
Sample records for canis familiaris linnaeus

  1. Avaliação da cultura de células-tronco do epitélio olfatório de cães sem raça definida (Canis familiaris Linnaeus, 1758)


    Flávio Ribeiro Alves


    As células provenientes do epitélio olfatório apresentam capacidade regenerativa durante toda a vida, embora este mecanismo ainda não esteja completamente elucidado. O potencial de diferenciação de células-tronco provenientes do epitélio olfatório de cães sem raça definida (Canis familiaris Linnaeus, 1758) foi avaliado utilizando-se 12 cães adultos e 12 cães com 60 dias de vida intra-uterina, oriundos do Hospital Veterinário da FMVZ-USP. Após coletado, o epitélio olfatório foi submetido a pro...

  2. Effects of organohalogen pollutants on haematological and urine clinical-chemical parameters in Greenland sledge dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Kirkegaard, Maja;


    Seven West Greenland sledge dog bitches (Canis familiaris) and their three pups were fed 50-200 g of contaminated West Greenland minke whale (Balaenoptera acutorostrata) blubber, and in a control cohort eight sister bitches and their .ve pups were fed a similar amount pork fat. Blood plasma and u...

  3. Comparative NMR studies of diffusional water permeability of red blood cells from different species: XVI Dingo (Canis familiaris dingo) and dog (Canis familiaris). (United States)

    Benga, Gheorghe; Chapman, Bogdan E; Matei, Horea; Cox, Guy C; Romeo, Tony; Mironescu, Eugen; Kuchel, Philip W


    As part of a programme of comparative measurements of Pd (diffusional water permeability) the RBCs (red blood cells) from dingo (Canis familiaris dingo) and greyhound dog (Canis familiaris) were studied. The morphologies of the dingo and greyhound RBCs [examined by light and SEM (scanning electron microscopy)] were found to be very similar, with regard to aspect ratio and size; the mean diameters were estimated to be the same (approximately 7.2 microm) for both dingo and greyhound RBCs. The water diffusional permeability was monitored by using an Mn2+-doping 1H NMR technique at 400 MHz. The Pd (cm/s) values of dingo and greyhound RBCs were similar: 6.5 x 10(-3) at 25 degrees C, 7.5 x 10(-3) at 30 degrees C, 10 x 10(-3) at 37 degrees C and 11.5 x 10(-3) at 42 degrees C. The inhibitory effect of a mercury-containing SH (sulfhydryl)-modifying reagent PCMBS (p-chloromercuribenzene sulfonate) was investigated. The maximal inhibition of dingo and greyhound RBCs was reached in 15-30 min at 37 degrees C with 2 mmol/l PCMBS. The values of maximal inhibition were in the range 72-74% when measured at 25 degrees C and 30 degrees C, and approximately 66% at 37 degrees C. The lowest value of Pd (corresponding to the basal permeability to water) was approximately 2-3 x 10(-3) cm/s in the temperature range 25-37 degrees C. The Ea,d (activation energy of water diffusion) was 25 kJ/mol for dingo RBC and 23 kJ/mol for greyhound RBCs. After incubation with PCMBS, the values of Ea,d increased, reaching 46-48 kJ/mol in the condition of maximal inhibition of water exchange. The electrophoretograms of membrane polypeptides of the dingo and greyhound RBCs were compared and seen to be very similar. We postulate that the RBC parameters reported in the present study are characteristic of all canine species and, in particular in the two cases presented here, these parameters have not been changed by the peculiar Australian habitat over the millennia (as in the case of the dingo) or over

  4. Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species

    DEFF Research Database (Denmark)

    Sonne, Christian; Gustavson, Kim; Eulaers, Igor;


    The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First...

  5. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    Directory of Open Access Journals (Sweden)

    Courtney Hofman


    Full Text Available Domesticated dogs (Canis familiaris are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial characteristics. No cutmarks were found on the bones, but one of the mandibles was burned. The CA-SRI-2 dogs appear to have eaten high trophic marine foods similar to what humans consumed, documenting the close bond between dogs and humans on the Channel Islands and broader North American Pacific Coast.

  6. Diphyllobothrium sp. in Canis familiaris from the subtropical area of Argentina (Puerto Iguazú, Misiones). (United States)

    Rivero, María R; Motta, Carlos E; Salas, Martín M; Chiaretta, Alicia; Salomón, Oscar D


    This paper reports the first finding of Diphyllobothrium sp. eggs in Canis familiaris (domestic dog) from Puerto Iguazú, a subtropical city of Misiones province, Argentina. In 2013, two positive cases of Diphyllobothrium sp. eggs were detected during an annual parasitological survey of dogs. Dog feces were collected in vials containing 10% formalin and processed using Telemann's sedimentation and Sheather's flotation techniques. The two cases were detected in rural areas of the municipality. Since Misiones is not a part of the endemic area of diphyllobothriasis and given the fact that it is located in the three-border area of Argentina, Brazil and Paraguay, we consider this finding of great importance to public health. We stress the need for updating the current knowledge about the life cycle of these parasites considering the range of intermediate and definitive hosts, their zoonotic potential, and the epidemiological situation in non-endemic areas.

  7. Effect of training and familiarity on responsiveness to human cues in domestic dogs (Canis familiaris). (United States)

    Cunningham, Clare L; Ramos, Mari F


    Domestic dogs (Canis familiaris) seem to possess an evolved competency to follow human-given cues, often out-performing their wild progenitor the wolf (Canis lupus) on cue-following tasks. However, domestication may not be solely responsible for the socio-cognitive skills of dogs, with ontogenetic experience also playing a role. This research evaluated the effects of intensive training on cue-following behaviour using an unreinforced object-choice paradigm. The responses of dogs that were trained to competitive levels were compared to those of pet dogs with only basic training, and dogs living in an animal shelter that demonstrated no or only rudimentary following of basic commands. Using a cue-following task where three types of cues were presented by familiar and unfamiliar human partners, the number of cues followed by each training group were recorded. All dogs found cues where gesture was combined with a congruent head and eye movement easier to follow than either gesture or eye gaze alone. Whether the cue-giver was familiar or not had a significant effect on number of cues followed in homed dogs, and the performance of shelter dogs was comparable to the other groups when faced with an unfamiliar cue-giver. Contrary to predictions, level of training did not improve performance on the cue-following task. This work does provide support for the presence of an evolved adaptation to exploit social cues provided by humans that can be augmented by familiarity with the cue giver. However, additional joint activity as experienced in an intensive training regime does not seem to increase accuracy in following human-given cues.

  8. Development of a non-invasive polysomnography technique for dogs (Canis familiaris). (United States)

    Kis, Anna; Szakadát, Sára; Kovács, Enikő; Gácsi, Márta; Simor, Péter; Gombos, Ferenc; Topál, József; Miklósi, Adám; Bódizs, Róbert


    Recently dogs (Canis familiaris) have been demonstrated to be a promising model species for studying human behavior as they have adapted to the human niche and developed human-like socio-cognitive skills. Research on dog behavior, however, has so far almost exclusively focused on awake functioning. Here we present a self-developed non-invasive canine polysomnography method that can easily be applied to naive pet dogs. N=22 adult pet dogs (with their owners present) and N=12 adult humans participated in Study I. From these subjects, N=7 dogs returned on two more occasions for Study II. In Study I, we give a descriptive analysis of the sleep electroencephalogram of the dog and compare it to human data. In order to validate our canine polysomnography method in Study II, we compare the sleep macrostructure and the EEG spectrum of dogs after a behaviorally active day without sleep versus passive day with sleep. In Study I, we found that dogs' sleep EEG resembled that of human subjects and was generally in accordance with previous literature using invasive technology. In Study II, we show that similarly to previous results on humans daytime load of novel experiences and sleep deprivation affects the macrostructural and spectral aspects of subsequent sleep. Our results validate the family dog as a model species for studying the effects of pre-sleep activities on the EEG pattern under natural conditions and, thus, broaden the perspectives of the rapidly growing fields of canine cognition and sleep research.

