seed priming technique becomes very important at the commercial scale. Little information has been reported on seedling development of muskmelon subsequent to seed priming. Seeds of muskmelon were primed in darkness at 25°C in different solutions and three osmotic potentials. Seeds were also primed with and without aeration during different periods. In relation to osmotic solutions, an osmotic potential around -1.30 MPa is most adequate for muskmelon priming. Salt solutions gave better germination rate but were deleterious for seed germination, especially at higher osmotic potentials. Aeration of the soaking salt solution gave faster germination at 17°C, and because of the early germination, these treatments probably presented a better seedling development. Deleterious effect on total seed germination was observed for long soaking periods with aeration. Fungal growth increased on seeds primed in aerated solutions. Seeds from priming treatments had a better germination rate and seedling development under 17 and 25°C.Importantes fatores afetando o condicionamento osmótico não têm sido extensivamente relatados em sementes de melão (Cucumis melo L.. A otimização do condicionamento osmótico é extremamente importante em uma escala comercial. Poucas informações têm sido relatadas quanto ao desenvolvimento de plântulas em resposta ao condicionamento osmótico de sementes de melão. Sementes de melão foram condicionadas a 25°C, na ausência de luz, em diferentes soluções osmóticas utilizando três potenciais osmóticos para cada solução. Em outro estudo, sementes foram condicionadas com ou sem aeração durante vários períodos. Indiferentemente das soluções osmóticas, o potencial osmótico em torno de - 1,30 MPa foi mais adequado para o condicionamento osmótico. Sementes condicionadas em

  6. Dynamic of epigeous macrofauna under organic soil management in the Brazilian semi-arid regionDinâmica da macrofauna epígea sob manejo orgânico do solo no semi-árido brasileiro

    Directory of Open Access Journals (Sweden)

    Márcio Sampaio Pimentel

    2012-04-01

    Full Text Available Soil macrofauna is responsible for soil fertility through cycling of nutrients, tillage and fragmentation of organic matter, as well as through the association between groups of fauna with conserved and/or degraded pedoenvironments. Nevertheless, under the conditions of the Brazilian semi-arid region, there is little information about this resource. The objective of this study was to evaluate the epigeous macrofauna in successive cropping using previous green manure and subsequent planting of melon (Cucumis melo L. in Juazeiro county, Bahia, Brazil. Sampling dates were undertaken in November 2007 and February, April and July 2008, using traps containing 4 % formaldehyde for seven days in plots of 64 m2. Results obtained indicate that there is no difference among the treatments with mixed cover crops, and epigeous macrofauna is influenced by the time of collection. Diversity and uniformity are inversely correlated with total density of epigeous macrofauna. Diversification of plant species favors the increase of diversity and uniformity of epigeous macrofauna. Formicidae, followed by Isopoda, Coleoptera and Oligochaeta are the groups of fauna most numerous in the areas. A macrofauna do solo é responsável pela melhoria da fertilidade do solo através da ciclagem de nutrientes, revolvimento e fragmentação da matéria orgânica, como também, pela associação entre grupos de fauna com pedoambientes conservados e/ou degradados. No entanto, nas condições de semi-árido brasileiro pouca informação se tem a respeito deste recurso. Neste sentido, na região do sub-médio do Rio São Francisco, pólo de desenvolvimento da agricultura irrigada objetivou-se avaliar a macrofauna epígea em sucessão cultural utilizando prévia adubação verde e subseqüente plantio de melão (Cucumis melo L.. As coletas foram realizadas em novembro de 2007 e fevereiro, abril e julho de 2008 no município de Juazeiro, BA, utilizando armadilhas contendo formol 4

  7. Estudo da utilização do efluente de biodigestor no cultivo hidropônico do meloeiro Utilization of biodigestor effluent in the hydroponic cultivation of melon

    Directory of Open Access Journals (Sweden)

    Luiz V. E. Villela Junior

    2003-04-01

    Full Text Available Objetivando-se o aproveitamento do efluente de biodigestor no cultivo hidropônico do meloeiro, desenvolveu-se a presente pesquisa. O experimento foi conduzido no Departamento de Engenharia Rural da Faculdade de Ciências Agrárias e Veterinárias da UNESP, campus de Jaboticabal, cultivando-se o meloeiro (Cucumis melo L. cv. Bonus nº 2. O delineamento experimental utilizado foi em blocos casualisados, com 6 repetições, cujos tratamentos foram: 1 cultivo hidropônico em sistema fechado tipo NFT ("nutrient film technique" com uso de solução nutritiva organo-mineral (biofertilizante com complementação mineral; 2 cultivo hidropônico em sistema fechado tipo NFT, com uso de solução nutritiva 100% mineral; 3 cultivo hidropônico em sistema aberto, com substrato e solução nutritiva organo-mineral e 4 cultivo hidropônico em sistema aberto, com substrato e solução nutritiva 100% mineral. O biofertilizante e o substrato foram obtidos a partir do efluente de biodigestor, produzido com estrume bovino. As plantas cultivadas no tratamento 1 tiveram desenvolvimento prejudicado, devido ao acúmulo de partículas sólidas junto ao sistema radicular. O tratamento 2 proporcionou às plantas desenvolvimento vegetativo mais rápido e maior produtividade. Os frutos produzidos no tratamento 2 apresentaram maior peso, formato mais alongado e maior teor de sólidos solúveis totais. A substituição parcial de adubos minerais por biofertilizante mostrou-se possível em sistema hidropônico aberto com substrato.With the objective to use effluent of biodigestor in the hydroponic cultivation, an experiment was conducted in the Department of Rural Engineering Faculty of Agricultural and Veterenary Sciences of UNESP, campus of Jaboticabal where a melon crop (Cucumis melo L. cv. Bonus nº 2 was cultivated. The experimental design used was a randomized blocks, with 6 repetitions and the treatments studied were: 1 hydroponic cultivation in closed system type NFT

  8. Concentração salina e fases de exposição à salinidade do meloeiro cultivado em substrato de fibra de coco Salt concentration and phases of exposure tosalinity of melon grown in coconut fiber substrate

    Directory of Open Access Journals (Sweden)

    Nildo da Silva Dias

    2011-09-01

    Full Text Available No semiárido, a escassez de água de boa qualidade faz com que os produtores utilizem água salobra para preparar a solução nutritiva. Com o objetivo de investigar a utilização de água salobra na irrigação de meloeiro (Cucumis melo L., cv. AF 015 cultivado em substrato de fibra de coco em casa de vegetação, plantas foram nutridas com soluções salinas de condutividades elétricas (CEs 1,1 (testemunha; 2,5; 4,0 e 5,5 dS m-1 aplicadas durante as fases: crescimento vegetativo (10-30 dias após o transplantio-DAT; florescimento (31-50 DAT e frutificação e maturação (51-70 DAT. O delineamento experimental foi o inteiramente casualizado, com 12 tratamentos arranjados em um esquema fatorial 4x3 (níveis de salinidade x tempo de exposição dos sais, com três repetições. Houve correlação na perda relativa por incremento de CEs das variáveis de crescimento e de produção do meloeiro em função da salinidade da solução nutritiva para cada fase de exposição. As soluções nutritivas preparadas com água salobra podem ser utilizadas no cultivo do meloeiro em substrato de fibra de coco com o mínimo de perdas relativas de massa média de frutos por incremento de CEs, quando aplicadas na fase de florescimento.Scarcity of good water quality in semiarid region causes producers to use brackish water to prepare the nutrient solution. In order to investigate the use of brackish water in irrigation of greenhouse-melon (Cucumis melo L., cv. AF 015 grown in coconut fiber substrate, plants were irrigated with saltine nutrient solutions of electrical conductivities (ECs of 1.1 (control, 2.5, 4.0 and 5.5 dS m-1, applied during the phases of vegetative growth (10-30 days after transplanting, DAT, flowering (31-50 DAT and fruiting and ripening (51-70 DAT. The design was completely randomized, with 12 treatments arranged in a 4x3 factorial design (salinity levels x exposure time of the salts, with three replications. There was a correlation in

  9. Fontes de fósforo aplicadas na cultura do melão via água de irrigação Souces of phosphorus applied through fertigation muskmelon

    Directory of Open Access Journals (Sweden)

    Luiza Teixeira de Lima Brito

    2000-04-01

    Full Text Available Este estudo teve por objetivo avaliar o efeito de fontes de fósforo aplicadas via água de irrigação e, de modo convencional, na cultura do melão (Cucumis melo L., híbrido AF-682, em um Latossolo Vermelho-Amarelo. As fontes analisadas foram superfosfato simples, fosfato monoamônico (MAP e ácido fosfórico, aplicadas até 30 e 42 dias após o plantio. Todos os tratamentos receberam a mesma dosagem (120 kg ha-1 de P2O5, conforme recomendado pela análise do solo. O delineamento experimental foi de blocos casualizados, com quatro repetições. Constatou-se que as maiores produtividades de frutos comerciais foram obtidas com ácido fosfórico (32,20 e 28,90 t ha-1 aplicado via água de irrigação até 42 e 30 dias após a germinação, respectivamente, não diferindo das produtividades com o MAP aplicado via água de irrigação até 42 dias após a germinação (27,95 t ha-1 e pelo modo convencional (26,92 t ha-1. Verificou-se que as fontes de fósforo e os modos de aplicação não influenciaram no peso médio dos frutos (1,43 kg, sendo que 65% dos frutos obtidos se enquadraram nos tipos 8 a 10; entretanto, observou-se diferença significativa para o teor de sólidos solúveis totais (SST nos frutos, por ocasião da colheita, com o maior valor obtido com o ácido fosfórico (12,53º brix.This study was carried out with the objective of evaluating the effect of three phosphorus sources applied conventionally and through trickle irrigation on melon crop (Cucumis melo L., hybrid AF-682. The sources of phosphorus were simple superphosphate, monoammonium phosphate (MAP and phosphoric acid applied up to 30 and 42 days after germination through trickle irrigation and conventionally. The experiment was conducted in a completely randomized block design, with four replications. All the treatments had the same amount of phosphorus (120 kg ha-1 of P2O5 according to soil analysis. The highest commercial fruit yields were obtained with phosphoric acid

  10. Crescimento de meloeiro sob estresse salino e doses de potássio Growth of melon cultivated under saline stress and potassium doses

    Directory of Open Access Journals (Sweden)

    Marcelo T. Gurgel

    2010-01-01

    Full Text Available O Estado do Rio Grande do Norte, em destaque a região da Chapada do Apodi, se destaca na produção e exportação de melão no País, em regime de irrigação, devido à distribuição pluvial baixa e irregular. A Chapada do Apodi possui dois aqüíferos subterrâneos; a do lençol menos profundo de alta salinidade, porém com menor custo de bombeamento, ocorrendo o contrário com o de maior profundidade. Objetivou-se, ante o exposto, avaliar o efeito de duas águas de salinidades diferentes (0,52 e 2,41 dS m-1, combinadas com cinco doses de K2O (218, 273, 328, 383 e 438 kg ha-1 sobre o crescimento do meloeiro (Cucumis melo L., cultivar Goldex, utilizando-se do delineamento de blocos ao acaso, com parcelas subdivididas; amostras de planta foram coletadas aos 21, 28, 35, 49 e 63 dias após a semeadura, determinando-se a fitomassa seca das plantas, estas separadas em ramos (caule + folhas, flores e frutos; avaliou-se, também, a taxa de crescimento absoluto e relativo e a produção de frutos. Em geral, o crescimento do melão foi favorecido com o uso de água mais salina; a taxa de crescimento absoluto foi máxima entre 35 e 49 dias após a semeadura. Obteve-se maior produção de fitomassa total com 438 kg ha-1 de K2O e uso de água mais salina, ao final do ciclo.The region of 'Chapada do Apodi', in the State of Rio Grande do Norte, stands out in Brazilian production and exportation of melon. This region possesses two aquiffers, one of lower exploration cost, though of high salinity, another of low salinity, with higher cost and limited use. This work was carried out with the objective to evaluate the effect of waters of different salinities combined with five doses of K in the dry matter accumulation and productivity of the melon (Cucumis melo L. cultivar Goldex. The experimental design adopted was split plot in completely randomized blocks. The melon crop was irrigated with low (0.52 dS m-1 and high (2.41 dS m-1 salinity water combined with

  11. Conservação pós-colheita de melão Charentais tratado com 1-MCP e armazenado sob refrigeração e atmosfera modificada Postharvest conservation of charentais melons treated with 1-MCP and stored under refrigeration and modified atmosphere

    Directory of Open Access Journals (Sweden)

    Pahlevi A de Souza

    2008-12-01

    Full Text Available Objetivando avaliar a vida útil pós-colheita de melão tipo Charentais (Cucumis melo L. sob refrigeração, tratados com 1-MCP e associado ou não a atmosfera modificada (AM, foram conduzidos dois experimentos em laboratório da Embrapa Agroindústria Tropical, Fortaleza-CE. Os frutos foram provenientes da Agroindústria Nolem Comercial Importadora e Exportadora Ltda, localizada no Agropólo Mossoró Açu-RN. Os frutos foram tratados com 300 e 600 ppb de 1-MCP, em seguida, metade desses frutos foram embalados em filmes plásticos, mantendo-se frutos embalados sem aplicação de 1-MCP nas mesmas condições de armazenamento dos demais. Os melões foram armazenados por 21 dias sendo 14 dias (9±1ºC e 87±5% UR + 7 dias (22±2ºC e 70±5% UR. Em função da aparência externa, a vida útil pós-colheita dos frutos armazenados sob atmosfera modificada, com ou sem tratamento inicial de 1-MCP foi de 21 dias, enquanto que dos frutos tratados inicialmente apenas com 1-MCP foi de 19 dias. A aplicação do 1-MCP proporcionou redução na atividade respiratória e na produção de etileno, e maior retenção da firmeza da polpa, menor perda de massa e melhor aparência externa quando associado a atmosfera modificada. A atmosfera modificada, isoladamente, foi eficiente em reduzir a perda de massa e manter melhor aparência externa.Aiming to evaluate the postharvest shelf life of Charentais melon (Cucumis melo L. stored under refrigeration, the fruits were treated with 1-MCP, associated or not with modified atmosphere (MAP. Two experiments were carried out at the laboratory of Embrapa Agroindústria Tropical in Fortaleza, Brazil, analyzing the chemical and physic quality characteristics. The fruits were obtained at the Agroindústria Nolem Comercial Importadora e Exportadora Ltda, located in Mossoró Açu, Brazil. The fruits were treated with 300 and 600 nL L-1 of 1-MCP, half of those were wrapped in plastic films, which were wrapped without the use of 1

  12. 40 CFR 180.34 - Tests on the amount of residue remaining.

    Science.gov (United States)

    2010-07-01

    ...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Procedural Regulations..., cauliflower, kohlrabi. (12) Cantaloups, honeydew melons, muskmelons, pumpkins, watermelons, winter squash. (13...

  13. Sodium and chloride exclusion and retention by non-grafted and grafted melon and Cucurbita plants

    Science.gov (United States)

    Edelstein, M.; Plaut, Z.; Ben-Hur, M.

    2011-01-01

    The effects of grafting on Na and Cl– uptake and distribution in plant tissues were quantified in a greenhouse experiment using six combinations of melon (Cucumis melo L. cv. Arava) and pumpkin (Cucurbita maxima Duchesne×Cucurbita moschata Duchesne cv. TZ-148): non-grafted, self-grafted, melons grafted on pumpkins, and pumpkins grafted on melons. Total Na concentration in shoots of plants with pumpkin or melon rootstocks was 400 mmol kg−1, respectively, regardless of the scion. In contrast, shoot Cl– concentrations were quite similar among the different scion–rootstock combinations. Na concentrations in exudates from cut stems of plants with a pumpkin rootstock were very low (<0.18 mM), whereas those in the exudates of plants with melon rootstocks ranged from 4.7 mM to 6.2 mM, and were quite similar to the Na concentration in the irrigation water. Root Na concentrations averaged 11.7 times those in the shoots of plants with pumpkin rootstocks, while in plants with melon rootstocks, values were similar. Two mechanisms could explain the decrease in shoot Na concentrations in plants with pumpkin rootstocks: (i) Na exclusion by the pumpkin roots; and (ii) Na retention and accumulation within the pumpkin rootstock. Quantitative analysis indicated that the pumpkin roots excluded ∼74% of available Na, while there was nearly no Na exclusion by melon roots. Na retention by the pumpkin rootstocks decreased its amount in the shoot by an average 46.9% compared with uniform Na distribution throughout the plant. In contrast, no retention of Na could be found in plants grafted on melons. PMID:20729482

  14. Sodium and chloride exclusion and retention by non-grafted and grafted melon and Cucurbita plants.

    Science.gov (United States)

    Edelstein, M; Plaut, Z; Ben-Hur, M

    2011-01-01

    The effects of grafting on Na and Cl(-) uptake and distribution in plant tissues were quantified in a greenhouse experiment using six combinations of melon (Cucumis melo L. cv. Arava) and pumpkin (Cucurbita maxima Duchesne×Cucurbita moschata Duchesne cv. TZ-148): non-grafted, self-grafted, melons grafted on pumpkins, and pumpkins grafted on melons. Total Na concentration in shoots of plants with pumpkin or melon rootstocks was 400 mmol kg(-1), respectively, regardless of the scion. In contrast, shoot Cl(-) concentrations were quite similar among the different scion-rootstock combinations. Na concentrations in exudates from cut stems of plants with a pumpkin rootstock were very low (<0.18 mM), whereas those in the exudates of plants with melon rootstocks ranged from 4.7 mM to 6.2 mM, and were quite similar to the Na concentration in the irrigation water. Root Na concentrations averaged 11.7 times those in the shoots of plants with pumpkin rootstocks, while in plants with melon rootstocks, values were similar. Two mechanisms could explain the decrease in shoot Na concentrations in plants with pumpkin rootstocks: (i) Na exclusion by the pumpkin roots; and (ii) Na retention and accumulation within the pumpkin rootstock. Quantitative analysis indicated that the pumpkin roots excluded ∼74% of available Na, while there was nearly no Na exclusion by melon roots. Na retention by the pumpkin rootstocks decreased its amount in the shoot by an average 46.9% compared with uniform Na distribution throughout the plant. In contrast, no retention of Na could be found in plants grafted on melons.

  15. Whole Genome Re-Sequencing and Characterization of Powdery Mildew Disease-Associated Allelic Variation in Melon.

    Directory of Open Access Journals (Sweden)

    Sathishkumar Natarajan

    Full Text Available Powdery mildew is one of the most common fungal diseases in the world. This disease frequently affects melon (Cucumis melo L. and other Cucurbitaceous family crops in both open field and greenhouse cultivation. One of the goals of genomics is to identify the polymorphic loci responsible for variation in phenotypic traits. In this study, powdery mildew disease assessment scores were calculated for four melon accessions, 'SCNU1154', 'Edisto47', 'MR-1', and 'PMR5'. To investigate the genetic variation of these accessions, whole genome re-sequencing using the Illumina HiSeq 2000 platform was performed. A total of 754,759,704 quality-filtered reads were generated, with an average of 82.64% coverage relative to the reference genome. Comparisons of the sequences for the melon accessions revealed around 7.4 million single nucleotide polymorphisms (SNPs, 1.9 million InDels, and 182,398 putative structural variations (SVs. Functional enrichment analysis of detected variations classified them into biological process, cellular component and molecular function categories. Further, a disease-associated QTL map was constructed for 390 SNPs and 45 InDels identified as related to defense-response genes. Among them 112 SNPs and 12 InDels were observed in powdery mildew responsive chromosomes. Accordingly, this whole genome re-sequencing study identified SNPs and InDels associated with defense genes that will serve as candidate polymorphisms in the search for sources of resistance against powdery mildew disease and could accelerate marker-assisted breeding in melon.

  16. Powdery Mildew Control and Yield Response of Inodorus Melon

    Directory of Open Access Journals (Sweden)

    Ippolito Camele

    Full Text Available The research was carried out on melon (Cucumis melo L. var. inodorus Naud. in 2006 and 2007 at “Pantanello” Experimental Farm (40° 24’N; 16° 48’E; 10 m a.s.l.; Metaponto, southern Italy to evaluate the efficacy of a low environmental impact control strategy against powdery mildew of cucurbits. Winter melon was treated with a new anti-oidium formulation, called Stifénia, obtained from fenugreek seeds and stimulating the plant self-defence. The adopted experimental design included two control strategies (1. biological, using Stifénia and 2. conventional, using penconazole, myclobutanil and sulphur and an untreated control (treated with water alone applied to two cultivars of inodorus melon (cv ‘Amarillo’ and HF1 ‘Cocorito’, the latter a genotype resistant to powdery mildew. Stifénia applications were not effective against the disease; in fact, there were no differences in percentage of attacked plant surface between treated plots and untreated ones. The melon marketable yield was significantly higher with the conventional strategy respect to Stifénia and control. Repeated applications of Stifénia resulted in a significant decrease of marketable yield even in comparison with the untreated control. The cultivars significantly affected powdery mildew development, since the resistant one (‘Cocorito’ was attacked later and damaged always lower than the non-resistant genotype (‘Amarillo’. Laboratory analyses carried out on infected leaves always confirmed that Golovinomyces cichoracearum D.C. was responsible of the disease.

  17. Comportamento do meloeiro em cultivo sem solo com a utilização de biofertilizante

    Directory of Open Access Journals (Sweden)

    Villela Junior Luiz Vitor E.

    2003-01-01

    Full Text Available O reaproveitamento de nutrientes após a fermentação de resíduos orgânicos em biodigestor, associado à técnica do cultivo hidropônico, é uma alternativa para reduzir custos na agricultura, além de contribuir no menor consumo das reservas naturais de nutrientes do planeta. Com esse enfoque, estudou-se o comportamento da cultura do meloeiro usando a técnica hidropônica e efluente de biodigestor proveniente da fermentação anaeróbica de estrume bovino. Cultivou-se o meloeiro (Cucumis melo L. 'Bônus 2' em condições de ambiente protegido. O delineamento estatístico utilizado foi de blocos casualizados, com 4 tratamentos (cultivo hidropônico em sistema fechado tipo NFT com uso de solução nutritiva organo-mineral; cultivo hidropônico em sistema fechado tipo NFT com uso de solução nutritiva 100% mineral; cultivo em sistema aberto, com substrato e solução nutritiva organo-mineral e cultivo em sistema aberto, com substrato e solução nutritiva 100% mineral e 6 repetições. Foram realizadas avaliações quanto a altura de plantas aos 50; 56; 63; 70 e 77 dias após a semeadura; tempo de colheita; peso de frutos e produtividade. As melhores respostas foram observadas no cultivo hidropônico em sistema fechado tipo NFT com uso de solução nutritiva 100% mineral. A substituição parcial de adubos minerais por biofertilizante, se mostrou viável para os tratamentos em sistema aberto (com substrato, constituindo-se em masi uma alternativa aos horticultores.

  18. Whole Genome Re-Sequencing and Characterization of Powdery Mildew Disease-Associated Allelic Variation in Melon.

    Science.gov (United States)

    Natarajan, Sathishkumar; Kim, Hoy-Taek; Thamilarasan, Senthil Kumar; Veerappan, Karpagam; Park, Jong-In; Nou, Ill-Sup

    2016-01-01

    Powdery mildew is one of the most common fungal diseases in the world. This disease frequently affects melon (Cucumis melo L.) and other Cucurbitaceous family crops in both open field and greenhouse cultivation. One of the goals of genomics is to identify the polymorphic loci responsible for variation in phenotypic traits. In this study, powdery mildew disease assessment scores were calculated for four melon accessions, 'SCNU1154', 'Edisto47', 'MR-1', and 'PMR5'. To investigate the genetic variation of these accessions, whole genome re-sequencing using the Illumina HiSeq 2000 platform was performed. A total of 754,759,704 quality-filtered reads were generated, with an average of 82.64% coverage relative to the reference genome. Comparisons of the sequences for the melon accessions revealed around 7.4 million single nucleotide polymorphisms (SNPs), 1.9 million InDels, and 182,398 putative structural variations (SVs). Functional enrichment analysis of detected variations classified them into biological process, cellular component and molecular function categories. Further, a disease-associated QTL map was constructed for 390 SNPs and 45 InDels identified as related to defense-response genes. Among them 112 SNPs and 12 InDels were observed in powdery mildew responsive chromosomes. Accordingly, this whole genome re-sequencing study identified SNPs and InDels associated with defense genes that will serve as candidate polymorphisms in the search for sources of resistance against powdery mildew disease and could accelerate marker-assisted breeding in melon.

  19. Investigation about selecting strong type of melons by using melon paleness factor fusarium oxysporum f.sp.melonis and mutation techniques

    International Nuclear Information System (INIS)

    Kantoglu, Y.; Secer, E.; Kunter, B.; Erzurum, K.; Maden, S.; Yanmaz, R.

    2009-01-01

    Fusarium wilt is a vascular disease of the Cucurbitaceae family, especially in muskmelon (Cucumis melo L.), caused by the soil fungus Fusarium oxysporum f. sp. melonis (FOM). This pathogen persists in the soil for extended periods of time, and the only effective control is the use of resistant varieties. Fusarium oxysporum f. sp. melonis is a very serious disease factor for farmers in Turkey. In this research, we show a method for mass-selection of melon mutants resistant to Fusarium wilt. In vitro selection of resistant cells, which are come from irradiated and non-irradiated explants, is done using culture filtrates of different FOM races. According to our results we determined effective irradiation doses and filtrate treatment dose by Linear Regression Analysis. According to our results 21.75 Gy is effective dose for in vitro Yuva cv. explants to induce mutation and for filtrate treatment 6.73% is the proper dose to select survive calluses and plantlets. We recommended using 10 and 20 Gy gamma ray doses for in vitro melon plantlets to induce mutation by our results. We succeed to regenerate 6% plantlets which were obtained and selected from irradiated plantlets and regenerated in in vitro medias which were include 6.73 % filtrate. Although 16.7% of resistant or tolerant plantlets can continue their viability in greenhouse conditions after disease inoculation treatment, we observed 4 plants had a surviving capability in a limited time. That is very important for breeding cycle and this research can lead to the development of new melon cultivars that will be resistant to Fusarium wilt.

  20. Cadmium accumulation by muskmelon under salt stress in contaminated organic soil

    Energy Technology Data Exchange (ETDEWEB)

    Gabrijel, Ondrasek [University of Zagreb, Faculty of Agriculture, Svetosimunska 25, 10000 Zagreb (Croatia)], E-mail: gondrasek@agr.hr; Davor, Romic [University of Zagreb, Faculty of Agriculture, Svetosimunska 25, 10000 Zagreb (Croatia); Zed, Rengel [Soil Science and Plant Nutrition, Faculty of Natural and Agricultural Sciences, University of Western Australia, Crawley WA 6009 (Australia); Marija, Romic; Monika, Zovko [University of Zagreb, Faculty of Agriculture, Svetosimunska 25, 10000 Zagreb (Croatia)

    2009-03-15

    Human-induced salinization and trace element contamination are widespread and increasing rapidly, but their interactions and environmental consequences are poorly understood. Phytoaccumulation, as the crucial entry pathway for biotoxic Cd into the human foodstuffs, correlates positively with rhizosphere salinity. Hypothesising that organic matter decreases the bioavailable Cd{sup 2+} pool and therefore restricts its phytoextraction, we assessed the effects of four salinity levels (0, 20, 40 and 60 mM NaCl) and three Cd levels (0.3, 5.5 and 10.4 mg kg{sup -1}) in peat soil on mineral accumulation/distribution as well as vegetative growth and fruit yield parameters of muskmelon (Cucumis melo L.) in a greenhouse. Salt stress reduced shoot biomass and fruit production, accompanied by increased Na and Cl and decreased K concentration in above-ground tissues. A 25- and 50-day exposure to salinity increased Cd accumulation in leaves up to 87% and 46%, respectively. Accumulation of Cd in the fruits was up to 43 times lower than in leaves and remained unaltered by salinity. Soil contamination by Cd enhanced its accumulation in muskmelon tissues by an order of magnitude compared with non-contaminated control. In the drainage solution, concentrations of Na and Cl slightly exceeded those in the irrigation solution, whereas Cd concentration in drainage solution was lower by 2-3 orders of magnitude than the total amount added. Chemical speciation and distribution modelling (NICA-Donnan) using Visual MINTEQ showed predominance of dissolved organic ligands in Cd chemisorption and complexation in all treatments; however, an increase in salt addition caused a decrease in organic Cd complexes from 99 to 71%, with free Cd{sup 2+} increasing up to 6% and Cd-chlorocomplexes up to 23%. This work highlights the importance of soil organic reactive surfaces in reducing trace element bioavailability and phytoaccumulation. Chloride salinity increased Cd accumulation in leaves but not in fruit

  1. Relaxin and atrial natriuretic peptide pathways participate in the anti-fibrotic effect of a melon concentrate in spontaneously hypertensive rats

    Directory of Open Access Journals (Sweden)

    Julie Carillon

    2016-04-01

    Full Text Available Background: In spontaneously hypertensive rats (SHR, a model of human essential hypertension, oxidative stress is involved in the development of cardiac hypertrophy and fibrosis associated with hypertension. Dietary supplementation with agents exhibiting antioxidant properties could have a beneficial effect in remodeling of the heart. We previously demonstrated a potent anti-hypertrophic effect of a specific melon (Cucumis melo L. concentrate with antioxidant properties in spontaneously hypertensive rats. Relaxin and atrial natriuretic peptide (ANP were reported to reduce collagen deposition and fibrosis progression in various experimental models. Objective: The aim of the present investigation was to test the hypothesis that, beside reduction in oxidative stress, the melon concentrate may act through relaxin, its receptor (relaxin/insulin-like family peptide receptor 1, RXFP1, and ANP in SHR. Design and results: The melon concentrate, given orally during 4 days, reduced cardiomyocyte size (by 25% and totally reversed cardiac collagen content (Sirius red staining in SHR but not in their normotensive controls. Treatment with the melon concentrate lowered cardiac nitrotyrosine-stained area (by 45% and increased by 17–19% the cardiac expression (Western blot of superoxide dismutase (SOD and glutathione peroxidase. In addition, plasma relaxin concentration was normalized while cardiac relaxin (Western blot was lowered in treated SHR. Cardiac relaxin receptor level determined by immunohistochemical analysis increased only in treated SHR. Similarly, the melon concentrate reversed the reduction of plasma ANP concentration and lowered its cardiac expression. Conclusions: The present results demonstrate that reversal of cardiac fibrosis by the melon concentrate involves antioxidant defenses, as well as relaxin and ANP pathways restoration. It is suggested that dietary SOD supplementation could be a useful additional strategy against cardiac hypertrophy

  2. Review of Scientific Evidence of Medicinal Convoy Plants in Traditional Persian Medicine

    Science.gov (United States)

    Sadati, Seyede Nargess; Ardekani, Mohammad Reza Shams; Ebadi, Nastaran; Yakhchali, Maryam; Dana, Azadeh Raees; Masoomi, Fatemeh; Khanavi, Mahnaz; Ramezany, Farid

    2016-01-01

    One concept used in traditional Persian medicine (TPM) for multidrug therapy is that of the convoy drug (Mobadregh). According to TPM texts, convoy drugs are substances (or drugs), which facilitate the access of drugs or foods to the whole body or to specific organs. This study reviewed some convoy drugs presented in TPM, their biological effects, and their probable interactions with main drugs, considering the increased absorption through inhibition of P-glycoprotein (P-gp) efflux function, bioavailability-enhancing effects, and decreased metabolism of the main drug using electronic databases including PubMed, Scopus, ScienceDirect, and Google Scholar in November and December, 2013. Recent studies have proven the beneficial effects of Crocus sativus L. (saffron) and camphor on the heart and brain, the cerebral therapeutic effects of Asarum europaeum (hazelwort), the hepatoprotective effects of Cichorium intybus (chicory), and Apium graveolens (celery) seeds, and the diuretic effects of Cinnamomum zeylanicum (cinnamon), and Cucumis melo (melon) seeds. The effects of vinegar in targeting the liver and brain have also been demonstrated. An evaluation of the results demonstrated that the suggested convoy drugs, including Piper nigrum (black pepper), Piper longum (long pepper), red wine, Camellia sinensis (tea), hazelwort, Mentha longifolia (pennyroyal), Anethum graveolens (dill), Foeniculum vulgare (fennel), cinnamon, and Sassafras albidum (sassafras) can increase the bioavailability of coadministered drugs by inhibition of P-gp or cytochrome P450s (CYP450s) or both of them. This evidence could be a good basis for the use of these agents as convoys in TPM. PMID:27041871

  3. Effect of mineral and organic fertilization on grey water footprint in a fertirrigated crop under semiarid conditions.

    Science.gov (United States)

    Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; María Tarquis Alfonso, Ana

    2016-04-01

    The concept of "water footprint" (WF) was introduced as an indicator for the total volume of direct and indirect freshwater used, consumed and/or polluted [1]. The WF distinguishes between blue water (volume of surface and groundwater consumed), green water (rain-water consumed), and grey water (volume of freshwater that is required to assimilate the load of pollutants based on existing ambient water quality standards). In semiarid scenarios with low water quality, where the irrigation is necessary to maintain production, green WF is zero because the effective rainfall is negligible. As well as blue WF includes: i) extra consumption or irrigation water that the farmer has to apply to compensate the fail of uniformity on discharge of drips, ii) percolation out of control or salts leaching, which depends on the salt tolerance of the crop, soil and quality of irrigation water, to ensure the fruit yield. The major concern is grey WF, because the irrigation and nitrogen dose have to be adjusted to the crop needs in order to minimize nitrate pollution. This study is focused in assessment mineral and organic fertilization on grey WF in a fertirrigated melon crop under semiarid conditions, which is principally cultivated in the centre of Spain declared vulnerable zone to nitrate pollution by applying the Directive 91/676/CEE. During successive years, a melon crop (Cucumis melo L.) was grown under field conditions. Different doses of ammonium nitrate were used as well as compost derived from the wine-distillery industry which is relevant in this area. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03. Keywords: Water footprint, nitrogen, fertirrigation, inorganic fertilizers, organic amendments, semiarid conditions. [1] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12

  4. Application of water footprint in a fertirrigated melon crop under semiarid conditions: A review.

    Science.gov (United States)

    Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; María Tarquis Alfonso, Ana

    2015-04-01

    In recent times, there has been a major increase in the use of water and fertilizers in order to increase agricultural production, while at the same time there has increased evidence that aquifers are reducing their water level, enriched by nutrient and degraded as a result of pollution. So best management practices are needed for much of cropped, irrigated and fertirrigated land, to avoid contamination of fresh water and groundwater. The concept of "water footprint" (WF) was introduced as an indicator for the total volume of direct and indirect freshwater used, consumed and/or polluted [1]. The WF distinguishes between blue water (volume of surface and groundwater consumed), green water (rain-water consumed), and grey water (volume of freshwater that is required to assimilate the load of pollutants based on existing ambient water quality standards). This study is focused in calculating the crops WF using a real case of study in a fertirrigated melon crop under semiarid conditions which is principally cultivated in the centre of Spain declared vulnerable zone to nitrate pollution by applying the Directive 91/676/CEE. During successive years, a melon crop (Cucumis melo L.) was grown under field conditions applying mineral and organic fertilizers. Different doses of ammonium nitrate were used as well as compost derived from the wine-distillery industry which is relevant in this area. This application help us to review the different concepts in which is based WF. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03-01. Keywords: Water footprint, nitrogen, fertirrigation, inorganic fertilizers, organic amendments, winery waste, semiarid conditions. [1] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12, UNESCO-IHE, Delft, The Netherlands.