  9. Experience matters: Dogs (Canis familiaris) infer physical properties of objects from movement clues. (United States)

    Kuroshima, Hika; Nabeoka, Yukari; Hori, Yusuke; Chijiiwa, Hitomi; Fujita, Kazuo


    Reasoning about physical properties of objects such as heaviness by observing others' actions toward them is important and useful for adapting to the environment. In this study, we asked whether domestic dogs (Canis familiaris) can use a human's action to infer a physical property of target objects. In Experiment 1, dogs watched an experimenter opening two differently loaded swinging doors with different corresponding degrees of effort, and then were allowed to open one of the doors. Dogs chose randomly between the two doors. In Experiment 2, we gave new dogs the same test as in Experiment 1, but only after giving them experience of opening the doors by themselves, so that they already knew that the doors could be either light or heavy. In this test the dogs reliably chose the light door. These results indicate that dogs are able to infer physical characteristics of objects from the latters' movement caused by human action, but that this inferential reasoning requires direct own experience of the objects.

  10. The effect of oxytocin on biological motion perception in dogs (Canis familiaris). (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József


    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills.

  11. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    James Hunt

    Full Text Available Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris, but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions

  12. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris). (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X


    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  13. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;


    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six exp...

  14. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme


    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  15. Coyote (Canis latrans) and domestic dog (Canis familiaris) mortality and morbidity due to a Karenia brevis red tide in the Gulf of Mexico. (United States)

    Castle, Kevin T; Flewelling, Leanne J; Bryan, John; Kramer, Adam; Lindsay, James; Nevada, Cheyenne; Stablein, Wade; Wong, David; Landsberg, Jan H


    In October 2009, during a Karenia brevis red tide along the Texas coast, millions of dead fish washed ashore along the 113-km length of Padre Island National Seashore (PAIS). Between November 2009 and January 2010, at least 12 coyotes (Canis latrans) and three domestic dogs (Canis familiaris) died or were euthanized at PAIS or local veterinary clinics because of illness suspected to be related to the red tide. Another red tide event occurred during autumn 2011 and, although fewer dead fish were observed relative to the 2009 event, coyotes again were affected. Staff at PAIS submitted carcasses of four coyotes and one domestic dog from November 2009 to February 2010 and six coyotes from October to November 2011 for necropsy and ancillary testing. High levels of brevetoxins (PbTxs) were measured by enzyme-linked immunosorbent assay in seven of the coyotes and the dog, with concentrations up to 634 ng PbTx-3 eq/g in stomach contents, 545 ng PbTx-3 eq/g in liver, 195 ng PbTx-3 eq/g in kidney, and 106 ng PbTx-3 eq/mL in urine samples. Based on red tide presence, clinical signs, and postmortem findings, brevetoxicosis caused by presumptive ingestion of toxic dead fish was the likely cause of canid deaths at PAIS. These findings represent the first confirmed report of terrestrial mammalian wildlife mortalities related to a K. brevis bloom. The implications for red tide impacts on terrestrial wildlife populations are a potentially significant but relatively undocumented phenomenon.

  16. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia). (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R


    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.

  17. Dieta del perro (canis familiaris) y sus interacciones con la fauna silvestre de la cuenca alta del Río Otún-Risaralda (Colombia)



    El perro (Canis familiaris) interactúa con la fauna silvestre principalmente por medio de la depredación, competencia y transmisión de enfermedades. Sin embargo, no se conoce con mucha claridad cómo se presentan estas interacciones. Para responder a este interrogante, en este trabajo se identificó la dieta del perro y la presencia de la enfermedad de Parvovirus (CPV). A partir de esta información, contrastada con el conocimiento de los pobladores del área de estudio, se determinaron las posib...

  18. Distribución de mastocitos del estroma de la glándula mamaria de perra (Canis familiaris), en periodos activo e inactivo


    Héctor Villaseñor Gaona; Rosa Emilia Laville; Santiago R. Anzaldúa Arce; Mario Pérez Martínez


    Los mastocitos (MC) son células del tejido conjuntivo que participan activamente en los mecanismos de comunicación paracrina mediante la liberación de diversos mediadores químicos contenidos en sus gránulos. El presente estudio se efectuó con el propósito de evaluar la distribución de los MC en la glándula mamaria de la perra (Canis familiaris), en periodos activo e inactivo. Las muestras de tejido mamario se obtuvieron a partir de perras adultas. Dichas muestras se procesaron siguiendo el mé...

  19. Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris)? (United States)

    Owczarczak-Garstecka, Sara C.; Burman, Oliver H. P.


    Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris) housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts). There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as ‘relaxed’ across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect. PMID:27732667

  20. Neospora Caninum and Leishmania Infantum Co-Infection in Domestic Dogs (Canis Familiaris in Meshkin-Shahr District, Northwestern Iran

    Directory of Open Access Journals (Sweden)

    A Rahimi Foroushani


    Full Text Available Background: Mediterranean visceral leishmaniasis (MVL is an infectious disease that affects both human and ani­mals. Domestic dogs (Canis familiaris are principal reservoir hosts of MVL caused by Leishmania infantum. Dogs are definitive hosts for Neospora caninum and a risk factor for infecting intermediate hosts. The immunosuppression caused by visceral leishmaniasis (VL can promote the occurrence of co-infections with other agents such as neosporo­sis. This study aimed to determine the frequency of co-infection of the both protozoan parasites in the en­demic areas of VL from Meshkin-Shahr District, north-west of Iran. Methods: Altogether, 171 serum samples were collected from domestic dogs of Meshkin- Shahr District by multistage cluster sampling from October 2008 to August 2009. The collected serum samples were tested for the detection of simultaneous infection of L. infantum and N. caninum using direct agglutination test (DAT and indirect ELISA, respectively. Results: Of the 171 domestic dogs, 27 (15.8% and 52 (30.4% were showed antibodies against L. infantum and N. caninum, respectively. Simultaneous infections of N. caninum and L. infantum was found in 16 (9.4% of the dogs. In VL-positive and VL-negative dogs, N. caninum infection was found in 59.3% and 25.0%, respectively. A statisti­cally significant difference was found between VL-positive and VL-negative dogs with N. caninum infection (P= 0.001. Conclusion: These findings indicate that Meshkin-Shahr District in northwestern Iran is an active focus of canine visceral leishmaniasis (CVL. Neospora caninum and L. infantum co-infection is prevalent in the area and infection by L. infantum seems to enhance susceptibility to N. caninum infection in domestic dogs.

  1. Neospora caninum and Leishmania infantum Co-Infection in Domestic Dogs (Canis familiaris in Meshkin-Shahr District, Northwestern Iran

    Directory of Open Access Journals (Sweden)

    M Sharifdini


    Full Text Available Background: Mediterranean visceral leishmaniasis (MVL is an infectious disease that affects both human and ani­mals. Domestic dogs (Canis familiaris are principal reservoir hosts of MVL caused by Leishmania infantum. Dogs are definitive hosts for Neospora caninum and a risk factor for infecting intermediate hosts. The immunosuppression caused by visceral leishmaniasis (VL can promote the occurrence of co-infections with other agents such as neosporo­sis. This study aimed to determine the frequency of co-infection of the both protozoan parasites in the en­demic areas of VL from Meshkin-Shahr District, north-west of Iran. Methods: Altogether, 171 serum samples were collected from domestic dogs of Meshkin- Shahr District by multistage cluster sampling from October 2008 to August 2009. The collected serum samples were tested for the detection of simultaneous infection of L. infantum and N. caninum using direct agglutination test (DAT and indirect ELISA, respectively. Results: Of the 171 domestic dogs, 27 (15.8% and 52 (30.4% were showed antibodies against L. infantum and N. caninum, respectively. Simultaneous infections of N. caninum and L. infantum was found in 16 (9.4% of the dogs. In VL-positive and VL-negative dogs, N. caninum infection was found in 59.3% and 25.0%, respectively. A statisti­cally significant difference was found between VL-positive and VL-negative dogs with N. caninum infection (P= 0.001. Conclusion: These findings indicate that Meshkin-Shahr District in northwestern Iran is an active focus of canine visceral leishmaniasis (CVL. Neospora caninum and L. infantum co-infection is prevalent in the area and infection by L. infantum seems to enhance susceptibility to N. caninum infection in domestic dogs.

  2. Physiological, physical and behavioural changes in dogs (Canis familiaris) when kennelled: testing the validity of stress parameters. (United States)

    Part, C E; Kiddie, J L; Hayes, W A; Mills, D S; Neville, R F; Morton, D B; Collins, L M


    Domestic dogs (Canis familiaris) housed in kennelling establishments are considered at risk of suffering poor welfare. Previous research supporting this hypothesis has typically used cortisol:creatinine ratios (C/Cr) to measure acute and chronic stress in kennelled dogs. However, the value of C/Cr as a welfare indicator has been questioned. This study aimed to test the validity of a range of physiological, physical and behavioural welfare indicators and to establish baseline values reflecting good dog welfare. Measurements were taken from 29 privately-owned dogs (14 males, 15 females), ranging in age and breed, in their own home and in a boarding kennel environment, following a within-subjects, counterbalanced design. Pairwise comparisons revealed that C/Cr and vanillylmandelic acid:creatinine ratios (VMA/Cr) were higher in the kennel than home environment (P=0.003; P=0.01, respectively) and were not associated with differences in movement/exercise between environments. Dogs' surface temperature was lower in kennels (P=0.001) and was not associated with ambient temperature. No association with age, or effects of kennel establishment, kennelling experience, sex or source were found. Dogs were generally more active in kennels, but showed considerable individual variability. C/Cr and 5-HIAA:creatinine ratios (5-HIAA/Cr) were negatively correlated with lip licking in kennels. Baseline values for each parameter are presented. The emotional valence of responses was ambiguous and no definitive evidence was found to suggest that dogs were negatively stressed by kennelling. It was concluded that C/Cr and, particularly, VMA/Cr and surface temperature provide robust indicators of psychological arousal in dogs, while spontaneous behaviour might be better used to facilitate interpretation of physiological and physical data on an individual level.

  3. How do guide dogs and pet dogs (Canis familiaris) ask their owners for their toy and for playing? (United States)

    Gaunet, Florence


    When apes are not fully understood by humans, they persist with attempts to communicate, elaborating their behaviours to better convey their meaning. Such abilities have never been investigated in dogs. The present study aimed to clarify any effect of the visual attentional state of the owner on dogs' (Canis familiaris) social-communicative signals for interacting with humans, and to determine whether dogs persist and elaborate their behaviour in the face of failure to communicate a request. Gaze at a hidden target or at the owner, gaze alternation between a hidden target and the owner, vocalisations and contacts in 12 guide and 12 pet dogs were analysed (i) when the dogs were asked by their owners (blind or sighted) to fetch their inaccessible toy and (ii) when the dogs were subsequently given an unfamiliar object (apparent unsuccessful communication) or their toy (apparent successful communication). No group differences were found, indicating no effect of the visual status of the owner on the dogs' socio-communicative modes (i.e. no sensitivity to human visual attention). Results, however, suggest that the dogs exhibited persistence (but not elaboration) in their "showing" behaviours in each condition, except that in which the toy was returned. Thus, their communication was about a specific item in space (the toy). The results suggest that dogs possess partially intentional non-verbal deictic abilities: (i) to get their inaccessible toy, the dogs gazed at their owners as if to trigger their attention; gaze alternation between the owner and the target direction, and two behaviours directed at the target were performed, apparently to indicate the location of the hidden toy; (ii) after the delivery of the toy, the dogs behaved as if they returned to the play routine, gazing at their owner whilst holding their toy. In conclusion, this study shows that dogs possess partially intentional non-verbal deictic abilities: they exhibit successive visual orienting between a

  4. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Rigét, Frank F; Beck Jensen, Jens-Erik


    ) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n=26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n=15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata......) blubber as main lipid sources. The results showed that BMD increased significantly with age (linear regression: p0.3). No differences in BMD(femur) or BMD(vertebrae) between exposed and control...... individuals in the bitch generation were found (linear mixed effect model: both p>0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMD(femur), BMD(vertebrae) and groups of OHCs...

  5. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery. (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco


    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.

  6. Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species. (United States)

    Sonne, Christian; Gustavson, Kim; Eulaers, Igor; Desforges, Jean-Pierre; Letcher, Robert J; Rigét, Frank F; Styrishave, Bjarne; Dietz, Rune


    The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First the critical body residues (CBRs) were estimated using the physiologically-based pharmacokinetic (PBPK) model for seven POP compounds based on rat critical daily doses (CDDs). These were then compared with the actual daily oral POP doses (DD) and body residues (BR) in the sledge dogs by calculating risk quotients (RQDD: DD/CDD; RQBR: BR/CBR; ≥1 indicates risk). The results showed that risk quotients for reproductive, immunotoxic and liver histopathological effects were significantly lowest in the control group (pPOP exposure negatively impacts steroid hormones, various immune parameters, as well as liver histopathology in sledge dogs. It is also clear that RQBR is the best reflector of health effects from POP exposure and that it is especially accurate in predicting immune and reproductive effects. We recommend that PBPK modelled (CBR) and RQBR should be used in the assessment of POP exposure and health effects in Arctic top predators.

  7. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Riget, Frank F.; Jensen, Jens-Erik Beck


    ) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n = 26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n = 15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata......) blubber as main lipid sources. The results showed that BMD increased significantly with age (linear regression: p 0.0001, r(2)=0.83, n=41) while no sex difference was found in the F-generation (two-way ANOVA: all p>0.3). No differences in BMDfemur or BMDvertebrae between exposed and control individuals...... in the bitch generation were found (linear mixed effect model: both p > 0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMDfemur, BMDvertebrae and groups of OHCs, respectively, did...

  8. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.


    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  9. Bacteriological evaluation of bone grafts stored by cryogenic freezing at –24°C from a canine (Canis familiaris bone bank

    Directory of Open Access Journals (Sweden)

    Jaqueline França dos Santos


    Full Text Available The scientific basis of bone transplantation was established during the mid-nineteenth century, when the osteogenic properties of the bone and periosteum, beneficial influence of cold preservation of bones, and first conventional attempt to store bones for elective use, were described. A bone bank has several advantages, such as the immediate availability of grafts in large quantities, and different shapes and sizes, and maintenance of osteoinductive activity in grafts. In addition, it reduces patient blood loss, surgical time, and quantity of anesthetics required. Clinical applications include the correction of comminuted fractures, treatment of non-union bones, and replacement of bone loss due to infections or malignancies. The success of these procedures depends on the preservation and integrity of the graft. This study aimed to evaluate the feasibility of maintaining a canine bone bank (Canis familiaris by quantifying the bacterial contamination of bone grafts preserved at –24°C. The samples were evaluated through a monthly assessment of bacteriological cultures over a period of 6 months. The harvest method was efficient and sterile, reducing the risk of contamination. We conclude that the techniques chosen for the implementation of a bone bank were effective and feasible (use of a common freezer reaching a temperature below –24°C. The viability of the bones was attested during a 6-month period, and the samples demonstrated a 100% sterility rate.