  5. Gibberellins producing Bacillus methylotrophicus KE2 supports plant growth and enhances nutritional metabolites and food values of lettuce.

    Science.gov (United States)

    Radhakrishnan, Ramalingam; Lee, In-Jung

    2016-12-01

    The nutritional quality of green leafy vegetables can be enhanced by application of plant beneficial micro-organisms. The present study was aimed to increase the food values of lettuce leaves by bacterial treatment. We isolated bacterial strain KE2 from Kimchi food and identified as Bacillus methylotrophicus by phylogenetic analysis. The beneficial effect of B. methylotrophicus KE2 on plants was confirmed by increasing the percentage of seed germination of Lactuca sativa L., Cucumis melo L., Glycine max L. and Brassica juncea L. It might be the secretion of array of gibberellins (GA 1 , GA 3 , GA 7 , GA 8 , GA 9 , GA 12 , GA 19 , GA 20 , GA 24 , GA 34 and GA 53 ) and indole-acetic acid from B. methylotrophicus KE2. The mechanism of plant growth promotion via their secreted metabolites was confirmed by a significant increase of GA deficient mutant rice plant growth. Moreover, the bacterial association was favor to enhance shoot length, shoot fresh weight and leaf width of lettuce. The higher concentration of protein, amino acids (Asp, Thr, Ser, Glu, Gly, Ala, Leu, Tyr and His), gama-aminobutric acid and fructose was found in bacterial culture (KE2) applied plants. The macro and micro minerals such as K, Mg, Na, P, Fe, Zn and N were also detected as significantly higher quantities in bacteria treated plants than untreated control plants. In addition, the carotenoids and chlorophyll a were also increased in lettuce at bacterial inoculation. The results of this study suggest that B. methylotrophicus KE2 application to soil helps to increase the plant growth and food values of lettuce. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. Intercropping of Green Garlic (Allium sativum L.) Induces Nutrient Concentration Changes in the Soil and Plants in Continuously Cropped Cucumber (Cucumis sativus L.) in a Plastic Tunnel

    Science.gov (United States)

    Xiao, Xuemei; Cheng, Zhihui; Meng, Huanwen; Liu, Lihong; Li, Hezi; Dong, Yinxin

    2013-01-01

    A pot-based experiment was conducted to investigate nutrient concentrations in cucumber plants intercropped with various amounts of green garlic. In addition, the soil nutrient contents were studied over two consecutive growing seasons. The results revealed that the accumulation of biomass and the nutritional elements nitrogen (N), phosphorus (P), potassium (K), calcium (Ca) and manganese (Mn) in cucumber plants were significantly increased for intercropping treatments during the two growing seasons compared to monoculture. Conversely, magnesium (Mg) concentrations were decreased in the cucumber plants. Shoot iron (Fe) concentrations decreased whereas root Fe concentrations increased in the intercropping system. Shoot and root zinc (Zn) concentrations decreased during the fall of 2011 but increased during the spring of 2012. Soil organic matter and available N, P and K were significantly increased as the proportion of intercropped green garlic increasing. Medium levels of intercropping green garlic improved cucumber nutrient concentrations the most. The regression analysis showed that the concentrations of most elements were significantly related to the amounts of garlic bulbs, especially the microelements in the spring 2011. The available soil N and organic matter were linearly related to the amounts of garlic bulbs. The results indicate that the nutritional status of the soil and plants of continuously cropped cucumber could be improved by intercropping with green garlic. PMID:23637994

  7. Intercropping of green garlic (Allium sativum L.) induces nutrient concentration changes in the soil and plants in continuously cropped cucumber (Cucumis sativus L.) in a plastic tunnel.

    Science.gov (United States)

    Xiao, Xuemei; Cheng, Zhihui; Meng, Huanwen; Liu, Lihong; Li, Hezi; Dong, Yinxin

    2013-01-01

    A pot-based experiment was conducted to investigate nutrient concentrations in cucumber plants intercropped with various amounts of green garlic. In addition, the soil nutrient contents were studied over two consecutive growing seasons. The results revealed that the accumulation of biomass and the nutritional elements nitrogen (N), phosphorus (P), potassium (K), calcium (Ca) and manganese (Mn) in cucumber plants were significantly increased for intercropping treatments during the two growing seasons compared to monoculture. Conversely, magnesium (Mg) concentrations were decreased in the cucumber plants. Shoot iron (Fe) concentrations decreased whereas root Fe concentrations increased in the intercropping system. Shoot and root zinc (Zn) concentrations decreased during the fall of 2011 but increased during the spring of 2012. Soil organic matter and available N, P and K were significantly increased as the proportion of intercropped green garlic increasing. Medium levels of intercropping green garlic improved cucumber nutrient concentrations the most. The regression analysis showed that the concentrations of most elements were significantly related to the amounts of garlic bulbs, especially the microelements in the spring 2011. The available soil N and organic matter were linearly related to the amounts of garlic bulbs. The results indicate that the nutritional status of the soil and plants of continuously cropped cucumber could be improved by intercropping with green garlic.

  8. Dinámica de impregnación al vacío en apio (Apium graveolens L. y pepino (Cucumis sativus L.

    Directory of Open Access Journals (Sweden)

    Yisell Martelo C.

    2011-05-01

    Full Text Available Objetivo. Evaluar la respuesta a la impregnación al vacio (IV en apio y pepino, con soluciones isotónicas de NaCl. Materiales y métodos. Se determinaron variables de impregnación en troncos de apio y rodajas de pepino (3 posiciones diferentes a lo largo de su estructura, considerando, fracción y deformación volumétrica en la etapa de vacío (X1 y g1 y atmosférica (X y g, y la porosidad disponible (Ee al proceso IV. Resultados. El apio y pepino no presentaron diferencias estadísticas por efecto de la posición. En las etapas de proceso se obtuvieron para el apio y el pepino valores de X1 (-14.32 ± 2.75 y -5.51±1.76%, g1 (-0.587±0.69 y -0.079±0.99%, X(13.49±2.32 y 6.72±2.72%, g (-1.40±1.042% y -2.33±1.26% y Ee (15.73±2.31 y 9.35±2.57%, respectivamente. Estos resultados indicaron una salida de líquido nativo (X1<0 y una ligera contracción volumétrica de las estructuras (g y g1<0, lo cual se evidenció microestructuralmente. Conclusiones. La respuesta a la IV en apio y pepino, permite identificar estas matrices alimentarias, como aptas para la incorporación de componentes que le proporcionen un valor agregado a estos productos.

  9. Estandarización de un bioensayo con Cucumis sativus para la determinación de la fitotoxicidad de metales en suelos y aguas

    OpenAIRE

    Hipólito Fernández, Pablo

    2016-01-01

    Los bioensayos con plantas son una herramienta indispensable para la evaluación de la toxicidad de los suelos. Gran parte de la variabilidad que dificulta su generalización y la interpretación de resultados radica en la falta de un protocolo estandarizado y común que elimine las variables asociadas a las condiciones experimentales, al germoplasma vegetal y a los bioindicadores relevantes de toxicidad que existen entre los bioensayos tradicionales con plantas. En nuestro estudio proponemos un ...

  10. Identification of microRNAs associated with the exogenous spermidine-mediated improvement of high-temperature tolerance in cucumber seedlings (Cucumis sativus L.).

    Science.gov (United States)

    Wang, Ying; Guo, Shirong; Wang, Lei; Wang, Liwei; He, Xueying; Shu, Sheng; Sun, Jin; Lu, Na

    2018-04-24

    High-temperature stress inhibited the growth of cucumber seedlings. Foliar spraying of 1.0 mmol·L - 1 exogenous spermidine (Spd) to the sensitive cucumber cultivar 'Jinchun No. 2' grown at high-temperature (42 °C/32 °C) in an artificial climate box improved the high-temperature tolerance. Although there have been many reports on the response of microRNAs (miRNAs) to high-temperature stress, the mechanism by which exogenous Spd may mitigate the damage of high-temperature stress through miRNA-mediated regulation has not been studied. To elucidate the regulation of miRNAs in response to exogenous Spd-mediated improvement of high-temperature tolerance, four small RNA libraries were constructed from cucumber leaves and sequenced: untreated-control (CW), Spd-treated (CS), high-temperature stress (HW), and Spd-treated and high-temperature stress (HS). As a result, 107 known miRNAs and 79 novel miRNAs were identified. Eight common differentially expressed miRNAs (miR156d-3p, miR170-5p, miR2275-5p, miR394a, miR479b, miR5077, miR5222 and miR6475) were observed in CS/CW, HW/CW, HS/CW and HS/HW comparison pairs, which were the first set of miRNAs that responded to not only high-temperature stress but also exogenous Spd in cucumber seedlings. Five of the eight miRNAs were predicted to target 107 potential genes. Gene function and pathway analyses highlighted the integral role that these miRNAs and target genes probably play in the improvement of the high-temperature tolerance of cucumber seedlings through exogenous Spd application. Our study identified the first set of miRNAs associated with the exogenous Spd-mediated improvement of high-temperature tolerance in cucumber seedlings. The results could help to promote further studies on the complex molecular mechanisms underlying high-temperature tolerance in cucumber and provide a theoretical basis for the high-quality and efficient cultivation of cucumber with high-temperature resistance.

  11. Zn availability in nutrient solutions for cucumber (Cucumis sativus L) in hydroponics as affected by Fe-chelates and pH

    NARCIS (Netherlands)

    Voogt, W.; Sonneveld, C.

    2017-01-01

    In soil-less culture systems Fe is usually supplied as chelate to ensure an adequate availability of this element. As chelates have affinity for many metal ions these chelates will interact with other cation nutrients in nutrient solutions. This affects the availability of Fe and other nutrients.

  12. Analysis of pathogen-induced glutathione S-transferases in Arabidopsis thaliana and a gene related to systemic acquired resistance in cucumber (Cucumis sativus L.)

    OpenAIRE

    Lieberherr, Damien; Métraux, Jean-Pierre

    2005-01-01

    Dans leur environnement naturel, les plantes sont exposées en permanence à une grande variété de microorganismes dont certains sont pathogènes. Ainsi, les plantes ont développé au cours de l’évolution des mécanismes de défense multiples et complexes, qui leur permettent de résister à la plupart des microbes pathogènes. La résistance peut s’exprimer localement au site d’infection et systémiquement selon la nature des agents infectieux. Par exemple, suite à une infection par un agent pathogène ...

  13. Magnetite (Fe3O4 Nanoparticles Alleviate Growth Inhibition and Oxidative Stress Caused by Heavy Metals in Young Seedlings of Cucumber (Cucumis Sativus L

    Directory of Open Access Journals (Sweden)

    Konate Alexandre

    2017-01-01

    Full Text Available Accumulation of heavy metals in the ecosystem and their toxic effects through food chain can cause serious ecological and health problems. In the present study, experiments were performed to understand how the addition of magnetite (Fe3O4 nanoparticles reduces the toxicity caused by Cd, Pb, Cu, and Zn in cucumber plants. Plant growth parameters, lipid peroxidation, and antioxidant enzymes were measured in seedling samples treated with either metals or metals supplemented with Fe3O4 to demonstrate the reduction in metal-induced oxidative stress conferred by Fe3O4. Results showed that the toxic effect of metals on seedling growth parameters can be arranged in the rank order of inhibition as follows: Cu > Cd > Zn > Pb. Exposure to metals significantly decreased the seedlings growth, the activities of superoxide dismutase (SOD and peroxidases (POD, while the malondialdehyde (MDA content significantly increased in cucumber seedlings. The reducing activity of nano-Fe3O4 against heavy metals stresses was confirmed in this study by the decrease in MDA content. The correlation between the decrease of MDA concentration and the increase in SOD and POD activities in the presence of nano-Fe3O4 suggest that the MDA reduction in the tested seedlings can result from the increased enzyme activity.

  14. The relationship between powdery mildew (Sphaerotheca fuliginea) resistance and leaf chlorosis sensitivity in cucumber (Cucumis sativus) studied in single seed descent lines

    NARCIS (Netherlands)

    Zijlstra, S.; Jansen, R.C.; Groot, S.P.C.

    1995-01-01

    The genetic relation between powdery mildew resistance and sensitivity for leaf chlorosis of glasshouse cucumber was investigated. The powdery mildew resistant, leaf chlorosis sensitive hybrid variety 'Profito' was crossed with the powdery mildew susceptible, non chlorosis sensitive hybrid variety

  15. Depletion of soil mineral N by roots of ¤Cucumis sativus¤ L. colonized or not by arbuscular mycorrhizal fungi

    DEFF Research Database (Denmark)

    Johansen, A.

    1999-01-01

    on depletion of the soil mineral N pool. All pots were gradually supplied with 31 mg NH4NO3-N kg(-1) dry soil from 12-19 days after planting and an additional 50 mg (NH4)(2)SO4-N kg(-1) dry soil (N-15-labelled in Experiment 1) was supplied at 21 or 22 days after planting in Experiments 1 and 2, respectively....... Dry weight of plant parts, total root length, mycorrhizal colonization rate and soil concentration of NH4+ and NO3- were recorded at five sequential harvest events: 21, 24, 30, 35 and 42 days (Experiment 1) and 22, 25, 28, 31 and 35 days (Experiment 2) after planting. In Experiment 1, plants were also...... in Experiment 2. Mycorrhizal colonization affected the rate of depletion of soil mineral N in Experiment 1, where both NH4+ and NO3- concentrations were markedly lower in the first two harvests, when plants were mycorrhizal. As the root length was similar in mycorrhizal and control treatments, this may indicate...

  16. Intercropping of green garlic (Allium sativum L. induces nutrient concentration changes in the soil and plants in continuously cropped cucumber (Cucumis sativus L. in a plastic tunnel.

    Directory of Open Access Journals (Sweden)

    Xuemei Xiao

    Full Text Available A pot-based experiment was conducted to investigate nutrient concentrations in cucumber plants intercropped with various amounts of green garlic. In addition, the soil nutrient contents were studied over two consecutive growing seasons. The results revealed that the accumulation of biomass and the nutritional elements nitrogen (N, phosphorus (P, potassium (K, calcium (Ca and manganese (Mn in cucumber plants were significantly increased for intercropping treatments during the two growing seasons compared to monoculture. Conversely, magnesium (Mg concentrations were decreased in the cucumber plants. Shoot iron (Fe concentrations decreased whereas root Fe concentrations increased in the intercropping system. Shoot and root zinc (Zn concentrations decreased during the fall of 2011 but increased during the spring of 2012. Soil organic matter and available N, P and K were significantly increased as the proportion of intercropped green garlic increasing. Medium levels of intercropping green garlic improved cucumber nutrient concentrations the most. The regression analysis showed that the concentrations of most elements were significantly related to the amounts of garlic bulbs, especially the microelements in the spring 2011. The available soil N and organic matter were linearly related to the amounts of garlic bulbs. The results indicate that the nutritional status of the soil and plants of continuously cropped cucumber could be improved by intercropping with green garlic.

  17. Reaction of tomato [Lycopersicon esculentum], cucumber [Cucumis sativus] and eggplant [Solanum melongena] cultured under the film altered the ratio of red and far-red photon flux

    International Nuclear Information System (INIS)

    Hotta, Y.; Hayashi, G.