  10. Steroid hormones in blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen polluted minke whalte (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Letcher, Robert J.;


    conducted in Greenland sledge dogs (Canis familiaris) as a sentinel species for adverse effects on steroid homeostasis. The control and exposed groups were composed of four sister-bitches all fed pork fat (Suis suis) and organohalogen contaminated minke whale (Balaenoptera acutorostrata) blubber......Persistent organic pollutants such as polychlorinated biphenyls (PCB) are known to disrupt steroidogenesis and subsequent concentrations of circulating endogenous hormones. This is also suspected to occur in Arctic predatory species, such as polar bears (Ursus maritimus) and a study was therefore...

  11. Contagious yawning in domestic dog puppies (Canis lupus familiaris): the effect of ontogeny and emotional closeness on low-level imitation in dogs. (United States)

    Madsen, Elainie Alenkær; Persson, Tomas


    Contagious yawning is a well-documented phenomenon in humans and has recently attracted much attention from developmental and comparative sciences. The function, development and underlying mechanisms of the phenomenon, however, remain largely unclear. Contagious yawning has been demonstrated in dogs and several non-human primate species, and theoretically and empirically associated with empathy in humans and non-human primates. Evidence of emotional closeness modulating contagious yawning in dogs has, nonetheless, been contradictory. Humans show a developmental increase in susceptibility to yawn contagion, with typically developing children displaying a substantial increase at the age of four, when a number of cognitive abilities (e.g. accurate identification of others' emotions) begin to clearly manifest. Explicit tests of yawn contagion in non-human animals have, however, thus far only involved adult individuals. Here, we report a study of the ontogeny of domestic dogs' (Canis lupus familiaris) susceptibility to yawn contagion, and whether emotional closeness to the yawning model affects this. Thirty-five dogs, aged 4-14 months, observed a familiar and unfamiliar human repeatedly yawn or gape. The dogs yawned contagiously, but emotional closeness with the model did not affect the strength of contagion, raising questions as to recent evidence of emotionally modulated auditory contagious yawning in dogs. The dogs showed a developmental effect, with only dogs above 7 months evidencing contagion. The results support the notion of a developmental increase in dogs' attention to others and identification of others' emotional states and suggest that yawn contagion is underpinned by developmental processes shared by humans and other animals.

  12. Estimativa do intervalo pós-morte em um canino (Canis lupus familiaris Linnaeus 1758 pela entomologia forense em Cabedelo-PB, Brasil: relato de caso

    Directory of Open Access Journals (Sweden)

    G. Martins


    Full Text Available O intervalo pós-morte (IPM é um instrumento importante de diagnóstico relacionado à prática forense. O uso de insetos tem sido relatado como um modo eficiente para estimá-lo, quando o cadáver encontra-se em estágio avançado de decomposição. Objetivou-se com este trabalho estimar o IPM com base em evidências entomológicas em um canino. Foram coletadas larvas de moscas no cadáver e encaminhadas ao laboratório de entomologia, onde foram criadas e eclodiram adultos da espécie Chrysomya albiceps (Wiedemann, 1819. Somando-se os dados abióticos de temperatura e umidade relativa do local de coleta e do local de criação, estimou-se um IPM mínimo de 3,34 dias do momento da postura dos ovos pelas moscas até a coleta das larvas. Com base nos resultados obtidos, conclui-se que a entomologia forense, como ferramenta para estimativa do IPM, mostrou-se eficaz e determinante na elucidação do caso em questão.

  13. Use of fibrin glue derived from snake venom in the repair of deep corneal ulcers: experimental study in dogs (Canis familiaris, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    R. L. Sampaio


    Full Text Available Fibrin glue has been researched as an alternative method for tissue synthesis and is known for its capability to promote hemostasis at the application site, good approximation of wound edges and fast healing. The current study consisted in the application of fibrin glue derived from snake venom as treatment for experimental corneal ulcers. Twenty-one dogs had their corneas experimentally prepared through lamellar keratectomy (of standardized diameter and depth. Animals were divided into seven groups of three animals each. Six experimental groups were periodically evaluated and collection was carried out on the 1st, 3rd, 7th, 15th, 30th and 60th post-operative days, whereas one control group was evaluated throughout the experiment. Analyses consisted in the clinical evolution and in the histopathological study of all operated on eyes. Results indicated that fibrin glue was efficient in repairing keratectomy wounds in dogs and contributed to an earlier healing phenomenon, avoiding edema formation and keeping corneal clearness. The use of fibrin glue derived from snake venom showed to be easy to apply, feasible with animal models and of low cost, avoiding the lesion progress and allowing fast and appropriate corneal healing.

  14. 茯苓多糖对鼠和犬一般药理学实验研究%A General Pharmacological Study of Pachymaran in Mice and Canis Familiaris

    Institute of Scientific and Technical Information of China (English)

    林丽霞; 薛银萍; 梁国瑞; 刘俊霞; 孟岩; 熊晨


    after duodenal administration for 1, 2 and 4 h. Results The differences in values of central nervous system in mice and respiratory range, respiratory rhythm, blood pressure and heart rate in dogs before and after medication showed no statistically significant difference (P >0. 05). Conclusion Pachyma-ran has no obvious influence on nervous system in mice, respiratory system and cardiovascular system in canis familiaris.

  15. Do dogs (Canis lupus familiaris) prefer family? (United States)

    Hamilton, Jennifer; Vonk, Jennifer


    Kin recognition requires the ability to discriminate between one's own genetic relatives and non-relatives. There are two mechanisms that aid in kin discrimination: phenotype matching and familiarity. Dogs may be a good model for assessing these mechanisms as dogs are a promiscuous social species with a keen sense of smell. Domestic dogs of both sexes were presented with two scents (close kin, distant-kin) and preference was assessed through three measures (latency to approach, number of visits, time spent). Experiment 1 explored the possibility of phenotype matching as subjects had no contact with sires, whose scent was presented alongside a control male's scent. Experiment 2 explored recognition of siblings raised with the subjects and then separated at seven weeks of age. Whereas female dogs in this experiment did not show a statistically significant preference, male dogs showed a preference for distant-kin when presented with sire and female sibling samples.

  16. Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus) (United States)

    Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...