    1998-01-01

    The effects of covering films which altered the ratio of red (R 600-700nm) and far-red (FR 700-800nm) photon flux to control succulent growth of seedlings on character of tomato, cucumber and eggplant seedlings Were determined. Also the effects on growth and yield of eggplant cultured in plastic greenhouse covered with the same films were investigated. The results were as follows: 1) The stem length of tomato, cucumber and eggplant seedlings cultured under the high R/FR ratio (2.28) film which intercepted far-red photon flux in the greenhouse got shorter than for cheesecloth (1.00) which had sane level of photosynthetic photon flux transmittance, especially evident on eggplant. There was no difference in the number of leaves on these seedlings between tested film and the cheesecloth, but the top and root dry weight of these seedlings cultured under tested film got lighter than the one using cheesecloth. The leaves got smaller in eggplant too. 2) The stem of eggplant cultured under the high R/FR ratio (2.28) film got shorter and thicker than the control PVC film; but there was no difference on the yield. But eggplant cultured under the low R/FR ratio (0.66) film which intercepted red photon flux grew similarly as control, but its yield decreased

  18. Management of irrigation frequency and nitrogen fertilization to mitigate GHG and NO emissions from drip-fertigated crops

    Energy Technology Data Exchange (ETDEWEB)

    Abalos, Diego, E-mail: diego.abalos@upm.es [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain); Sanchez-Martin, Laura; Garcia-Torres, Lourdes [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain); Groenigen, Jan Willem van [Department of Soil Quality, Wageningen University, PO Box 47, 6700 AA Wageningen (Netherlands); Vallejo, Antonio [ETSI Agronomos, Technical University of Madrid, Ciudad Universitaria, 28040 Madrid (Spain)

    2014-08-15

    Drip irrigation combined with split application of fertilizer nitrogen (N) dissolved in the irrigation water (i.e. drip fertigation) is commonly considered best management practice for water and nutrient efficiency. As a consequence, its use is becoming widespread. Some of the main factors (water-filled pore space, NH{sub 4}{sup +} and NO{sub 3}{sup −}) regulating the emissions of greenhouse gases (i.e. N{sub 2}O, CO{sub 2} and CH{sub 4}) and NO from agroecosystems can easily be manipulated by drip fertigation without yield penalties. In this study, we tested management options to reduce these emissions in a field experiment with a melon (Cucumis melo L.) crop. Treatments included drip irrigation frequency (weekly/daily) and type of N fertilizer (urea/calcium nitrate) applied by fertigation. Crop yield, environmental parameters, soil mineral N concentrations and fluxes of N{sub 2}O, NO, CH{sub 4} and CO{sub 2} were measured during 85 days. Fertigation with urea instead of calcium nitrate increased N{sub 2}O and NO emissions by a factor of 2.4 and 2.9, respectively (P < 0.005). Daily irrigation reduced NO emissions by 42% (P < 0.005) but increased CO{sub 2} emissions by 21% (P < 0.05) compared with weekly irrigation. We found no relation between irrigation frequency and N{sub 2}O emissions. Based on yield-scaled Global Warming Potential as well as NO cumulative emissions, we conclude that weekly fertigation with a NO{sub 3}{sup −}-based fertilizer is the best option to combine agronomic productivity with environmental sustainability. Our study shows that adequate management of drip fertigation, while contributing to the attainment of water and food security, may provide an opportunity for climate change mitigation. - Highlights: • The effect of fertigation management techniques on GHG and NO emissions was studied. • Fertigation with urea instead of calcium nitrate increased N{sub 2}O by a factor of 2.4. • Daily irrigation reduced NO (42%) but increased CO

  19. Adubação fosfatada no meloeiro-amarelo: reflexos na produção e qualidade dos frutos

    Directory of Open Access Journals (Sweden)

    Francisco Luis Gonçalves de Abrêu

    2011-12-01

    Full Text Available O melão (Cucumis melo L. é uma das culturas de grande expressão econômica e social para a região Nordeste do Brasil. Apesar disso e dos baixos níveis de fósforo (P dos solos tropicais, existem poucas pesquisas sobre adubação com P nesta cultura, embora seja frequentemente mencionado que este nutriente tem papel preponderante na produção e qualidade dos frutos. Neste contexto, objetivou-se com este trabalho avaliar o efeito de doses de P (0; 120; 240; 360 e 480 kg ha-1 de P2O5, na produção e qualidade do melão-amarelo híbrido Goldex F1, nas condições ambientais de Teresina - Piauí. O experimento foi conduzido em um delineamento de blocos ao acaso, com quatro repetições, tendo 40 plantas por parcela. Os frutos foram colhidos aos 75 após o plantio. Foram avaliados os dados médios da produção total, produção de frutos comerciais, massa e número de frutos por planta, comprimento e diâmetro de frutos, espessura da polpa de frutos, sólidos solúveis, acidez titulável e o índice de maturação. A produção total e comercial, assim como a massa e o número de frutos e acidez titulável aumentaram com as doses de P aplicadas até a dose de 278 kg ha-1 de P2O5. Doses acima de 278 kg ha-1 de P2O5 prejudicaram a produtividade de frutos classificados como comerciais. O comprimento, o diâmetro de frutos e a espessura de polpa aumentaram até a dose de 355 kg ha-1 de P2O5, com aumentos pouco expressivos entre 278 e 355 kg ha-1 de P2O5. O teor de sólidos solúveis totais não foi afetado pela adubação fosfatada. Para as condições de fertilidade do solo deste trabalho, recomenda-se uma dose ao redor de 275 kg ha-1 de P2O5.

  20. Allelopathy by extracts of Caatinga species on melon seeds

    Directory of Open Access Journals (Sweden)

    Andreya Kalyana de Oliveira

    2016-04-01

    Full Text Available The melon crop is of great socioeconomic importance in Brazil and some species from the Caatinga biome show allelopathic effects on other species. The aim of this study was to assess leaf and seed extracts of cumaru (Amburana cearensis (Allemao A.C. Sm., the jujube tree (Zizyphus joazeiro Mart., Jucá (Caesalpinia ferrea Mart. Ex. Tul. Var. Ferrea and mulungu (Erythrina velutina Willd. on the emergence of melon seeds (Cucumis melo L.. Leaves and seeds were used to produce extracts for each species at concentrations of a 1%, b 0.5% c 0.25%, d 0.125% and e 0% (control. The experiment was conducted with each extract type and its respective concentrations in a completely randomized design, with four replicates, each of 20 seeds. The percentage emergence and rate index, percentage of abnormal seedlings, seedling dry matter and seedling shoot and root length were assessed. Seed extracts of A. cearensis prevented melon germination, whereas the other extracts had no effect on this variable. Leaf extracts of A. cearensis and leaf and seed extracts of Z. joazeiro, C. ferrea and E. velutina resulted in abnormal melon seedlings. The percentage of abnormal melon seedlings exceeded 30% when treated with C. ferrea seed extract at the highest concentration. Most extracts did not affect seedling dry matter, but E. velutina leaf and seed extract increased the dry matter accumulation of melon seedlings and Z. joazeiro seed extract decreased dry matter accumulation at a concentration of 0.25%. The highest concentrations of mulungu and jucá leaf extracts promoted the shoot growth of melon seedlings. The extract from E. velutina seeds negatively affected root length compared to the control, similar to the effect of C. ferrea and E. velutina leaf extracts at the highest concentrations. Extracts of different organs of Caatinga plants can affect the emergence and characteristics related to seedling growth, depending on the concentration. Most extracts did not affect

  1. Yield, nutrient utilization and soil properties in a melon crop amended with wine-distillery waste compost

    Science.gov (United States)

    Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; Jesús Cabello Cabello, María; Castellanos Serrano, María Teresa

    2014-05-01

    In Spain, large quantities of wine are produced every year (3,339,700 tonnes in 2011) (FAO, 2011) with the consequent waste generation. During the winemaking process, solid residues like grape stalks are generated, as well as grape marc and wine lees as by-products. According to the Council Regulation (EC) 1493/1999 on the common organization of the wine market, by-products coming from the winery industry must be sent to alcohol-distilleries to generate exhausted grape marc and vinasses. With an adequate composting treatment, these wastes can be applied to soils as a source of nutrients and organic matter. A three-year field experiment (2011, 2012 and 2013) was carried out in Ciudad Real (central Spain) to study the effects of wine-distillery waste compost application in a melon crop (Cucumis melo L.). Melon crop has been traditionally cultivated in this area with high inputs of water and fertilizers, but no antecedents of application of winery wastes are known. In a randomized complete block design, four treatments were compared: three compost doses consisted of 6.7 (D1), 13.3 (D2) and 20 t compost ha-1 (D3), and a control treatment without compost addition (D0). The soil was a shallow sandy-loam (Petrocalcic Palexeralfs) with a depth of 0.60 m and a discontinuous petrocalcic horizon between 0.60 and 0.70 m, slightly basic (pH 8.4), poor in organic matter (0.24%), rich in potassium (410 ppm) and with a medium level of phosphorus (22.1 ppm). During each growing period four harvests were carried out and total and marketable yield (fruits weighting cycle, four plants per treatment were sampled and the nutrient content (N, P and K) was determined. Soil samplings (0-30 cm depth) were carried before the application of compost and at the end of each growing season and available N and P, as well as exchangeable K content were analyzed. With this information, an integrated analysis was carried out with the aim to evaluate the suitability of this compost as organic

  2. Distinct colonization patterns and cDNA-AFLP transcriptome profiles in compatible and incompatible interactions between melon and different races of Fusarium oxysporum f. sp. melonis

    Science.gov (United States)

    2011-01-01

    Background Fusarium oxysporum f. sp. melonis Snyd. & Hans. (FOM) causes Fusarium wilt, the most important infectious disease of melon (Cucumis melo L.). The four known races of this pathogen can be distinguished only by infection on appropriate cultivars. No molecular tools are available that can discriminate among the races, and the molecular basis of compatibility and disease progression are poorly understood. Resistance to races 1 and 2 is controlled by a single dominant gene, whereas only partial polygenic resistance to race 1,2 has been described. We carried out a large-scale cDNA-AFLP analysis to identify host genes potentially related to resistance and susceptibility as well as fungal genes associated with the infection process. At the same time, a systematic reisolation procedure on infected stems allowed us to monitor fungal colonization in compatible and incompatible host-pathogen combinations. Results Melon plants (cv. Charentais Fom-2), which are susceptible to race 1,2 and resistant to race 1, were artificially infected with a race 1 strain of FOM or one of two race 1,2 w strains. Host colonization of stems was assessed at 1, 2, 4, 8, 14, 16, 18 and 21 days post inoculation (dpi), and the fungus was reisolated from infected plants. Markedly different colonization patterns were observed in compatible and incompatible host-pathogen combinations. Five time points from the symptomless early stage (2 dpi) to obvious wilting symptoms (21 dpi) were considered for cDNA-AFLP analysis. After successful sequencing of 627 transcript-derived fragments (TDFs) differentially expressed in infected plants, homology searching retrieved 305 melon transcripts, 195 FOM transcripts expressed in planta and 127 orphan TDFs. RNA samples from FOM colonies of the three strains grown in vitro were also included in the analysis to facilitate the detection of in planta-specific transcripts and to identify TDFs differentially expressed among races/strains. Conclusion Our data

  3. The Deterioration of Morocco’s Vegetable Crop Genetic Diversity: An Analysis of the Souss-Massa Region

    Directory of Open Access Journals (Sweden)

    Stuart Alan Walters

    2018-03-01

    Full Text Available Crop domestication and breeding efforts during the last half-century in developed countries has significantly reduced the genetic diversity in all major vegetable crops grown throughout the world. This includes developing countries such as Morocco, in which more than 90% of all farms are less than 10 ha in size, which are generally maintained by subsistence farmers who try to maximize crop and animal productivity on a limited land area. Near Agadir, in the remote Anti-Atlas mountain areas of the Souss-Massa region, many small landowner vegetable growers are known to still utilize crop populations (landraces. Thus, an assessment of the current status of vegetable landraces was made in this mountainous region of Southwestern Morocco during 2014. This assessment indicated that a significant loss of vegetable crop landraces has occurred in the last 30 years in this region of Morocco. Although many vegetable crops are still maintained as landrace populations by small subsistence farmers in remote areas in the Souss-Massa region, only 31% of these farmers cultivated landraces and saved seed in the villages assessed, with the average farmer age cultivating landraces being 52 years old. Moreover, the approximated loss of vegetable crop landraces over the last 30 years was an astounding 80 to 90%. Vegetable crops notably lost during this time period included carrot (Daucus carota, fava beans (Vicia faba, melon (Cucumis melo, pea (Pisum sativum, watermelon (Citrullus lanatus, and tomato (Solanum lycopersicon. The most significant loss was tomato as no landraces of this crop were found in this region. The vegetable crop landraces that are still widely grown included carrot, melon, onion (Allium cepa, turnip (Brassica rapa var. rapa, and watermelon, while limited amounts of eggplant (Solanum melongea, fava bean, pea, pepper (Capsicum annuum, and pumpkin (Cucurbita moshata and C. maxima were found. This recent genetic deterioration will have a profound

  4. influence of some types of Algerian soil on the development of rot-knot nematodes Meloidogyne incognita, M. javanica and M. arenaria (Tylenchida,Meloidogynidae)

    International Nuclear Information System (INIS)

    Hammach, M.

    2010-01-01

    Crops under greenhouses offer the possibility of vegetables production of high added value by focusing on earliness. They help to spread the availability timing of vegetables and fruits in the market throughout the year. However, these crops are subject to numerous attacks entailing heavy losses of yield quantity and quality. The plant parasitic nematodes especially rot-knot nematodes of the genus Meloidogyne are considered dangerous enemies of these cultures. The evolution study of these nematodes in different soil types allows one to compare the migration and movement of these nematodes in sandy soils considered as light soils, in clay soils heavy and intermediate silty clay soils. These soils have also rates of organic matter and a percentage of magnesium and calcium that might provide better conditions to the survival and migration of second stage larvae inoculated at a rate of 650 juveniles per pot of 24 cm in diameter where plants of melon Cucumis melo var. (Charentais) known to be susceptible to Meloidogyne was cultivated. The results for the population development of Meloidogyne, after a growing period of 3 months show an increase in the number of eggs, juvenile stages, inflated, swollen females and males in the 3 types of soil and that independently of clay fraction although clay soil may asphyxiate Meloidogyne. The development of the three species of Meloidogyne studied in these soils, the parameters taken into consideration (index of galls, which were 1.58, 1.75 and 1.5 for the sandy clay and the middle ground soils, vigour index and the evolution of populations of Meloidogyne and roots and soil as well as parameters related to production reveal the adaptation of these root-knot nematodes to the clay and sandy loam soils. At the end of culture, the final populations are important in the soils studied; 2680 for soil S. (sandy), 2272 for soil A (clay) and 2327 for soil I (intermediate) with a multiplication rate almost similar ( 4.12, 3.49 and 3

  5. Estudo da diversidade genética de Podosphaera xanthii através de marcadores AFLP e seqüências ITS

    Directory of Open Access Journals (Sweden)

    Erika Sayuri Naruzawa

    2011-06-01

    Full Text Available O meloeiro (Cucumis melo L. é uma frutífera largamente cultivada no Brasil, principalmente no nordeste brasileiro, onde é produzida principalmente para a exportação. Plantas da família do meloeiro, como pepino e abóbora, podem ser severamente afetadas pelo oídio, causado por Podosphaera xanthii.. Este fungo apresenta diversas raças fisiológicas cuja correta identificação é importante para o manejo da doença, já que o uso de variedades resistentes é o método mais eficaz de seu controle. No entanto, a identificação destas raças por meio da prática tradicional de inoculações em uma série diferenciadora de variedades de meloeiro é laboriosa e passível de erros. Devido a isso, um método alternativo seria o uso de marcadores moleculares para determinar de forma rápida a identidade das raças. O objetivo deste estudo foi o de analisar a variabilidade entre isolados de P. xanthii previamente classificados em raças através da técnica de AFLP e do seqüenciamento da região ITS 5.8S do rDNA. A partir dos marcadores AFLP obteve-se um dendrograma no qual não houve separação dos isolados quanto às suas raças, origem geográfica ou hospedeiro de origem. Com esta técnica verificou-se alta variabilidade entre isolados, com similaridade genética máxima de 69% e similaridade mínima de 23%. Ao contrário da informação gerada por AFLP, não foi observada variação na sequência da região ITS 5.8S entre isolados. Desta forma, a análise por AFLP indicou que os isolados tem composição genética heterogênea muito embora este fato não tenha sido evidenciado pelo sequenciamento da região ITS.

  6. Screening suitable reference genes for normalization in reverse transcription quantitative real-time PCR analysis in melon.

    Directory of Open Access Journals (Sweden)

    Qiusheng Kong

    Full Text Available Melon (Cucumis melo. L is not only an economically important cucurbitaceous crop but also an attractive model for studying many biological characteristics. Screening appropriate reference genes is essential to reverse transcription quantitative real-time PCR (RT-qPCR, which is key to many studies involving gene expression analysis. In this study, 14 candidate reference genes were selected, and the variations in their expression in roots and leaves of plants subjected to biotic stress, abiotic stress, and plant growth regulator treatment were assessed by RT-qPCR. The stability of the expression of the selected genes was determined and ranked using geNorm and NormFinder. geNorm identified the two most stable genes for each set of conditions: CmADP and CmUBIep across all samples, CmUBIep and CmRPL in roots, CmRAN and CmACT in leaves, CmADP and CmRPL under abiotic stress conditions, CmTUA and CmACT under biotic stress conditions, and CmRAN and CmACT under plant growth regulator treatments. NormFinder determined CmRPL to be the best reference gene in roots and under biotic stress conditions and CmADP under the other experimental conditions. CmUBC2 and CmPP2A were not found to be suitable under many experimental conditions. The catalase family genes CmCAT1, CmCAT2, and CmCAT3 were identified in melon genome and used as target genes to validate the reliability of identified reference genes. The catalase family genes showed the most upregulation 3 days after inoculation with Fusarium wilt in roots, after which they were downregulated. Their levels of expression were significantly overestimated when the unsuitable reference gene was used for normalization. These results not only provide guidelines for the selection of reference genes for gene expression analyses in melons but may also provide valuable information for studying the functions of catalase family genes in stress responses.

  7. Generation of a BAC-based physical map of the melon genome

    Directory of Open Access Journals (Sweden)

    Puigdomènech Pere

    2010-05-01

    Full Text Available Abstract Background Cucumis melo (melon belongs to the Cucurbitaceae family, whose economic importance among horticulture crops is second only to Solanaceae. Melon has high intra-specific genetic variation, morphologic diversity and a small genome size (450 Mb, which make this species suitable for a great variety of molecular and genetic studies that can lead to the development of tools for breeding varieties of the species. A number of genetic and genomic resources have already been developed, such as several genetic maps and BAC genomic libraries. These tools are essential for the construction of a physical map, a valuable resource for map-based cloning, comparative genomics and assembly of whole genome sequencing data. However, no physical map of any Cucurbitaceae has yet been developed. A project has recently been started to sequence the complete melon genome following a whole-genome shotgun strategy, which makes use of massive sequencing data. A BAC-based melon physical map will be a useful tool to help assemble and refine the draft genome data that is being produced. Results A melon physical map was constructed using a 5.7 × BAC library and a genetic map previously developed in our laboratories. High-information-content fingerprinting (HICF was carried out on 23,040 BAC clones, digesting with five restriction enzymes and SNaPshot labeling, followed by contig assembly with FPC software. The physical map has 1,355 contigs and 441 singletons, with an estimated physical length of 407 Mb (0.9 × coverage of the genome and the longest contig being 3.2 Mb. The anchoring of 845 BAC clones to 178 genetic markers (100 RFLPs, 76 SNPs and 2 SSRs also allowed the genetic positioning of 183 physical map contigs/singletons, representing 55 Mb (12% of the melon genome, to individual chromosomal loci. The melon FPC database is available for download at http://melonomics.upv.es/static/files/public/physical_map/. Conclusions Here we report the construction

  8. Analysis of expressed sequence tags generated from full-length enriched cDNA libraries of melon

    Directory of Open Access Journals (Sweden)

    Bendahmane Abdelhafid

    2011-05-01

    Full Text Available Abstract Background Melon (Cucumis melo, an economically important vegetable crop, belongs to the Cucurbitaceae family which includes several other important crops such as watermelon, cucumber, and pumpkin. It has served as a model system for sex determination and vascular biology studies. However, genomic resources currently available for melon are limited. Result We constructed eleven full-length enriched and four standard cDNA libraries from fruits, flowers, leaves, roots, cotyledons, and calluses of four different melon genotypes, and generated 71,577 and 22,179 ESTs from full-length enriched and standard cDNA libraries, respectively. These ESTs, together with ~35,000 ESTs available in public domains, were assembled into 24,444 unigenes, which were extensively annotated by comparing their sequences to different protein and functional domain databases, assigning them Gene Ontology (GO terms, and mapping them onto metabolic pathways. Comparative analysis of melon unigenes and other plant genomes revealed that 75% to 85% of melon unigenes had homologs in other dicot plants, while approximately 70% had homologs in monocot plants. The analysis also identified 6,972 gene families that were conserved across dicot and monocot plants, and 181, 1,192, and 220 gene families specific to fleshy fruit-bearing plants, the Cucurbitaceae family, and melon, respectively. Digital expression analysis identified a total of 175 tissue-specific genes, which provides a valuable gene sequence resource for future genomics and functional studies. Furthermore, we identified 4,068 simple sequence repeats (SSRs and 3,073 single nucleotide polymorphisms (SNPs in the melon EST collection. Finally, we obtained a total of 1,382 melon full-length transcripts through the analysis of full-length enriched cDNA clones that were sequenced from both ends. Analysis of these full-length transcripts indicated that sizes of melon 5' and 3' UTRs were similar to those of tomato, but

  9. Utilização de revestimento comestível à base de quitosana para aumentar a vida útil de melão minimamente processado

    Directory of Open Access Journals (Sweden)

    Raquel Costa Chevalier

    2016-10-01

    Full Text Available Revestimentos comestíveis podem contribuir para aumentar a vida útil de frutas minimamente processadas reduzindo a umidade e a migração do soluto, a troca gasosa, respiração e velocidades de reação de oxidação, bem como reduzir distúrbios fisiológicos. O objetivo deste estudo foi avaliar os efeitos da aplicação de quitosana associada com argila montmorillonita e óleo essencial de cravo, em relação às características físicas, químicas, microbiológicas e atributos sensoriais de melão (Cucumis melo L. minimamente processado quando armazenados a 4°C. Os melões foram lavados, descascados, retiradas as sementes, cortados em cubos, foi aplicado os revestimentos e em seguida os cubos foram armazenados em embalagem PET (politereftalato de etileno, por um período de 7 dias a 4±1°C. Realizaram-se análises de pH, sólidos solúveis totais, acidez titulável, análises microbiológicas (Escherichia coli, Salmonella, bolores e leveduras e análise sensorial (textura, cor, aroma, avaliação global. As análises foram realizadas em triplicata no dia do processamento (dia 0 e após 1, 3, 5 e 7 dias de armazenamento. Pode-se concluir que os revestimentos que continham quitosana juntamente com argila montmorillonita e quitosana juntamente com montmorillonita e óleo essencial de cravo (T3 e T4 foram mais eficientes na conservação das características físico-químicas de melão minimamente processado quando comparados com a amostra controle e o tratamento que continha somente quitosana. O uso de quitosana isoladamente e juntamente com montmorillonita e óleo essencial de cravo foram eficientes para manter as características sensoriais e microbiológicas por mais tempo.

  10. Effect of Temperature and Viscoelastic Creep on the Clamp-Up Load in Hybrid Composite/Metal Bolted Joints

    Science.gov (United States)

    2009-08-17

    Glaser. Also acknowledged is the assistance of Dr. Jose Daniel Diniz Melo, chair of the Department of Engineering Materials, Universidade Federal do Rio...supervision of Dr. Jose Daniel Diniz Melo. Figure 2.1 shows the 8mm cubic CTE specimens used in these experiments. They were machined to meet the

  11. 7 CFR 51.490 - Decay.

    Science.gov (United States)

    2010-01-01

    ... FRESH FRUITS, VEGETABLES AND OTHER PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Cantaloups 1 Definitions § 51.490 Decay. Decay means breakdown, disintegration or...

  12. Facts about Vitamin A

    Science.gov (United States)

    ... yolks. Table 2. Food sources of vitamin A Food Vitamin A (RAE*) Sweet potato, cooked, 1 medium 1,400 Spinach, frozen, boiled, ½ cup 580 Carrot, raw, ½ cup 460 Pumpkin, cooked, ½ cup 305 Cantaloupe, cubed, 1 cup ...

  13. 75 FR 42324 - Pyraclostrobin; Pesticide Tolerances

    Science.gov (United States)

    2010-07-21

    ... 10% Cantaloupe 15% Carrot 25% Celery 2.5% Cherry 30% Chinese mustard cabbage 10% Cowpea seed 5% Cowpea (succulent) 2.5% Cucumber 5% Currant 5% Dry bulb onion 15% Field corn 5% Filbert 10% Garlic 10...

  14. Diabetes-Friendly Recipes

    Science.gov (United States)

    ... fresh fruit cup of kiwifruit slices, cantaloupe cubes, strawberries, and red grapes for breakfast. Individual Three-Cheese ... breakfast on the run or a leisurely brunch. Strawberry Breakfast Mousse Crème No more skipping breakfast! This ...

  15. Vitamin A

    Science.gov (United States)

    ... carrots, and squash. Fruits, including cantaloupe, apricots, and mangos. Dairy products, which are among the major sources ... medicines might interfere with how your body absorbs, uses, or breaks down nutrients . Vitamin A and healthful ...

  16. 21 CFR 172.859 - Sucrose fatty acid esters.

    Science.gov (United States)

    2010-04-01

    ... as safe in food or regulated for such use by an appropriate section in this part. Ethyl acetate or... fresh apples, avocados, bananas, banana plantains, limes, melons (honeydew and cantaloupe), papaya...

  17. Vitamin Chart

    Science.gov (United States)

    ... or green vegetables (such as carrots, sweet potatoes, pumpkin, and kale), and orange fruits such as cantaloupe, ... eggs, legumes (like peas and lentils), nuts, dairy products, green leafy vegetables, broccoli, asparagus, and fortified cereals. ...

  18. Níveis de nitrogênio por fertirrigação e densidade de plantio na cultura do melão em um Vertissolo Nitrogen levels through fertirrigation and plant density on melon crop in a Vertisol

    Directory of Open Access Journals (Sweden)

    CLEMENTINO MARCOS BATISTA DE FARIA

    2000-03-01

    Full Text Available O trabalho constou de um experimento com melão (Cucumis melo L., conduzido em um Vertissolo, em Juazeiro, BA, em 1995, com o objetivo de avaliar o efeito de níveis de N por fertirrigação e de densidades de plantio na produtividade e qualidade de fruto. Os níveis de N foram 0, 80, 130 e 180 kg/ha, combinados com os espaçamentos 2,00 e 1,80 m entre linhas e 0,20 m entre plantas, com uma ou duas plantas por cova. A fonte de N foi a uréia, aplicada diariamente até 42 dias após a germinação, por meio da irrigação por gotejamento. Todos os tratamentos receberam uma adubação uniforme de 120 kg/ha de P2O5 e 120 kg/ha de K2O. Os espaçamentos entre linhas não causaram diferenças significativas em nenhuma variável estudada. O nível de 80 kg/ha de N combinado com uma planta por cova proporcionou uma produtividade de 34,07 t/ha, com 55,7% de frutos próprios para o mercado interno, não-significativamente (P £ 0,05 inferior à produtividade obtida com os níveis mais elevados de N em qualquer combinação. Com este mesmo nível, obtiveram-se frutos com 10,22º Brix significativamente (P£ 0,05 superior ao do tratamento sem N e não-significativamente inferior ao dos outros níveis. Para se obter uma maior parte de frutos próprios para o mercado externo, foi necessário elevar a densidade para duas plantas por cova e o nível de N para 130 ou 180 kg/ha. O peso médio dos frutos aumentou de 1,008 para 1,705 kg, à medida que foram aumentados os níveis de N ou se diminuiu a densidade de plantio de duas para uma planta por cova.This study consisted of one experiment with melon (Cucumis melo L., carried out in a Vertisol in Juazeiro, BA, Brazil, in 1995, with the objective of evaluating the effects of nitrogen levels through fertirrigation and plant density on fruit yield and quality. The N levels were 0, 80, 130 and 180 kg/ha, combined with row spacings of 2.0 and 1.8 m and 0.20 m between plants within the row, with one or two plants

  19. Intestinal digestibility of protein of adapted forages and by-products in Brazilian Northeast by three-steps technique Digestão intestinal da proteína de forrageiras e co-produtos da agroindústria produzidos no Nordeste Brasileiro por intermédio da técnica de três estágios

    Directory of Open Access Journals (Sweden)

    José Gilson Lousada Regadas Filho

    2010-06-01

    Full Text Available It was aimed to estimate the intestinal digestibility (ID of rumen-undegradable protein (RUDP of several feeds by a three-steps procedure. The evaluated forages were algaroba (Prosopis juliflora, canafístula (Pithecellobium multiflorum, flor-de-seda (Calotropis procera, jitirana (Ipomea sp., juazeiro (Ziziphus joazeiro, mata-pasto (Senna obtusifolia, sabiá (Mimosa caesalpiniaefolia Benth, palma gigante (Opuntia ficus indica and xique-xique (Cereus gounellei, and the agroindustry byproducts were pineapple (Ananas comosus L., barbados cherry (Malpighia emarginata, cashew (Anacardium occidentale, coconut (Cocos nucifera L., melon (Cucumis melo, passion fruit (Passiflora eduli, grape (Vitis labrusca and anatto seeds (Bixa orellana L.. The feeds were incubated in rumen during 16 hours to determine the RUDP, and the residue was submitted to the digestion with pepsin solution during one hour, and pancreatic solution during 24 hours at 38ºC, those residues were analyzed for total nitrogen. The estimative of RUDP forage ranged from 13.37 to 83.6%, and the RUDP by-product ranged from 39.14 to 89.06%. The intestinal digestion of RUDP of the forages ranged from 26.09 to 80.68%, while for by-products varied from 22.26 to 76.82%. The sabiá was the forage that presented the highest intestinal digestibility and digestive rumen-undegradable protein (RUDPd, and the flor-de-seda, the lowest digestibility; while for by-products, melon and cashew presented, respectively, the highest values for DI and RUDP. The coconut presented the lowest values for ID and RUDPd. Although, some formulation systems of diets for ruminant consider that the RUDP present constant ID, the data obtained in this work suggest variation among the different feeds.A pesquisa objetivou estimar a digestibilidade intestinal (DI da proteína não-degradada no rúmen (PNDR de alimentos por intermédio da técnica de três estágios. As forragens avaliadas foram algaroba (Prosopis juliflora

  20. Melão minimamente processado: um controle de qualidade Minimally processed melon: a quality control

    Directory of Open Access Journals (Sweden)

    Karla Suzanne Florentino da Silva Chaves Damasceno

    2005-12-01

    Full Text Available O processamento mínimo tem sido descrito como a manipulação, preparo, embalagem e distribuição de produtos agrícolas, através de procedimentos como a seleção, limpeza, lavagem, descascamento e corte, que não afetem as suas características organolépticas e agreguem valor aos mesmos, resultando em produtos naturais, práticos, cujo preparo e consumo requerem menos tempo, atendendo às exigências da vida moderna. A finalidade dos alimentos minimamente processados e refrigerados é proporcionar ao consumidor um produto similar ao fresco, garantindo segurança e mantendo a qualidade nutritiva e sensorial. O processo tem despertado interesse para a realização de pesquisas, principalmente, relacionando as alterações microbiológicas, físico-químicas e sensoriais que influenciam a vida de prateleira destes produtos. O objetivo do trabalho foi a avaliação do efeito da temperatura de comercialização (15ºC sobre a qualidade físico-química, microbiológica e sensorial do melão espanhol (Cucumis melo L. var. inodorus minimamente processado. Os frutos acondicionados em bandejas e envolvidos com filme plástico foram adquiridos aleatoriamente em um supermercado local. Os tratamentos foram: temperaturas (4 e 15ºC, períodos de armazenamento (5, 10, 15 e 1, 2 e 3 dias a 4ºC e 15ºC, respectivamente e o tratamento controle (melão minimamente processado no dia zero. As amostras foram analisadas quanto às características físico-químicas, microbiológicas e sensoriais. A qualidade do melão foi afetada, significativamente, durante o armazenamento refrigerado. Na temperatura de comercialização (15ºC o produto apresenta prazo de validade de apenas 24 horas. O armazenamento a 4°C permitiu uma conservação de até 5 dias, sendo necessária a discriminação da temperatura e do período de armazenamento adequado, no rótulo do produto.The minimum processing has been described as the manipulation, preparation, packaging and

  1. Uncommon disorders and decay in near-isogenic lines of melon and reference cultivars Acidentes fisiológicos e podridões atípicas em linhas quase-isogénicas de melão e em cultivares de referência

    Directory of Open Access Journals (Sweden)

    Juan Antonio Martínez

    2009-12-01

    Full Text Available Postharvest disorders and rots can produce important economic losses in fruits stored for long time for exportation. The genetic and physiological basis of some disorders in melon (Cucumis melo L. are unknown and particularly the possible relation with climacteric behavior. A collection of melon near-isogenic lines (NILs (SC3-5 and seven more showing climacteric and two non-climacteric ripening pattern were analyzed to study genetic and physiological aspects of fruit disorders and rots. Two non-climacteric (Nicolás; Inodorus Group; and Shongwan Charmi PI161375, Conomon Group and two climacteric cultivars (Fado, Reticulatus Group; Védrantais, Cantaloupensis Group were used as reference. The field was divided in eight blocks containing one three-plant replication for each NIL, two for the parental cultivar Piel de Sapo and one or two for the reference cultivars. Replications evaluated were more than six in the cultivars studied. Plant problems included aphids, powdery mildew, and leaf wind injury. Preharvest fruit disorders included whole fruit cracking in cultivar Védrantais and NIL 5M2, and stylar-end cracking in cultivar Fado. Climacteric NILs with yellow skin were particularly affected by over-ripening, stylar-end cracking, and sunburn during cultivation. At harvest, two NILs showed slight placental tissue necrosis which was inherited from SC and were also detected after storage. Other uncommon disorders seen at harvest or 30 days after storage at 8ºC included warted skin (scarring, flesh discoloration (light brown or translucent areas, hollow flesh disorder, and deep furrow netting inherited from SC. Less common rots included grey mould, bacterial soft rot, Penicillium rot, cottony leak and internal Cladosporium rot. Stylar-end hardness below 20 N·mm-1 was associated with cracking and softening. The incidence of the disorders and rots was too low to confirm that the genetic component played a role in their development

  2. Qualidade do fruto de melão rendilhado em função de doses de nitrogênio Muskmelon fruit quality as affected by nitrogen rates

    Directory of Open Access Journals (Sweden)

    Evando Luiz Coelho

    2003-01-01

    Full Text Available Foram realizados dois experimentos com meloeiro, (Cucumis melo L. Grupo Cantalupensis, no verão, em condições de campo e de ambiente protegido com o objetivo de avaliar o efeito de doses de nitrogênio sobre características físicas (massa, diâmetro, espessura da polpa e diâmetro da cavidade e químicas (teor de sólidos solúveis, acidez titulável e pH do fruto. Cada experimento constou de quatro blocos ao acaso, contendo cinco tratamentos que foram as doses de nitrogênio (0, 75, 150, 300 e 450 kg ha-1de N. Utilizou-se uréia, sendo 30% colocada nos sulcos, antes do transplante, e 70% remanescente aplicada via água de irrigação, por gotejamento, durante o ciclo da cultura. Nos dois ambientes, os valores das características físicas elevaram-se com o aumento da dose de N. Sob ambiente protegido, associados à dose de 312 kg.ha-1de N, que propiciou a produção comercial máxima de frutos (PCM, os valores de massa, diâmetro, espessura da polpa e cavidade do fruto foram: 1.280 g, 12,6 cm, 3,1 cm e 6,1 cm respectivamente. No campo, com dose de 344 kg.ha-1de N, que propiciou a PCM, os valores correspondentes foram de 1.390 g, 13,1 cm, 3,4 cm e 5,9 cm respectivamente. O teor de sólidos solúveis não foi influenciado por doses de N, alcançando 9% e 9,5%, respectivamente, nos frutos produzidos no ambiente protegido e no campo. Nos dois ambientes, a acidez titulável da polpa elevou-se com as doses de N, atingindo 0,13 e 0,14 % de ácido cítrico com as doses de N para a PCM. O pH do fruto produzido em ambiente protegido não foi influenciado pelo aumento da dose de N, atingindo 6,83, enquanto o pH daquele produzido no campo elevou-se com as doses de N, atingindo 6,99 com a dose de N para a PCM.Two experiments with melon plants (Cucumis melo L. Cantalupensis Group were carried out in the summer, in the field and in an unheated greenhouse, aiming to evaluate the effect of nitrogen rates on fruit physical (weight, diameter, flesh pulp