  17. Ultra-sonografia bidimensional em tempo real do bulbo ocular de cães (Canis familiaris, Linnaeus, 1758 com opacificação de meios transparentes. Emprego do transdutor mecânico setorial de 7,5 MHz com almofada de recuo Two-dimensional real-time ultrasonography in eyes of dogs (Canis familiaris, Linnaeus, 1758 with opacification of transparent media use of a 7.5 MHz mechanical sector fluid offset transducer

    Directory of Open Access Journals (Sweden)

    Ana Maria Barros Soares


    Full Text Available Utilizou-se ultra-sonografia bidimensional em tempo real na avaliação de 20 bulbos oculares de 10 cães, sem alterações clínicas visíveis, e de 55 bulbos oculares de 30 cães com opacificação de meios transparentes. Empregou-se transdutor mecânico setorial de 7,5 MHz com almofada de recuo, em técnica de contato corneano. Para a realização dos exames, os animais foram contidos mecanicamente e as córneas receberam anestesia tópica. A blefarostasia deu-se manualmente. Os bulbos foram avaliados com o transdutor aplicado nas posições vertical e horizontal. As características ultra-sonográficas encontradas em olhos normais o foram a similitude da literatura especializada. Relativamente aos bulbos oculares com opacificação de meios transparentes, encontraram-se alterações junto às estruturas e compartimentos. Destacaram-se as cataratas, as luxações e subluxações do cristalino, as degenerações do vítreo, as hemorragias e inflamações em câmaras anterior e vítrea e os descolamentos de retina. A base dos achados e a fidedignidade das imagens colhidas permitem admitir que a ultra-sonografia bidimensional em tempo real, utilizando o transdutor mecânico setorial de 7,5MHz com almofada de recuo, adequa-se ao exame das estruturas intra-oculares, mormente na Medicina Veterinária em que os recursos são parcos à aplicação de procedimentos mais sofisticados ou de equipamentos para ultra-sonografia próprios à especialidade.The two-dimensional real-time ultrasonography was used to evaluate 20 normal eyes of 10 dogs and 55 eyes o f 30 dogs with ocular opacity. A 7.5MHz mechanical sector fluid offset transducer was utilized, and the corneal contact method was performed. The exams were carried out with the animal awake, the córnea received a topical ophtalmic anesthetic, and the eyelids were held open manually. The eyes were examined with the transducer in vertical and horizontal positions. The ultraso- nographic characteristics found in the normal eye structures were compatible with the experiences related by several dijferent authors. Several changes were found in the structures and chambers of the eye which presented opacities of the media, such as cataracts, lens luxation and sub-luxation, vitreous degeneration, hemorrhage and inflammation in the vitreal chamber, besides retinal detachments. On the basis of the studies carried out and the obtained results, it was possible to conclude that the two-dimensional real-time ultrasonography, with the use of a 7.5MHz mechanical sector fluid offset transducer shows a satisfactory adaptability to the evaluation of the intra-ocular structures. It is indicated specially in Veterinary Medicine in which resources are scanty to sophisticated procedures or specific eye ultrasound equipment.

  18. Do domestic dogs (Canis lupus familiaris) perceive the Delboeuf illusion? (United States)

    Miletto Petrazzini, Maria Elena; Bisazza, Angelo; Agrillo, Christian


    In the last decade, visual illusions have been repeatedly used as a tool to compare visual perception among species. Several studies have investigated whether non-human primates perceive visual illusions in a human-like fashion, but little attention has been paid to other mammals, and sensitivity to visual illusions has been never investigated in the dog. Here, we studied whether domestic dogs perceive the Delboeuf illusion. In human and non-human primates, this illusion creates a misperception of item size as a function of its surrounding context. To examine this effect in dogs, we adapted the spontaneous preference paradigm recently used with chimpanzees. Subjects were presented with two plates containing food. In control trials, two different amounts of food were presented in two identical plates. In this circumstance, dogs were expected to select the larger amount. In test trials, equal food portion sizes were presented in two plates differing in size: if dogs perceived the illusion as primates do, they were expected to select the amount of food presented in the smaller plate. Dogs significantly discriminated the two alternatives in control trials, whereas their performance did not differ from chance in test trials with the illusory pattern. The fact that dogs do not seem to be susceptible to the Delboeuf illusion suggests a potential discontinuity in the perceptual biases affecting size judgments between primates and dogs.

  19. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  20. How dogs lap: ingestion and intraoral transport in Canis familiaris


    Crompton, A. W.; Musinsky, Catherine


    It has recently been suggested that the mechanism for lifting liquid from a bowl into the oral cavity during lapping is fundamentally different in cats and dogs: cats use adhesion of liquid to the tongue tip while dogs ‘scoop’ with their backwardly curled tongue. High-speed light videos and X-ray videos show that on the contrary, both cats and dogs use the mechanism of adhesion. Liquid is transported through the oral cavity to the oesophagus, against gravity, on the surface of the tongue as i...

  1. How dogs lap: ingestion and intraoral transport in Canis familiaris. (United States)

    Crompton, A W; Musinsky, Catherine


    It has recently been suggested that the mechanism for lifting liquid from a bowl into the oral cavity during lapping is fundamentally different in cats and dogs: cats use adhesion of liquid to the tongue tip while dogs 'scoop' with their backwardly curled tongue. High-speed light videos and X-ray videos show that on the contrary, both cats and dogs use the mechanism of adhesion. Liquid is transported through the oral cavity to the oesophagus, against gravity, on the surface of the tongue as it is drawn upwards, then a tight contact between the tongue surface and palatal rugae traps liquid and prevents its falling out as the tongue is protruded. At least three cycles are needed for intraoral transport of liquid in the dog.

  2. Isolation of viable Neospora caninum from brains of wild gray wolves (Canis lupus). (United States)

    Dubey, J P; Jenkins, M C; Ferreira, L R; Choudhary, S; Verma, S K; Kwok, O C H; Fetterer, R; Butler, E; Carstensen, M


    Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts that can excrete environmentally resistant oocysts in the environment, but also can act as intermediate hosts, harboring tissue stages of the parasite. In an attempt to isolate viable N. caninum from tissues of naturally infected wolves, brain and heart tissue from 109 wolves from Minnesota were bioassayed in mice. Viable N. caninum (NcWolfMn1, NcWolfMn2) was isolated from the brains of two wolves by bioassays in interferon gamma gene knockout mice. DNA obtained from culture-derived N. caninum tachyzoites of the two isolates were analyzed by N. caninum-specific Nc5 polymerase chain reaction and confirmed diagnosis. This is the first report of isolation of N. caninum from tissues of any wild canid host.

  3. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L.S.


    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  4. Linnaeus garden. [Spanish

    Directory of Open Access Journals (Sweden)

    François Delaporte


    Full Text Available Since XVIII century, garden is the place of both the know-how and the knowledge accomplished by experimental botanic. Starting from this point a definition will be advanced of what a technical environment is: an environment of culture made of norms and laws. But this technical environment should be distinguished from the natural environment. This one refers to an environment occupied by wild species. The point is, therefore, to determine the nature of the relationship between technical and natural environment. Linnaeus used to assign the products of culture a positive value. Rousseau goes the opposite way. He assigns nature a positive value. Linnaeus valuates the garden, he stands for the culture. Rousseau devaluates the garden, he stands for nature. The debate about modified organisms may begin.

  5. Assessing inbreeding and loss of genetic variation in canids, domestic dog (Canis familiaris) and wolf (Canis lupus), using pedigree data


    Jansson, Mija


    Genetic variation is necessary to maintain the ability of wild and domestic populations to genetically adapt to changed selective pressures. When relationships among individuals are known, conservation genetic management can be based on statistical pedigree analysis. Such approaches have traditionally focused on wild animal conservation breeding in captivity. In this thesis, I apply pedigree-based techniques to domestic and wild animal populations, focusing on two canids – the domestic dog an...