  3. Qualidade dos frutos de tipos de melão,produzidos em ambiente protegido Quality of melon fruit type produced under protected system

    Directory of Open Access Journals (Sweden)

    Micheline Tavares Paduan

    2007-01-01

    Full Text Available O interesse pela cultura do melão no Brasil tem aumentado muito nos últimos anos, pelas crescentes exportações e pelo incremento no consumo do mercado interno. O objetivo deste trabalho foi avaliar as características físicas e químicas, assim como a atividade da pectinametilesterase dos frutos de tipos de melão (Cucumis melo L., produzidos em ambiente protegido, no município de Centenário do Sul-PR. Os tipos estudados foram: Valenciano ('Amarelo-Ouro', Caipira ('Gaúcho Caipira', Net Melon ('Net Galia', Orange ('Orange Melon' e Pele-de-Sapo ('Filipo', com cinco repetições, utilizando seis frutos por repetição em delineamento inteiramente casualizado. Os frutos do Valenciano e Pele-de-Sapo destacaram-se quanto à massa, com valores 2,02 e 2,07 kg, respectivamente, e formatos alongados, enquanto os demais tipos apresentaram formatos arredondados e massa em torno de 1,4 kg. Os melões Pele-de-Sapo apresentaram espessura da polpa de 43,36 mm, estatisticamente superior à dos frutos Valenciano, com 38,98 mm. A menor espessura de polpa, 24,78 cm, e a maior espessura de casca, 9,74 mm, foram encontradas nos frutos do tipo Caipira que diferiu estatisticamente dos outros tipos. Os valores de pH não se apresentaram estatisticamente diferentes e variaram de 6,24 a 6,48. O Net Melon apresentou polpa com 12,3ºBrix e diferiu estatisticamente do Orange, Valenciano e Pele-de-Sapo, com 11;12; 10,34 e 9,94 ºBrix, respectivamente. O Caipira atingiu 5,06ºBrix, e também o menor conteúdo de acidez, 0,10 g de ac. cítrico.100-1 g de suco, o que inviabiliza sua comercialização. A atividade da pectinametilesterase na polpa dos frutos foi muito baixa, inferior a 0,005 PEu x 10(4 mL-1, nos cinco tipos avaliados. Na região norte do Paraná (Vale do Paranapanema, sob condições de cultivo protegido, os melões Pele-de-Sapo, Net Melon, Orange e Valenciano apresentaram boas características físicas e químicas dos frutos, destacando-se o Net Melon

  4. Hıyarda (Cucumis sativus L. yabancı ot çıkış zamanın tahminine yönelik araştırmalar

    Directory of Open Access Journals (Sweden)

    Nihat Tursun

    2015-01-01

    Full Text Available İstatistiki modellerin geliştirilmesi için hıyar bitkisinde on bir önemli yabancı otun çıkış zamanın belirlenmesinde modellemeler yapılmıştır. Hıyar deneme arazisinde bulunan önemli yabancı otlar çıkış zamanlarına göre gruplara ayrılmıştır. Bu yabancı otlardan; Amaranthus retroflexus, Chenopodium album, Heliotropium europaeum, Polygonum aviculare ve Solanum nigrum erken, Convolvulus arvensis, Cyperus rotundus, Cynodon dactylon, Portulaca oleracea ve Sorghum halepense bütün vejetasyon boyunca ve Tribulus terrestris ise geç çimlenen yabancı ot türü olarak belirlenmiştir. Farklı doğrusal olmayan büyüme eğrileri (Chapman-Richard, Weibull, logistic, Gompertz ve cubic spline farklı yabancı ot türleri ve yıllar için çıkış yüzdeleri verileri esas alınarak uyarlanmıştır. Cubic splin model birçok yabancı ot türü için en iyi model olarak saptanmıştır.

  5. Ectopic Expression of CsCTR1, a Cucumber CTR-Like Gene, Attenuates Constitutive Ethylene Signaling in an Arabidopsis ctr1-1 Mutant and Expression Pattern Analysis of CsCTR1 in Cucumber (Cucumis sativus

    Directory of Open Access Journals (Sweden)

    Beibei Bie

    2014-09-01

    Full Text Available The gaseous plant hormone ethylene regulates many aspects of plant growth, development and responses to the environment. Constitutive triple response 1 (CTR1 is a central regulator involved in the ethylene signal transduction pathway. To obtain a better understanding of this particular pathway in cucumber, the cDNA-encoding CTR1 (designated CsCTR1 was isolated from cucumber. A sequence alignment and phylogenetic analyses revealed that CsCTR1 has a high degree of homology with other plant CTR1 proteins. The ectopic expression of CsCTR1 in the Arabidopsis ctr1-1 mutant attenuates constitutive ethylene signaling of this mutant, suggesting that CsCTR1 indeed performs its function as negative regulator of the ethylene signaling pathway. CsCTR1 is constitutively expressed in all of the examined cucumber organs, including roots, stems, leaves, shoot apices, mature male and female flowers, as well as young fruits. CsCTR1 expression gradually declined during male flower development and increased during female flower development. Additionally, our results indicate that CsCTR1 can be induced in the roots, leaves and shoot apices by external ethylene. In conclusion, this study provides a basis for further studies on the role of CTR1 in the biological processes of cucumber and on the molecular mechanism of the cucumber ethylene signaling pathway.

  6. Carryover of perfluorooctanoic acid (PFOA) and perfluorooctane sulfonate (PFOS) from soil to plant and distribution to the different plant compartments studied in cultures of carrots (Daucus carota ssp. Sativus), potatoes (Solanum tuberosum), and cucumbers (Cucumis Sativus).

    Science.gov (United States)

    Lechner, Mareike; Knapp, Holger

    2011-10-26

    A vegetation study was carried out to investigate the carryover of Perfluorooctanoic Acid (PFOA) and Perfluorooctane Sulfonate (PFOS) from soil mixed with contaminated sewage sludge to potato, carrot, and cucumber plants. Analysis was done by liquid-extraction using acetonitrile with dispersive SPE cleanup and subsequent HPLC-MS/MS. In order to assess the transfer potential from soil, transfer factors (TF) were calculated for the different plant compartments: TF = [PFC](plant (wet substance))/[PFC](soil (dry weight)). The highest TF were found for the vegetative plant compartments with average values for PFOS below those for PFOA: cucumber, 0.17 (PFOS), 0.88 (PFOA); potato, 0.36 (PFOS), 0.40 (PFOA); carrot, 0.38 (PFOS), 0.53 (PFOA). Transfer of PFOA and PFOS into potato peelings (average values of TF: PFOA 0.03, PFOS 0.04) exceeded the carryover to the peeled tubers (PFOA 0.01, PFOS potatoes (TF < 0.01). For PFOA, it was higher (TF: 0.03).

  7. Contribution by two arbuscular mycorrhizal fungi to P uptake by cucumber (Cucumis sativus L.) from 32P-labelled organic matter during mineralization in soil

    DEFF Research Database (Denmark)

    Joner, E.J.; Jakobsen, I.

    1994-01-01

    compartment by either 37 mu m or 700 mu m nylon mesh giving only hyphae or both roots and hyphae, respectively, access to the labelled soil. The recovery of P-32 from the hyphal compartment was 5.5 and 8.6 % for plants colonized with Glomus sp. and G. caledonium, respectively, but only 0.6 % for the non...... of mycorrhizas, probably due to high root densities in the labelled soil. The experiment confirms that AM fungi differ in P uptake characteristics, and that mycorrhizal hyphae can intercept some P immobilization by other microorganisms and P-sorbing clay minerals....

  8. Albedo of a cucumber culture in polyethylene greenhouses in the North-South and East-West orientations; Albedo da cultura do pepino (Cucumis sativus) em estufas de polietileno, nas orientacoes norte-sul e leste-oeste

    Energy Technology Data Exchange (ETDEWEB)

    Assis, Simone V. de [Pelotas Univ., RS (Brazil). Dept. de Meteorologia; Escobedo, Joao F. [UNESP, Botucatu, SP (Brazil). Faculdade de Ciencias Agronomicas

    1998-12-31

    The calculation of albedo on a complete cycle of a cucumber culture was obtained in two polyethylene greenhouses with different orientations (north-south and east-west) and outside. The area of the greenhouse was 35 m{sup 2} and outside 80 cm longer than the surface. They were built in the Solar Radiometer Station, in Botucatu, SP. They are formed by central body, two glasses dome and two glasses dome and two sensors (thin film thermopiles). The sensors are positioned on the up and down part of the instrument. Th up sensor is used to measure global solar radiation and the down sensor is used to measure reflected solar radiation. The signs received from albedo meters were sent to a system of the data acquisition Datalogger 21 XL - CAMPBELL. (author) 5 refs., 5 figs., 2 tabs.

  9. Management of Meloidogyne incognita in nematodesusceptible ...

    African Journals Online (AJOL)

    Watermelon (Citrullus lanatus) cultivars are highly susceptible to the southern root-knot nematode (Meloidogyne incognita), with considerable yield losses when this nematode is not managed. Empirical evidence suggested that wild watermelon (Cucumis africanus) and wild cucumber (Cucumis myriocarpus) were highly ...

  10. IBICT: Brazilian experience in open access to service of Latin America

    Directory of Open Access Journals (Sweden)

    Editores Biblios

    2012-09-01

    Full Text Available Interview with Bianca Amaro de Melo, Coordinator of the Laboratory of Methodologies for Treatment and Dissemination of Information of the Brazilian Institute of Information in Science and Technology - IBICT.

  11. IBICT: Brazilian experience in open access to service of Latin America

    OpenAIRE

    Editores Biblios

    2012-01-01

    Interview with Bianca Amaro de Melo, Coordinator of the Laboratory of Methodologies for Treatment and Dissemination of Information of the Brazilian Institute of Information in Science and Technology - IBICT.

  12. H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from right) with R. Salmeron, C. Melo, A. Dos Anjos and H. Pessoa Lima Junior

  13. Influences of growth and consumption variables on nutritional ...

    African Journals Online (AJOL)

    Julio

    Relationship between tissue retention efficiency and production traits ... Sauveur (1997) pointed out that, in France, the main factors required to ..... VII World Congr. on Genetics Applied to Livestock Prod., Montpellier, France. p. 87. Melo, J.E. ...

  14. Environmental impact analysis of aquaculture in net cages in a ...

    African Journals Online (AJOL)

    Environmental impact analysis of aquaculture in net cages in a Brazilian water reservoir, based in zooplankton communities. Maria Cristina Crispim, Karla Patrícia Ponte Araújo, Hênio do Nascimento Melo Júnior ...

  15. Melo Larco, Grace EsperanzaAnálisis de las neo-expresiones utilizadas en redes sociales como Facebook y Twitter por adolescentes de 12 a 17 años en El Colegio Sebastián de Benalcázar.

    OpenAIRE

    Melo Larco, Grace Esperanza; Vargas Silva, Aglaya Vanessa

    2014-01-01

    This work analyses a new type of communication between young people that appears with massive penetration of internet. This new language is called “neo-expressions” and is used in social network like Facebook or Twitter. Neo-expressions are so popular due to the fact that young people keep connected anywhere and anytime with their smartphones, portable computers, or other devices. In addition, new ways of communication emerged with telecommunications an internet era for example short messages...

  16. Experimental evaluation of admission and disposition of artificial radionuclides including transuranium elements in agricultural plants

    Energy Technology Data Exchange (ETDEWEB)

    Kozhakhanov, T.; Lukashenko, S. [Institute of radiation safety and ecology (Kazakhstan)

    2014-07-01

    Processes of radionuclides migration and transfer to agricultural plants are quite well developed worldwide, but the information on character of accumulation of {sup 241}Am and {sup 239+240}Pu transuranium radionuclides in agricultural plants is still fragmentary. Even in generalized materials of worldwide studies, IAEA guide, accumulation coefficient (AC) can have wide range of values (5-6 orders), no data exists on radionuclides' distribution in different organs of plants and they are given for joined groups of plants and types of soils. That is why the main aim of this work was to obtain basic quantitative parameters of radionuclides' migration in 'soil-plant' system, and firs of all- for transuranium elements.. In 2010 a series of experiments with agricultural plants was started at the territory of the former Semipalatinsk Test Site aimed to investigate entry of artificial radionuclides by crop products in natural climatic conditions. To conduct the experiment for study of coefficient of radionuclides' accumulation by agricultural corps, there was chosen a land spot at the STS territory, characterized by high concentration of radionuclides: {sup 241}Am - n*10{sup 4} Bq/kg, {sup 137}Cs - n*10{sup 3} Bq/kg, {sup 90}Sr - n*10{sup 3} Bq/kg and {sup 239+240}Pu- n*10{sup 5} Bq/kg. As objects of investigation, cultures, cultivated in Kazakhstan have been selected: wheat (Triticum vulgare), barley (Hordeum vulgare), oat (Avena sativa L.), water melon (Citrullus vulgaris), melon (Cucumis melo), potato (Solanum tuberosum), eggplant (Solanum melongena), pepper (Capsicum annuum), tomato (Solanum lycopersicum), sunflower (Helianthus cultus), onion (Allium cepa), carrot (Daucus carota), parsley(Petroselinum vulgare)and cabbage (Brassica oleracea). Investigated plants have been planted within the time limits, recommended for selected types of agricultural plants. Cropping system included simple agronomic and amelioration measures. Fertilizers were not

  17. Nutrient uptake by greenhouse net melonAcúmulo de nutrientes e rendimento de óleo em plantas de girassol influenciados pelo vigor dos aquênios e pela densidade de semeadura

    Directory of Open Access Journals (Sweden)

    Silvana da Silva Cardoso

    2010-02-01

    Full Text Available For presenting more commercial value, the net melon (Cucumis melo L. var reticulatus Naud. has been an option of greenhouse planting for the horticulturists. This work was carried out in Piracicaba, Brazil with the aim of evaluating the nutrient uptake from this melon cultivated in greenhouse. To obtain the nutrients accumulation in the different stages of the plant development, plants were collected in the transplant day (seedling, in the vegetative stage, in the beginning of the flowering stage, in the beginning and in the middle of fruit production period and in the harvest period. It was verified that the greatest increase of nutrient uptake happened between the beginning of the flowering and the beginning of the fruit production. The greatest dry matter accumulation happened between the beginning of the fruit production and the middle of fruit production period. The decrescent order of nutrients accumulated in the above ground part of the plant was: potassium > nitrogen > calcium > magnesium > sulphur > phosphorus > iron > manganese > zinc > copper ~ boron. O objetivo do trabalho foi avaliar o acúmulo de nutrientes e o rendimento de óleo dos aquênios em plantas de girassol produzidas sob a influência do vigor dos aquênios e da densidade de semeadura. Para isto, foi instalado um experimento no campo experimental no município de Seropédica/RJ, em outubro de 2006, com três distintos lotes de aquênios de girassol cv Embrapa 122 V2000, classificados como de baixo, de médio e de alto vigor, sob duas densidades de semeadura (45.000 e 75.000 sementes ha-1. Aos 20, 60 e 100 dias após a semeadura (DAS, foram coletadas as plantas para avaliação da massa de matéria seca e do acúmulo de nitrogênio, de fósforo, de potássio e de cálcio, no caule, nas folhas e nos capítulos. Nas plantas coletadas aos 100 DAS, foi feita também a avaliação do rendimento de aquênios (kg ha-1, do teor de óleo e do rendimento de óleo (kg ha-1. Observou

  18. Evolução da salinidade e pH de solo sob cultivo de melão irrigado com água salina Evolution of salinity and pH of soil cultivated with melon irrigated with brackish water

    Directory of Open Access Journals (Sweden)

    Francisco de Q. Porto Filho

    2011-11-01

    Full Text Available Com o presente trabalho objetivou-se estudar os efeitos da irrigação com águas salinas em um solo cultivado com melão a evolução da salinidade e reação do solo. O experimento foi conduzido na Fazenda Santa Júlia, município de Mossoró, RN, em dois plantios consecutivos, no período de 2001 a 2002. As plantas de melão (Cucumis melo L. cv. AF646 foram irrigadas com água de salinidade 0,6 (testemunha; 1,9; 3,2 e 4,5 dS m-1 durante todo o ciclo (70 dias e de forma incremental, em três fases de desenvolvimento do meloeiro (1-30, 31-50, 51-70 dias após a semeadura - DAS. O delineamento experimental adotado foi em blocos ao acaso, com 15 tratamentos e quatro repetições. A salinidade e o pH do solo foram medidos no início e aos 30, 50 e 70 DAS, em amostras de solo coletadas nas camadas de 0-15, 15-30 e 30-45 cm. Observou-se maior acúmulo de sais no solo na camada superficial (até 15 cm em todos os níveis de salinidade e que a utilização de águas de maior salinidade aumentou a salinidade média no perfil do solo. Os valores médios de pH estiveram dentro da faixa ótima de absorção de nutrientes requerida para a cultura do melão, com pequena variação entre os tratamentos estudados.This work aimed to study the effects of irrigation with saline waters in an area cultivated with melon on soil salinity and pH. The experiment was conducted in the Santa Julia Farm, Mossoró city, Rio Grande do Norte State, Brazil, during the years 2001 to 2002. Water with different salinity levels (0.6; 1.9; 3.2 and 4.5 dS m-1 was used throughout the cycle and in incremental way in three periods of melon development, forming 15 treatments, arranged in randomized blocks with four replications. The salinity was measured at 0, 30, 50 and 70 days after sowing in soil samples collected in layers of 0-15, 15-30 and 30-45 cm. There was greater accumulation of salts in the surface layer (up to 15 cm in all salinity levels and the use of more saline water

  19. Water Footprint in Nitrate Vulnerable Zones: Mineral vs. Organic Fertilization.

    Science.gov (United States)

    Castellanos Serrano, María Teresa; Requejo Mariscal, María Isabel; Villena Gordo, Raquel; Cartagena Causapé, María Carmen; Arce Martínez, Augusto; Ribas Elcorobarrutia, Francisco; María Tarquis Alfonso, Ana

    2017-04-01

    (Cucumis melo L.) was grown under field conditions. Different doses of ammonium nitrate were used as well as waste compost derived from the wine-distillery industry, which is relevant in this area. Grey WF was estimated in both type of fertilizers using Castellanos et al. [3] methodology. The results showed that in the case of inorganic fertilization gray WF experiment a huge increase when the optimum dose were exceeded. Meanwhile, in the case of organic fertilization, even the doses exceeded the optimum, the increase gray WF was significantly lower. The discussion of these results will be presented based on the mineralization rate and N content of irrigation water. Acknowledgements: This project has been supported by INIA-RTA04-111-C3 and INIA-RTA2010-00110-C03. [1] ITAP, 2011. Protocolo para el seguimiento y control de los programas de actuación en las zonas vulnerables a la contaminación por nitratos de Castilla-La Mancha. Available in: www.itap.es. [2] Hoekstra, A.Y. 2003. Virtual water trade. Proceedings of the International Expert Meeting on Virtual Water Trade, Delft, The Netherlands, 12-13 December 2002. Value of Water Research Report Series No. 12, UNESCO-IHE, Delft, The Netherlands. [3] Castellanos, M.T., Cartagena, M.C., Requejo, M.I. Arce, A., Cabello, M.J., Ribas, F., Tarquis, A.M. 2016. Agronomic concepts in water footprint assessment: A case of study in a fertirrigated melon crop under semiarid conditions. Agricultural Water Management 170: 81-90.

  20. Field experiments of Anopheles gambiae attraction to local fruits/seedpods and flowering plants in Mali to optimize strategies for malaria vector control in Africa using attractive toxic sugar bait methods

    Directory of Open Access Journals (Sweden)

    Bah Sekou

    2010-09-01

    to An. gambiae s.l. females and males, respectively. Guava (Psidium guajava and honey melon (Cucumis melo were the two most attractive fruits for both females and males. Of the 26 flowering plants tested, 9 were significantly attractive for females, and 8 were attractive for males. Acacia macrostachya was the most attractive flowering plant. Periodicity studies using this plant showed peaks of An. gambiae s.l. attraction between 1930 and 2200 h and 0400-0500 h, which differed considerably from the response to human odors, which expectedly peaked at around midnight. Conclusion These field experiments in Mali highlight that female and male An. gambiae s.l. have pronounced differences in attraction for diverse types of indigenous fruits/seedpods and flowering plants. The identification of attractive fruits and seedpods shows that a variety of indigenous and locally abundant natural products could potentially be used as juices to make ATSB solution for mosquito control. As well, the simple methods used to identify the most attractive flowering plants provide valuable insights into the natural history of sugar feeding for An. gambiae s.l. These observations can be used to guide future strategies for employing ATSB methods for malaria vector control in Africa. They also provide a basis for subsequent chemical analysis and development of attractive baits for mosquito control.

  1. Field experiments of Anopheles gambiae attraction to local fruits/seedpods and flowering plants in Mali to optimize strategies for malaria vector control in Africa using attractive toxic sugar bait methods.

    Science.gov (United States)

    Müller, Günter C; Beier, John C; Traore, Sekou F; Toure, Mahamoudou B; Traore, Mohamed M; Bah, Sekou; Doumbia, Seydou; Schlein, Yosef

    2010-09-20

    . Guava (Psidium guajava) and honey melon (Cucumis melo) were the two most attractive fruits for both females and males. Of the 26 flowering plants tested, 9 were significantly attractive for females, and 8 were attractive for males. Acacia macrostachya was the most attractive flowering plant. Periodicity studies using this plant showed peaks of An. gambiae s.l. attraction between 1930 and 2200 h and 0400-0500 h, which differed considerably from the response to human odors, which expectedly peaked at around midnight. These field experiments in Mali highlight that female and male An. gambiae s.l. have pronounced differences in attraction for diverse types of indigenous fruits/seedpods and flowering plants. The identification of attractive fruits and seedpods shows that a variety of indigenous and locally abundant natural products could potentially be used as juices to make ATSB solution for mosquito control. As well, the simple methods used to identify the most attractive flowering plants provide valuable insights into the natural history of sugar feeding for An. gambiae s.l. These observations can be used to guide future strategies for employing ATSB methods for malaria vector control in Africa. They also provide a basis for subsequent chemical analysis and development of attractive baits for mosquito control.

  2. Temperatura de armazenamento e tipo de corte para melão minimamente processado Storage temperature and cut type to minimally processed melon

    Directory of Open Access Journals (Sweden)

    Maria Cecília de Arruda

    2003-04-01

    Full Text Available O presente trabalho teve como objetivo determinar a temperatura de armazenamento e o tipo de corte que proporciona melhor manutenção da qualidade de melões minimamente processados. Melões rendilhados, híbrido Bonus II, foram processados em câmara fria a 12ºC. Os frutos foram cortados manualmente em 8 fatias longitudinais. Em um dos tratamentos, as fatias foram divididas em pedaços de aproximadamente 3 cm de base e, no outro tratamento, foram utilizadas fatias inteiras. O produto minimamente processado foi acondicionado em embalagem rígida de politereftalato de etileno e armazenado a 3; 6 e 9ºC. O delineamento experimental foi inteiramente casualizado em esquema fatorial. Foram realizadas análises físico-químicas e sensoriais a cada 3 dias, por um período de 9 dias. A coloração e o teor de sólidos solúveis totais não foram afetados pelos tratamentos. O produto armazenado a 3ºC manteve maiores valores de firmeza, independentemente do tipo de corte. A aparência foi considerada boa até o 9º dia de armazenamento e o aroma, até o 6º dia, para melões a 3ºC. Em todos os tratamentos, houve declínio das notas atribuídas ao sabor durante o armazenamento. Pelos resultados obtidos, conclui-se que a qualidade de melões minimamente processados pode ser mantida por 6 dias a 3ºC, independentemente do tipo de corte.The objective of this work was to determine the storage temperature and the cut type that provides the better maintenance of the quality of minimally processed melons (Cucumis melo L. var. reticulatus hybrid. Bonus II. Fruits were hand cut in 8 longitudinal slices in cold chamber at 12ºC. One of the slices was divided in 3cm pieces, in the other treatment whole slices were used. The product minimally processed was packed in rigid polyethylene terephthalate tray and stored at 3, 6 and 9ºC. The experimental design was completely randomized in factorial arrangement. The physical-chemical and sensorial characteristics were

  3. On the photosynthetic and devlopmental responses of leaves to the spectral composition of light

    NARCIS (Netherlands)

    Hogewoning, S.W.

    2010-01-01

    Key words: action spectrum, artificial solar spectrum, blue light, Cucumis sativus, gas-exchange, light-emitting diodes (LEDs), light interception, light quality, non-photosynthetic pigments, photo-synthetic capacity, photomorphogenesis, photosystem excitation balance, quantum yield, red light.

  4. PRELIMINARY NUTRITIONAL EVALUATION OF FIVE SPECIES OF ...

    African Journals Online (AJOL)

    pumpkin or squash gourd), Cucurbita moschata (musk melon), Lagenaria siceraria (bottle gourd or calabash) and Cucumis sativus (“Ibo” egusi). The moisture content was determined by drying in an oven to constant weight, crude protein content by ...

  5. Genetic relationship of a cucumber germplasm collection revealed ...

    Indian Academy of Sciences (India)

    SSR is a new marker system which is commonly developed ... A web tool, SSRIT (http://www.gramene.org/db/markers/ssrtool), was used for searching SSRs in the unigenes with the crite- ..... genomic library of cucumber (Cucumis sativus).

  6. 77 FR 59186 - Notice of Receipt of Pesticide Products; Registration Applications To Register New Uses

    Science.gov (United States)

    2012-09-26

    ... to me? You may be potentially affected by this action if you are an agricultural producer, food... code 111). Animal production (NAICS code 112). Food manufacturing (NAICS code 311). Pesticide... cantaloupe, cucumber, pea (succulent), pumpkin, squash (Summer and Winter), watermelon, and vegetable soybean...

  7. 7 CFR 51.478 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... or mold. (2) En route or at destination. 12 percent for cantaloups in any lot which fail to meet the...

  8. 7 CFR 51.477 - U.S. Commercial.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... destination. 24 percent for cantaloups in any lot which fail to meet the requirements of this grade: Provided...

  9. Imidacloprid in Melon Guttation Fluid: A Mode of Exposure for Pest and Beneficial Organisms

    Science.gov (United States)

    ELISA techniques were used to detect imidacloprid in guttation fluid of young cantaloupe plants in Arizona. Imidacloprid was detected at up to 37 µg / ml (ppm) one d after a label rate soil application. These imidacloprid titers exceed reported median oral toxicities for several insect species by ...

  10. FARM LABOR COSTS AND FOOD PRICES, 1964-65.

    Science.gov (United States)

    1966

    TO MEASURE THE IMPACT OF THE DECLINE OF FOREIGN AGRICULTURAL WORKER EMPLOYMENT ON FARM-LABOR COSTS, FOOD PRICES, AND RETURN TO THE FARMER, AN ANALYSIS WAS MADE OF THE 1964-65 CHANGES IN THESE FACTORS FOR SELECTED CALIFORNIA CROPS. TOMATOES, LETTUCE, STRAWBERRIES, CANTALOUPES, CELERY, LEMONS, AND ASPARAGUS, WHICH ACCOUNTED FOR 71 PERCENT OF THE…

  11. 7 CFR 51.475 - U.S. Fancy.

    Science.gov (United States)

    2010-01-01

    ... meet the requirements of U.S. No. 1 grade except that the cantaloups have very good internal quality... shall not apply to the requirements relating to internal quality and uniformity of appearance: (1) At... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

  12. 76 FR 18906 - Mancozeb; Pesticide Tolerances

    Science.gov (United States)

    2011-04-06

    ..., 32%; cantaloupe, 12.5%; carrot, 2.5%; casaba, 12.5%; cauliflower, 15%; celery, 12%; chickpea, 2.5...%; cauliflower, 5%; celery, 12%; chickpea, 1%; Chinese waxgourd, 5%; chive, 10%; collards, 10%; corn, field, 1...%; cauliflower, 10%; chickpea, 1%; collards, 31%; corn, field, 1%; corn, sweet, 6%; cottonseed, oil, 11...

  13. Botany and culture

    Science.gov (United States)

    The cucurbits (family Cucurbitaceae) form a diverse group of species grown around the world under many different conditions and for many different purposes. The major cultivated types include cucumber, melon (cantaloupe or muskmelon, honeydew, etc.), watermelon, squash, and pumpkin. Minor cultivated...

  14. Electrical, luminescent, and deep trap properties of Si doped n-GaN grown by pendeo epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Polyakov, A. Y. [National University of Science and Technology MISiS, Leninskiy pr. 4, Moscow 119049 (Russian Federation); Smirnov, N. B. [National University of Science and Technology MISiS, Leninskiy pr. 4, Moscow 119049 (Russian Federation); Institute of Rare Metals, B. Tolmachevsky, 5, Moscow 119017 (Russian Federation); Yakimov, E. B. [National University of Science and Technology MISiS, Leninskiy pr. 4, Moscow 119049 (Russian Federation); Institute of Microelectronics Technology and High Purity Materials, Russian Academy of Science, 6, Academician Ossipyan str., Chernogolovka, Moscow Region 142432 (Russian Federation); Lee, In-Hwan, E-mail: ihlee@jbnu.ac.kr [School of Advanced Materials Engineering and Research Center of Advanced Materials Development, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Pearton, S. J. [University of Florida, Gainesville, Florida 32611 (United States)

    2016-01-07

    Electrical and luminescent properties and deep trap spectra of Si doped GaN films grown by maskless epitaxial lateral overgrowth (MELO) are reported. The dislocation density in the wing region of the structure was 10{sup 6 }cm{sup −2}, while in the seed region it was 10{sup 8 }cm{sup −2}. The major electron traps present had activation energy of 0.56 eV and concentrations in the high 10{sup 15 }cm{sup −3} range. A comparison of diffusion length values and 0.56 eV trap concentration in MELO GaN and epitaxial lateral overgrowth (ELOG) GaN showed a good correlation, suggesting these traps could be effective in carrier recombination. The doped MELO films were more uniform in their electrical properties than either ELOG films or undoped MELO films. We also discuss the differences in deep trap spectra and luminescence spectra of low-dislocation-density MELO, ELOG, and bulk n-GaN samples grown by hydride vapor phase epitaxy. It is suggested that the observed differences could be caused by the differences in oxygen and carbon contamination levels.

  15. H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Photo 01: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni Photo 02: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (centre) with C. Melo (left) and P. Jenni. Photo 03: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from right) with R. Salmeron, C. Melo, A. Dos Anjos and H. Pessoa Lima Junior. Photo 05: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (second from left) with, from left to right C. Melo, R. Salmeron, P. Jenni. Photo 06: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science, Technology and Innovation, Brazil (left) with C. Melo. Behind, J. Ellis and J.A. Rubiol. Photo 07: At the ATLAS assembly hall H.E. Mr Ronaldo Mota Sardenberg, Minister for Science,...

  16. Development and validation of a mathematical model for growth of pathogens in cut melons.

    Science.gov (United States)

    Li, Di; Friedrich, Loretta M; Danyluk, Michelle D; Harris, Linda J; Schaffner, Donald W

    2013-06-01

    Many outbreaks of foodborne illness associated with the consumption of fresh-cut melons have been reported. The objective of our research was to develop a mathematical model that predicts the growth rate of Salmonella on fresh-cut cantaloupe over a range of storage temperatures and to validate that model by using Salmonella and Escherichia coli O157:H7 on cantaloupe, honeydew, and watermelon, using both new data and data from the published studies. The growth of Salmonella on honeydew and watermelon and E. coli O157:H7 on cantaloupe, honeydew, and watermelon was monitored at temperatures of 4 to 25°C. The Ratkowsky (or square-root model) was used to describe Salmonella growth on cantaloupe as a function of storage temperature. Our results show that the levels of Salmonella on fresh-cut cantaloupe with an initial load of 3 log CFU/g can reach over 7 log CFU/g at 25°C within 24 h. No growth was observed at 4°C. A linear correlation was observed between the square root of Salmonella growth rate and temperature, such that √growth rate = 0.026 × (T - 5.613), R(2) = 0.9779. The model was generally suitable for predicting the growth of both Salmonella and E. coli O157:H7 on cantaloupe, honeydew, and watermelon, for both new data and data from the published literature. When compared with existing models for growth of Salmonella, the new model predicts a theoretic minimum growth temperature similar to the ComBase Predictive Models and Pathogen Modeling Program models but lower than other food-specific models. The ComBase Prediction Models results are very similar to the model developed in this study. Our research confirms that Salmonella can grow quickly and reach high concentrations when cut cantaloupe is stored at ambient temperatures, without visual signs of spoilage. Our model provides a fast and cost-effective method to estimate the effects of storage temperature on fresh-cut melon safety and could also be used in subsequent quantitative microbial risk

  17. Caracterização química, qualidade microbiológica e aspectos nutricionais de picles elaborados com pepino (Cucumis sativus L. e com nabo (Brassica campestris L. var. rapa orgânicos produzidos por agricultores familiares.

    Directory of Open Access Journals (Sweden)

    Juliana Domingues dos Santos Carvalho

    2014-06-01

    Full Text Available O objetivo deste trabalho foi determinar as características fisicoquímicas e a qualidade microbiológica de picles de pepino e de nabo como alternativa para geração de renda para a Agricultura Familiar. As olerícolas submetidas ao sistema de cultivo orgânico foram produzidas por agricultores familiares de Seropédica, Rio de Janeiro, Brasil. Foram analisados os teores de umidade, proteínas, lipídeos, cinzas, fibras, de carboidratos totais, além do pH, a acidez total e o teor de sódio das amostras de picles estudadas. Também foi avaliada a qualidade microbiológica de acordo com a Legislação vigente para esta categoria de produto. Os picles estudados não puderam ser denominados “picles orgânicos”, uma vez que a quantidade de vinagre convencional ficou acima do limite máximo estipulado pela Legislação, que permite o uso de matéria-prima de origem não orgânica em quantidade não superior a 5%. De forma geral, os picles estudados apresentaram elevada umidade (acima de 90 %, e pequena quantidade de nutrientes calóricos (carboidratos totais, proteínas e lipídeos, resultando em um produto com baixo teor calórico. Quanto ao teor de sódio, verificou-se que a conserva de pepino e de nabo apresentaram teor de sódio semelhante. O picles de pepino e de nabo estavam dentro dos padrões microbiológicos de qualidade exigidos pela Agência Nacional de Vigilância Sanitária (ANVISA, sugerindo que as normas de Boas Práticas de Fabricação (BPF foram seguidas pelos agricultores de forma satisfatória. Quanto aos aspectos nutricionais, apesar das amostras de picles terem apresentado baixo valor calórico, o consumo de uma porção diária da conserva de picles de pepino e de nabo foi suficiente para fornecer 30% e 65 % de sódio, respectivamente do valor diário (%VD recomendado, sugerindo a necessidade de ajuste na formulação dos produtos estudados. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

  18. Efecto de tres abonos orgánicos: lombricomposta, bocashi y tierra de corral en un cultivo intercalado de jitomate (Solanum lycopersicon) y pepino (Cucumis sativus) bajo invernadero en el ejido El Limón, Tepalcingo, Morelos, México

    OpenAIRE

    Hernández Tapia, Alejandro; Ramírez-Rivero,Libia Aidé; Corlay-Chee, Langen; Cruz Rodríguez, Juan Antonio

    2015-01-01

    Se evaluó una intercalación de jitomate y pepino bajo condiciones de invernadero, con un diseño de bloques completos al azar, con nueve tratamientos de abono en cuatro repeticiones (Bocashi, lombricomposta y tierra de corral con tres niveles de dosificación 0.5, 1.0 y 1.5 kg/m2).Se evaluó rendimiento y,en el caso del jitomate número de frutos dañados. Se empleó un análisis de varianza (ANOVA) y pruebas de comparación de medias (Tukey α=.05). En el caso del pepino, con el tratamiento lombri...