  6. What or where? The meaning of referential human pointing for dogs (Canis familiaris). (United States)

    Tauzin, Tibor; Csík, Andor; Kis, Anna; Topál, József


    Dogs have a unique capacity to follow human pointing, and thus it is often assumed that they can comprehend the referential meaning of such signals. However, it is still unclear whether dogs perceive human directional gestures as signals referring to a target object (indicating what to manipulate) or a spatial cue (indicating where to do something). In the present study, we investigated which of these alternative interpretations may explain dogs' responses to human pointing gestures in ostensive communicative and nonostensive cuing contexts. To test whether dogs select the cued object or the cued location, subjects were presented with 2 alternative object-choice trials. An experimenter first attracted the attention of the dog either by calling the dog's name and looking at it (ostensive condition, n = 24) or by clapping the hands (nonostensive condition, n = 24) then pointed at 1 of 2 different toy objects. Subsequently, the experimenter switched the location of the 2 target objects in full view of the dogs by grasping the objects and making a 180° turn. Dogs were then allowed to choose between the 2 objects. In the ostensive condition, dogs showed a significant bias toward the cued location compared with the nonostensive condition in which they performed at chance. These results suggest that pointing refers to a direction or location for dogs, but only if they are addressed with ostensive cues that indicate the communicative intention of the signaler.

  7. Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

    Directory of Open Access Journals (Sweden)

    Jennifer B Nagashima

    Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.

  8. The interrelated effect of sleep and learning in dogs (Canis familiaris); an EEG and behavioural study (United States)

    Kis, Anna; Szakadát, Sára; Gácsi, Márta; Kovács, Enikő; Simor, Péter; Török, Csenge; Gombos, Ferenc; Bódizs, Róbert; Topál, József


    The active role of sleep in memory consolidation is still debated, and due to a large between-species variation, the investigation of a wide range of different animal species (besides humans and laboratory rodents) is necessary. The present study applied a fully non-invasive methodology to study sleep and memory in domestic dogs, a species proven to be a good model of human awake behaviours. Polysomnography recordings performed following a command learning task provide evidence that learning has an effect on dogs’ sleep EEG spectrum. Furthermore, spectral features of the EEG were related to post-sleep performance improvement. Testing an additional group of dogs in the command learning task revealed that sleep or awake activity during the retention interval has both short- and long-term effects. This is the first evidence to show that dogs’ human-analogue social learning skills might be related to sleep-dependent memory consolidation. PMID:28165489

  9. Comparative functional anatomy of the epaxial musculature of dogs (Canis familiaris) bred for sprinting vs. fighting. (United States)

    Webster, Emma L; Hudson, Penny E; Channon, Sarah B


    The axial musculoskeletal system of quadrupedal mammals is not currently well understood despite its functional importance in terms of facilitating postural stability and locomotion. Here we examined the detailed architecture of the muscles of the vertebral column of two breeds of dog, the Staffordshire bull terrier (SBT) and the racing greyhound, which have been selectively bred for physical combat and high speed sprint performance, respectively. Dissections of the epaxial musculature of nine racing greyhounds and six SBTs were carried out; muscle mass, length, and fascicle lengths were measured and used to calculate muscle physiological cross-sectional area (PCSA), and to estimate maximum muscle potential for force, work and power production. The longissimus dorsi muscle was found to have a high propensity for force production in both breeds of dog; however, when considered in combination with the iliocostalis lumborum muscle it showed enhanced potential for production of power and facilitating spinal extension during galloping gaits. This was particularly the case in the greyhound, where the m. longissimus dorsi and the m. iliocostalis lumborum were estimated to have the potential to augment hindlimb muscle power by ca. 12%. Breed differences were found within various other muscles of the axial musculoskeletal system, particularly in the cranial cervical muscles and also the deep muscles of the thorax which insert on the ribs. These may also highlight key functional adaptations between the two breeds of dog, which have been selectively bred for particular purposes. Additionally, in both breeds of dog, we illustrate specialisation of muscle function by spinal region, with differences in both mass and PCSA found between muscles at varying levels of the axial musculoskeletal system, and between muscle functional groups.

  10. The Effect of Pet Remedy on the Behaviour of the Domestic Dog (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Sienna Taylor


    Full Text Available Stress-affected behaviour in companion animals can have an adverse effect on animal health and welfare and their relationships with humans. This stress can be addressed using chemical treatments, often in conjunction with behavioural therapies. Here, we investigated the efficacy of one commercial pharmacological intervention, Pet Remedy, advertised as a natural stress relief product for mammals. We aimed to see whether the product lowered stress-affected behaviour in dogs placed in a non-familiar environment. Behavioural responses of 28 dogs were video recorded using a double-blind, placebo-controlled, and counterbalanced repeated measures design. Dogs were exposed to both a placebo and Pet Remedy plug-in diffuser for 30 min with an intervening period of approximately 7 days between conditions. Multivariate regression analysis identified no significant differences in behaviour in either the Pet Remedy or placebo condition. In conclusion, in the current study, Pet Remedy did not reduce behavioural indicators indicative of a stress response. To determine the effects of Pet Remedy, future research using a larger sample size and controlling for breed would be beneficial.

  11. Change of Diurnal Heart Rate Patterns During Pregnancy and Lactation in Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Häggström J


    Full Text Available Pregnancy and lactation involve great demands on the cardiovascular system. The purpose of this study was to investigate how the heart rate and diurnal heart rate pattern change when dogs become pregnant or lactate. Five clinically healthy female beagle dogs were mated, and delivered three to seven healthy puppies. The heart rate was investigated with 24-h ECG (Holter once during anoestrus, at 3, 5, 7 and 9 weeks of pregnancy, and at week 4 postpartum (lactation. However, at 9 weeks, the ECG could not be recorded for the fully 24 h in 4 of 5 dogs, because labour started and the dogs then appeared disturbed by the recordings. The results at this date are not included in the statistical comparison. The heart rate increased progressively during pregnancy and was still elevated at 4 weeks of lactation. During late pregnancy the difference in heart rates between daytime and nighttime became smaller, but the heart rate was significantly higher in daytime in all periods. In conclusion, the increased heart rates during pregnancy and lactation reflect increased demands on the cardiovascular system and may be important to consider in clinical practice.

  12. Influence of owners' attachment style and personality on their dogs' (Canis familiaris separation-related disorder.

    Directory of Open Access Journals (Sweden)

    Veronika Konok

    Full Text Available Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD, Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  13. Influence of Owners' Attachment Style and Personality on Their Dogs' (Canis familiaris) Separation-Related Disorder


    Veronika Konok; András Kosztolányi; Wohlfarth Rainer; Bettina Mutschler; Ulrike Halsband; Ádám Miklósi


    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence ...

  14. Influence of owners' attachment style and personality on their dogs' (Canis familiaris) separation-related disorder. (United States)

    Konok, Veronika; Kosztolányi, András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi, Ádám


    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian) dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD), Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  15. Discrimination of human and dog faces and inversion responses in domestic dogs (Canis familiaris). (United States)

    Racca, Anaïs; Amadei, Eleonora; Ligout, Séverine; Guo, Kun; Meints, Kerstin; Mills, Daniel


    Although domestic dogs can respond to many facial cues displayed by other dogs and humans, it remains unclear whether they can differentiate individual dogs or humans based on facial cues alone and, if so, whether they would demonstrate the face inversion effect, a behavioural hallmark commonly used in primates to differentiate face processing from object processing. In this study, we first established the applicability of the visual paired comparison (VPC or preferential looking) procedure for dogs using a simple object discrimination task with 2D pictures. The animals demonstrated a clear looking preference for novel objects when simultaneously presented with prior-exposed familiar objects. We then adopted this VPC procedure to assess their face discrimination and inversion responses. Dogs showed a deviation from random behaviour, indicating discrimination capability when inspecting upright dog faces, human faces and object images; but the pattern of viewing preference was dependent upon image category. They directed longer viewing time at novel (vs. familiar) human faces and objects, but not at dog faces, instead, a longer viewing time at familiar (vs. novel) dog faces was observed. No significant looking preference was detected for inverted images regardless of image category. Our results indicate that domestic dogs can use facial cues alone to differentiate individual dogs and humans and that they exhibit a non-specific inversion response. In addition, the discrimination response by dogs of human and dog faces appears to differ with the type of face involved.

  16. Dogs (Canis familiaris) adjust their social behaviour to the differential role of inanimate interactive agents. (United States)

    Petró, Eszter; Abdai, Judit; Gergely, Anna; Topál, József; Miklósi, Ádám


    Dogs are able to flexibly adjust their social behaviour to situation-specific characteristics of their human partner's behaviour in problem situations. However, dogs do not necessarily detect the specific role played by the human in a particular situation: they may form expectations about their partners' behaviour based on previous experiences with them. Utilising inanimate objects (UMO-unidentified moving object) as interacting agents offers new possibilities for investigating social behaviour, because in this way we can remove or control the influence of previous experience with the partner. The aim of the present study was to investigate whether dogs are able to recognise the different roles of two UMOs and are able to adjust their communicative behaviour towards them. In the learning phase of the experiment, dogs were presented with a two-way food-retrieval problem in which two UMOs, which differed in their physical appearance and abilities, helped the dog obtain a piece of food in their own particular manner. After a short experience with both UMOs, dogs in the test phase faced one of the problems in the presence of both inanimate agents. Overall, dogs displayed similar levels of gazing behaviour towards the UMOs, but in the first test they looked, approached and touched the relevant partner first. This rapid adjustment of social behaviour towards UMOs suggests that dogs may generalise their experiences with humans to unfamiliar agents and are able to select the appropriate partner when facing a problem situation.

  17. Concomitant administration of GonaCon™ and rabies vaccine in female dogs (Canis familiaris) in Mexico. (United States)

    Vargas-Pino, Fernando; Gutiérrez-Cedillo, Verónica; Canales-Vargas, Erick J; Gress-Ortega, Luis R; Miller, Lowell A; Rupprecht, Charles E; Bender, Scott C; García-Reyna, Patricia; Ocampo-López, Juan; Slate, Dennis


    Mexico serves as a global model for advances in rabies prevention and control in dogs. The Mexican Ministry of Health (MMH) annual application of approximately 16 million doses of parenteral rabies vaccine has resulted in significant reductions in canine rabies during the past 20 years. One collateral parameter of rabies programs is dog population management. Enhanced public awareness is critical to reinforce responsible pet ownership. Surgical spaying and neutering remain important to prevent reproduction, but are impractical for achieving dog population management goals. GonaCon™, an anti-gonadotropin releasing hormone (GnRH) vaccine, was initially tested in captive female dogs on the Navajo Nation, 2008. The MMH led this international collaborative study on an improved formulation of GonaCon™ in captive dogs with local representatives in Hidalgo, Mexico in 2011. This study contained 20 bitches assigned to Group A (6 control), Group B (7 GonaCon™), and Group C (7 GonaCon™ and rabies vaccine). Vaccines were delivered IM. Animals were placed under observation and evaluated during the 61-day trial. Clinically, all dogs behaved normally. No limping or prostration was observed, in spite of minor muscle atrophy post-mortem in the left hind leg of dogs that received GonaCon™. Two dogs that began the study pregnant give birth to healthy pups. Dogs that received a GonaCon™ injection had macro and microscopic lesions consistent with prior findings, but the adverse injection effects were less frequent and lower in intensity. Both vaccines were immunogenic based on significant increases in rabies virus neutralizing antibodies and anti-GnRH antibodies in treatment Groups B and C. Simultaneous administration of GonaCon™ and rabies vaccine in Group C did not affect immunogenicity. Progesterone was suppressed significantly in comparison to controls. Future studies that monitor fertility through multiple breeding cycles represent a research need to determine the value of integrating this vaccine into dog rabies management.



    VILCA DE DIAZ, FELICIANA; Universidad Nacional del Altiplano; MELO ANCCASI, MAXIMO; Universidad Nacional del Altiplano


    ResumenLas mascotas que conviven con el hombre, el  perro y el gato ocupan un lugar muy especial, como amigos fieles, especialmente de los niños; sin embargo esta relación se interrumpe por la presencia de parásitos ciclozoonóticos, ocasionando múltiples enfermedades, incluso en algunos casos podrían ocasionar  la muerte, con repercusiones socioeconómicas de impacto. Por ello la necesidad de realizar esta investigación para determinar la prevalencia de entero parásitos  en estas especies, eva...

  19. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)



    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfoló- gicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se reco- lectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fue- ron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

  20. Cross modal perception of body size in domestic dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna M Taylor

    Full Text Available While the perception of size-related acoustic variation in animal vocalisations is well documented, little attention has been given to how this information might be integrated with corresponding visual information. Using a cross-modal design, we tested the ability of domestic dogs to match growls resynthesized to be typical of either a large or a small dog to size-matched models. Subjects looked at the size-matched model significantly more often and for a significantly longer duration than at the incorrect model, showing that they have the ability to relate information about body size from the acoustic domain to the appropriate visual category. Our study suggests that the perceptual and cognitive mechanisms at the basis of size assessment in mammals have a multisensory nature, and calls for further investigations of the multimodal processing of size information across animal species.

  1. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris)


    Héctor Rubén Ávila Adarme; Luis Rafael Neira Rairán


    La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores rep...

  2. Effect of reinforcement, reinforcer omission and extinction on a communicative response in domestic dogs (Canis familiaris). (United States)

    Bentosela, Mariana; Barrera, Gabriela; Jakovcevic, Adriana; Elgier, Angel M; Mustaca, Alba E


    There is a controversy about the mechanisms involved in the interspecific communicative behaviour in domestic dogs. The main question is whether this behaviour is a result of instrumental learning or higher cognitive skills are required. The present investigations were undertaken to study the effect of learning processes upon the gaze towards the human's face as a communicative response. To such purpose, in Study 1, gaze response was subjected to three types of reinforcement schedules: differential reinforcement, reinforcer omission, and extinction in a situation of "asking for food". Results showed a significant increase in gaze duration in the differential reinforcement phase and a significant decrease in both the omission and extinction phases. These changes were quite rapid, since they occurred only after three training trials in each phase. Furthermore, extinction resulted in animal behaviour changes, such as an increase in the distance from the experimenter, the back position and lying behaviour. This is the first systematic evaluation of the behavioural changes caused by reward withdrawal (frustration) in dogs. In Study 2, the gaze response was studied in a situation where dogs walked along with their owners/trainers. These results show that learning plays an important role in this communicative response. The possible implications of these results for service dogs are discussed.


    Directory of Open Access Journals (Sweden)



    Full Text Available

    Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato fisiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos fisiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  4. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)



    Full Text Available


    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave: garrapatas, perros, Ornithodoros puertoricensis, Ixodida, Colombia.


    Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

    Key words: Ticks, dogs, Ornithodoros puertoricensis, Ixodida, Colombia

  5. What counts for dogs (Canis lupus familiaris) in a quantity discrimination task? (United States)

    Miletto Petrazzini, Maria Elena; Wynne, Clive D L


    Numerous studies have reported that animals reliably discriminate quantities of more or less food. However, little attention has been given to the relative salience of numerosity compared to the total amount of food when animals are making their choices. Here we investigated this issue in dogs. Dogs were given choices between two quantities of food items in three different conditions. In the Congruent condition, the total amount of food co-varied with the number of food items; in the Incongruent condition the total amount was pitted against the numerosity; and in the Controlled condition the total amount between the sets was equal. Results show that dogs based their choice on the total amount of edible food rather than on the number of food items, suggesting that, in food choice tasks, amount counts more than number. The presence of the largest individual item in a set did not bias dogs' choices. A control test excluded the possibility that dogs based their choices on olfactory cues alone.