  19. Neutron activation and statistical analysis of pottery from Thera, Greece

    International Nuclear Information System (INIS)

    Kilikoglou, V.; Grimanis, A.P.; Karayannis, M.I.

    1990-01-01

    Neutron activation analysis, in combination with multivariate analysis of the generated data, was used for the chemical characterization of prehistoric pottery from the Greek islands of Thera, Melos (islands with similar geology) and Crete. The statistical procedure which proved that Theran pottery could be distinguished from Melian is described. This discrimination, attained for the first time, was mainly based on the concentrations of the trace elements Sm, Yb, Lu and Cr. Also, Cretan imports to both Thera and Melos were clearly separable from local products. (author) 22 refs.; 1 fig.; 4 tabs

  20. Group recommendation strategies based on collaborative filtering

    OpenAIRE

    Ricardo de Melo Queiroz, Sérgio

    2003-01-01

    Ricardo de Melo Queiroz, Sérgio; de Assis Tenório Carvalho, Francisco. Group recommendation strategies based on collaborative filtering. 2003. Dissertação (Mestrado). Programa de Pós-Graduação em Ciência da Computação, Universidade Federal de Pernambuco, Recife, 2003.

  1. Mining inventory of Uruguay: Uranium report of synthesis annexes GQE

    International Nuclear Information System (INIS)

    1984-01-01

    This report is about place, analysis and radiometric results in Amarillo, Acegua, Alborada,Arbolito,Caraguata,Centurion,Cerro de las Cuentas, Cuchilla de Ombu, Fraile Muerto, Las Flores, Lechiguana, Melo, Moirones, La Paloma de Durazno,Paso Mazangano, Paso del Minuano, Paso Pereira, Paso del Puerto, Paso San Diego, Polanco, Porrua, Sierra de los Rios, Tacuari, Vichadero, MoironesZanja Honda

  2. Sulphur oxidising bacteria in mangrove ecosystem: A review

    African Journals Online (AJOL)

    SAM

    2014-07-16

    Jul 16, 2014 ... factors such as salinity and nutrient availability highly variable. Mangrove .... sulphate and converts it into organic sulphur compound. (Subba Rao ..... of organic fertilizer long favored in Australia. .... Fish. Technol. Soc. 21:126-130. Dias ACF, Andreote FD, Rigonato J, Fiore MF, Melo IS, Araujo WL. (2010).

  3. Antioxidant properties of differently processed spinach products

    NARCIS (Netherlands)

    Castenmiller, J.J.M.; Linssen, J.P.H.; Heinonen, I.M.; Hopia, A.I.; Schwarz, K.; Hollman, P.C.H.; West, C.E.

    2002-01-01

    The effect of variously processed spinach products (whole-leaf, minced and enzymatically liquefied spinach) on lipid oxidation was determined. In an autoxidative methyl linoleate (MeLo) system the inhibition of hydroperoxide formation, measured by HPLC after three days of oxidation, was in

  4. Translations on Narcotics and Dangerous Drugs No. 305

    Science.gov (United States)

    1977-06-17

    prosecutor; Augusto Caro Rojas, court reporter; Rodolfo Carvajal Florez, municipal employee; Orlando Carrascal Claro, inspector; Jesus Antonio Carrillo...Arturo Melo Diaz, judge; Rafael Mendez Buendia, judge; Tirso Mendez Herrera, professor; Rubiela Maria Mendez Mendez , judge; Luis Orlando Mendez ...Misael Roa Fonseca, jail guard; Jose Ignacio Roa Mendez , policeman; Jose Anibal Robles Alvarado, judge; Jorge Rocha Mahecha, govern- ment inspector

  5. The impact of wood biochar as a soil amendment in aerobic rice systems of the Brazilian Savannah

    NARCIS (Netherlands)

    Carvalho, M.T.M.

    2015-01-01

    Abstract

    Keywords: tropical Savannah, biochar, soil fertility, aerobic rice, grain yield, N2O emission

    Márcia Thaís de Melo Carvalho (2015). The impact of wood biochar as a soil amendment in aerobic rice systems of the Brazilian Savannah. PhD thesis,

  6. Anti-inflammatory and analgesic activities of leaf extracts of ...

    African Journals Online (AJOL)

    The aqueous, methanol and chloroform extracts of Landolphia owariensis ... rats and the nociception induced by Tail immersion in hot water (50.0 ± 1.00C) and ... (acetic acid) MELO produced the highest and comparable analgesic activity to ...

  7. V Campos

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. V Campos. Articles written in Bulletin of Materials Science. Volume 37 Issue 1 February 2014 pp 157-166 Electronic Supplementary Material. Characterization of neutrophil adhesion to different titanium surfaces · V Campos R C N Melo L P Silva E N Aquino M S Castro W ...

  8. A new species of Tropidopedia from the Amazon rainforest, Brazil (Hymenoptera: Apidae), with a revised phylogenetic overview of the genus.

    Science.gov (United States)

    Mahlmann, Thiago; De Oliveira, Marcio L

    2015-10-15

    We describe a new species of the bee tribe Tapinotaspidini, Tropidopedia guaranae Mahlmann & Oliveira sp. n. from the Amazon rainforest, Amazonas, Brazil. We emend the phylogenetic tree of Aguiar & Melo (2007) to include the new species and comment upon some characters presented by those authors.

  9. Quality changes and nutrient retention in fresh-cut versus whole fruits during storage.

    Science.gov (United States)

    Gil, María I; Aguayo, Encarna; Kader, Adel A

    2006-06-14

    The influences of processing and storage on the quality indices and nutritional content of fresh-cut fruits were evaluated in comparison to whole fruits stored for the same duration but prepared on the day of sampling. Fresh-cut pineapples, mangoes, cantaloupes, watermelons, strawberries, and kiwifruits and whole fruits were stored for up to 9 days in air at 5 degrees C. The postcutting life based on visual appearance was shorter than 6 days for fresh-cut kiwifruit and shorter than 9 days for fresh-cut pineapple, cantaloupe, and strawberry. On the other hand, fresh-cut watermelon and mango pieces were still marketable after 9 days at 5 degrees C. Losses in vitamin C after 6 days at 5 degrees C were spoil before any significant nutrient loss occurs.

  10. 40 CFR 180.300 - Ethephon; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 1.0 Hog, meat 0.02 Hog, meat byproducts, except kidney 0.2 Horse, fat 0.02 Horse, kidney 1.0 Horse, meat 0.02 Horse, meat byproducts, except kidney 0.2 Milk 0.01 Nut, macadamia 0.5 Pepper 30.0 Pineapple... Blackberry 30.0 Blueberry 20.0 Cantaloupe 2.0 Cattle, fat 0.02 Cattle, kidney 1.0 Cattle, meat 0.02 Cattle...

  11. Root-Knot Nematode Management in Double-Cropped Plasticulture Vegetables

    OpenAIRE

    Desaeger, J. A.; Csinos, A. S.

    2006-01-01

    Combination treatments of chisel-injected fumigants (methyl bromide, 1,3-D, metam sodium, and chloropicrin) on a first crop, followed by drip-applied fumigants (metam sodium and 1,3-D ± chloropicrin) on a second crop, with and without oxamyl drip applications were evaluated for control of Meloidogyne incognita in three different tests (2002 to 2004) in Tifton, GA. First crops were eggplant or tomato, and second crops were cantaloupe, squash, or jalapeno pepper. Double-cropped vegetables suffe...

  12. Researches about selecting resistant melon types to fusarium oxyporum f. sp.melonis race 1,2 by using tissue culture and mutation techniques

    International Nuclear Information System (INIS)

    2009-01-01

    Fusarium wilt is a vascular disease of the Cucurbitaceae family caused by the soil fungus Fusarium oxysporum f. sp. melonis (FOM), which is very detrimental to muskmelons (Cucumis melo L.). Fusarium wilt of melon is prevalent in temperate and tropical regions and causes a worldwide problem. FOM can survive in the soil for extended periods of time as chlamydospores, and is capable of colonizing crop residues and roots of most crops grown in rotation with melon. The only effective control is the use of resistant varieties. Four races of FOM have been identified, namely 0, 1, 2 and 1.2. Race 1.2 was further subdivided into race 1.2y and 1.2w, which cause yellowing and wilt symptoms, respectively. Two resistance genes (Fom-1 and Fom-2) have been identified in melons. Fom-1 confers resistance to FOM races 0 and 2, and Fom-2 confers resistance to races 0 and 1. These two genes are extensively used in breeding programmes, which can be assisted by marker assisted selection using markers linked to these resistance genes. No genes have been identified that confer resistance to race 1.2. However, polygenic recessive genes have been found to confer resistance to race 1.2 in Piboule genotypes. Melon production in Turkey is 1,700,000 tons and it is declining the year after year because of Fusarium wilt. Therefore, Fusarium wilt has a high economic importance in the cultivation of muskmelon in Turkey. In some parts of Turkey the prevalent races of this pathogen were determined. FOM has caused severe losses for farmers as our native cultivars are not resistant to this disease. It is believed our native cultivars will disappear if resistance to FOM is not introduced into the cultivated material. For this reason, many scientists in Turkey are focusing on research to develop new resistant cultivars via conventional and biotechnological breeding methods. In vitro techniques became widely spread during the 20th century, and their potential to make important contributions to plant

  13. Avaliação de fontes de cálcio na cultura do melão tipo 'Gália' sob cultivo protegido Comparative analysis of calcium sources in greenhouse 'Galia' muskmelon

    Directory of Open Access Journals (Sweden)

    Eva Cintra D. de Faria

    2004-09-01

    Full Text Available Um experimento com a cultura de Melão (Cucumis melo L. var. reticulatus, do tipo Gália, híbrido Galileo foi conduzido sob cultivo protegido, em vasos, na Embrapa Hortaliças, em Brasília-DF, de setembro a dezembro de 2001. Foram avaliadas 5 formas de aplicação de cálcio (calagem, calagem mais fertirrigação com nitrato de cálcio, cálcio tamponado, cálcio quelatizado e cloreto de cálcio além do tratamento controle, sem cálcio. O delineamento experimental foi de blocos ao acaso com seis tratamentos e seis repetições e parcelas com seis plantas. Não houve diferença estatística entre os tratamentos. No entanto, uma análise de contrastes mostrou um aumento de 26% em peso (kg m-2 e 21% em número de frutos comerciais resultante da aplicação de cálcio, indicando a importância da aplicação do nutriente em pré-plantio e/ou fertirrigação para solos com saturação de bases (V% abaixo de 70%. Constatou-se aumento de 30% na produtividade e de 27% no número de frutos comerciais com o uso da fertirrigação. Houve aumento de 23% no número de frutos comerciais nos tratamentos com cálcio e com calagem (3,52 frutos m-2, em relação ao tratamento onde utilizou-se apenas calagem (2,87 frutos m-2. Não houve efeito dos tratamentos sobre os pesos médios dos frutos. Os tratamentos fertirrigados com nitrato de cálcio e cloreto de cálcio apresentaram maior eficiência econômica. Não houve efeito significativo dos tratamentos sobre a espessura, teores de sólidos solúveis totais (Brix, acidez total titulável (ATT e relação Brix/ATT. Conclui-se que há a necessidade de aplicação de cálcio no meloeiro sob cultivo protegido para solos com saturação de base abaixo de 70% e que a calagem mais fertirrigação com cálcio foi mais efetiva do que só a calagem. O uso do nitrato ou do cloreto de cálcio em fertirrigação apresentou maior rentabilidade do que a calagem ou calagem mais fertirrigação com cálcio tamponado ou c

  14. Effect of Soybean and Wheat as Cover Crops on Corn Yield and Weed Control using Different Fertilizer Sources

    Directory of Open Access Journals (Sweden)

    F. Dadashi

    2016-02-01

    . The dominant weed species were velvetleaf (Abutilon theophrasti Medic., johnson grass (Sorghum halepense (L. Pers., wild melon (Cucumis melo var. agrestis and giant foxtail (Setaria glauca L. in the field. In order to determine the dry weight and density of weeds, three-stage sampling was performed from the middle rows of corn. Corn yield was also measured by mechanical harvesting in middle rows and adjusting to 14% moisture. A week before the final harvest, ten plants of corn were selected randomly from the three middle rows of each plot and yield components including the number of rows in corn, number of kernels per row, weight of 1000 grains was measured. Results and Discussion: The results showed that soybean cover crop reduced weed density compared to control in weed infestated plots, but wheat was not successful in suppressing weeds and reducing their density due to poor biomass and dying at the end of growing season . So, the lowest dry matter of velvetleaf, wild melon and other weeds were related to planted corn with soybean and compost and the maximum was related to monoculture of corn with weed infestation. Results of analysis of variance indicated treatments had significant effect on grain yield. The lowest yield of corn (2733.3 Kg ha-1 was in weed-infestation control while the highest one (12124.0 and 8351.3 Kg ha-1 respectively was in weed-free control and soybean’ cover crop plus compost. For both cover crops between fertilizer treatments, compost and chemical fertilizer had more corn biological yield than no fertilizer and differences between this two fertilizer treatments wasn’t significant. Reduction of yield under no fertilizer treatments was due to competition for nutrients, light between weed and corn. The maximum and minimum number of rows in corn and number of kernels per row respectively was obtained with monoculture of corn in weed free and weed infestation, while the maximum weight of 1000 grains was observed in soybean with applying

  15. Efficacy of Peracetic Acid in Inactivating Foodborne Pathogens on Fresh Produce Surface.

    Science.gov (United States)

    Singh, Prashant; Hung, Yen-Con; Qi, Hang

    2018-02-01

    Washing treatment with effective sanitizer is one of the critical steps in ensuring fresh produce safety. This study was to evaluate the efficacy of peracetic acid (PAA; VigorOx® 15 F&V), chlorine-based sanitizers (acidic electrolyzed water [AEO], near neutral electrolyzed water and bleach), lactic acid, and deionized (DI) water to reduce Escherichia coli O157:H7, Listeria monocytogenes, and Salmonella Typhimurium DT104 from fresh produce surfaces. A 5-strain cocktail of E. coli O157:H7, L. monocytogenes, and S. Typhimurium DT104 was separately prepared and used for surface inoculation on produce samples (E. coli O157:H7 on romaine lettuce, lemons, tomatoes, and blueberries; L. monocytogenes on romaine lettuce and cantaloupe; S. Typhimurium DT104 on lemons, tomatoes, cantaloupe, and blueberries). PAA at 45, 85, and 100 mg/L; AEO, NNEO, and bleach at 100 mg/L of free chlorine; lactic acid at 2%; and DI water were used for washing inoculated produce in an automated produce washer for 5 min. In general, PAA at 100 mg/L achieved the highest microbial inactivation of E. coli O157:H7 (lettuce, lemon, tomato, and blueberry at 2.2, 5.7, 5.5, and 6.7 log CFU/g, respectively), S. Typhimurium DT104 (lemon, tomato, cantaloupe, blueberry at 5.4, 6.8, 4.5, and 5.9 log CFU/g, respectively), and L. monocytogenes (lettuce and cantaloupe at 2.4 and 4.4 log CFU/g, respectively). Efficacy of sanitizers on produce with coarse surface (for example, lettuce and cantaloupe) was lower than produce with smooth texture (lemon, tomato, and blueberry). Cross-contamination of E. coli O157:H7 among romaine lettuce heads during simulated retail crisping process was greatly reduced by the application of PAA and NNEO. NNEO and PAA showed high efficacy in foodborne pathogen removal from fresh produce. Produce surface texture plays an important role in pathogen removal. NNEO and PAA effectively prevented cross-contamination during the crisping process. © 2018 Institute of Food Technologists®.

  16. Effectiveness of plant based insecticides as a sustainable means of ...

    African Journals Online (AJOL)

    Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...

  17. QTL list: sex1.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64750 Cucumis sativus Cucurbitaceae sex1.2 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_01 ... 25.7 7.3 ... 10.1007/s00122-003-1277-1 12827247

  18. QTL list: sex6.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64751 Cucumis sativus Cucurbitaceae sex6.1 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_06 ... 63.8 5 ... 10.1007/s00122-003-1277-1 12827247

  19. QTL list: sex6.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64904 Cucumis sativus Cucurbitaceae sex6.1 Female flower ratio gynoecious (F) locus (sex...2.1), small spines (ss) locus (sex6.1) ... e7m18b LG_02 ... 92.6 4.47 ... 10.1007/s10681-008-9722-5 ...

  20. QTL list: sex2.1 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT64906 Cucumis sativus Cucurbitaceae sex2.1 Female flower ratio gynoecious (F) locus (sex...2.1), small spines (ss) locus (sex6.1) ... CS15 LG_06 ... 35.3 6.56 ... 10.1007/s10681-008-9722-5 ...