  6. Identification of behaviour in freely moving dogs (Canis familiaris using inertial sensors.

    Directory of Open Access Journals (Sweden)

    Linda Gerencsér

    Full Text Available Monitoring and describing the physical movements and body postures of animals is one of the most fundamental tasks of ethology. The more precise the observations are the more sophisticated the interpretations can be about the biology of a certain individual or species. Animal-borne data loggers have recently contributed much to the collection of motion-data from individuals, however, the problem of translating these measurements to distinct behavioural categories to create an ethogram is not overcome yet. The objective of the present study was to develop a "behaviour tracker": a system composed of a multiple sensor data-logger device (with a tri-axial accelerometer and a tri-axial gyroscope and a supervised learning algorithm as means of automated identification of the behaviour of freely moving dogs. We collected parallel sensor measurements and video recordings of each of our subjects (Belgian Malinois, N=12; Labrador Retrievers, N=12 that were guided through a predetermined series of standard activities. Seven behavioural categories (lay, sit, stand, walk, trot, gallop, canter were pre-defined and each video recording was tagged accordingly. Evaluation of the measurements was performed by support vector machine (SVM classification. During the analysis we used different combinations of independent measurements for training and validation (belonging to the same or different individuals or using different training data size to determine the robustness of the application. We reached an overall accuracy of above 90% perfect identification of all the defined seven categories of behaviour when both training and validation data belonged to the same individual, and over 80% perfect recognition rate using a generalized training data set of multiple subjects. Our results indicate that the present method provides a good model for an easily applicable, fast, automatic behaviour classification system that can be trained with arbitrary motion patterns and potentially be applied to a wide range of species and situations.

  7. Identification of behaviour in freely moving dogs (Canis familiaris) using inertial sensors. (United States)

    Gerencsér, Linda; Vásárhelyi, Gábor; Nagy, Máté; Vicsek, Tamas; Miklósi, Adam


    Monitoring and describing the physical movements and body postures of animals is one of the most fundamental tasks of ethology. The more precise the observations are the more sophisticated the interpretations can be about the biology of a certain individual or species. Animal-borne data loggers have recently contributed much to the collection of motion-data from individuals, however, the problem of translating these measurements to distinct behavioural categories to create an ethogram is not overcome yet. The objective of the present study was to develop a "behaviour tracker": a system composed of a multiple sensor data-logger device (with a tri-axial accelerometer and a tri-axial gyroscope) and a supervised learning algorithm as means of automated identification of the behaviour of freely moving dogs. We collected parallel sensor measurements and video recordings of each of our subjects (Belgian Malinois, N=12; Labrador Retrievers, N=12) that were guided through a predetermined series of standard activities. Seven behavioural categories (lay, sit, stand, walk, trot, gallop, canter) were pre-defined and each video recording was tagged accordingly. Evaluation of the measurements was performed by support vector machine (SVM) classification. During the analysis we used different combinations of independent measurements for training and validation (belonging to the same or different individuals or using different training data size) to determine the robustness of the application. We reached an overall accuracy of above 90% perfect identification of all the defined seven categories of behaviour when both training and validation data belonged to the same individual, and over 80% perfect recognition rate using a generalized training data set of multiple subjects. Our results indicate that the present method provides a good model for an easily applicable, fast, automatic behaviour classification system that can be trained with arbitrary motion patterns and potentially be applied to a wide range of species and situations.

  8. Algorithm-supported visual error correction (AVEC) of heart rate measurements in dogs, Canis lupus familiaris. (United States)

    Schöberl, Iris; Kortekaas, Kim; Schöberl, Franz F; Kotrschal, Kurt


    Dog heart rate (HR) is characterized by a respiratory sinus arrhythmia, and therefore makes an automatic algorithm for error correction of HR measurements hard to apply. Here, we present a new method of error correction for HR data collected with the Polar system, including (1) visual inspection of the data, (2) a standardized way to decide with the aid of an algorithm whether or not a value is an outlier (i.e., "error"), and (3) the subsequent removal of this error from the data set. We applied our new error correction method to the HR data of 24 dogs and compared the uncorrected and corrected data, as well as the algorithm-supported visual error correction (AVEC) with the Polar error correction. The results showed that fewer values were identified as errors after AVEC than after the Polar error correction (p error correction is more suitable for dog HR and HR variability than is the customized Polar error correction, especially because AVEC decreases the likelihood of Type I errors, preserves the natural variability in HR, and does not lead to a time shift in the data.

  9. Conservation of the Sapsaree (Canis familiaris), a Korean Natural Monument, using somatic cell nuclear transfer. (United States)

    Jang, Goo; Hong, SoGun; Kang, JungTaek; Park, JungEun; Oh, HyunJu; Park, ChanKyu; Ha, JiHong; Kim, DaeYong; Kim, MinKyu; Lee, ByeongChun


    A recent emerging technology, somatic cell nuclear transfer (SCNT), has been considered for conserving threatened or endangered species. Sapsaree is a native breed in Korea and has been designated as a Natural Monument. The aim of this study was to produce a Sapsaree by SCNT for breed conservation. Donor fibroblasts from a 9-year-old male Sapsaree were placed into the perivitelline spaces of enucleated in vivo matured oocytes and fused electrically. A total of 309 cloned embryos were transferred into the oviducts of 15 naturally synchronized recipients. Two recipients were diagnosed as pregnant, and each delivered one cloned puppy, both of which weighed 530 g. Overall, this study demonstrated that an endangered canine breed can be conserved by SCNT.

  10. Experimental infection of dogs (Canis familiaris) with sporulated oocysts of Neospora caninum. (United States)

    Bandini, Luciana A; Neto, Aldo F A; Pena, Hilda F J; Cavalcante, Guacyara T; Schares, Gereon; Nishi, Sandra M; Gennari, Solange M


    Neospora caninum is widely distributed in the world and this parasite is one of the major causes of abortion in cattle. Dogs and coyotes are definitive hosts of N. caninum and several species of domestic and wild animals are intermediate hosts. Dogs can become infected by the ingestion of tissues containing cysts and then excrete oocysts. It is not yet known whether sporulated oocysts are able to induce a patent infection in dogs, i.e. a shedding of N. caninum oocysts in feces. The objective of this study was to experimentally examine the infection of dogs by sporulated oocysts. The oocysts used in the experiment were obtained by feeding dogs with brain of buffaloes (Bubalus bubalis) positive for anti-N. caninum antibodies by indirect fluorescent antibody test (IFAT ≥200). Oocysts shed by these dogs were confirmed to be N. caninum by molecular methods and by bioassay in gerbils, and sporulated N. caninum oocysts were used for the oral infection of four dogs. The dogs were 8 weeks old and negative for antibodies to N. caninum and Toxoplasma gondii. Dogs 1 and 4 received an inoculum of 10,000 sporulated oocysts each; dog 2 an inoculum of 5000 sporulated oocysts and dog 3 received 1000 sporulated oocysts of N. caninum. The total feces excreted by these dogs were collected and examined daily for a period of 30 days. No oocysts were found in their feces. The dogs were monitored monthly for a 6-month period to observe a possible seroconversion and when this occurred the animals were eliminated from the experiment. Dogs 1 and 4 seroconverted 1 month after the infection with titer, in the IFAT, of 1600 and 800, respectively; the other two dogs presented no seroconvertion during the 6-month period. Dogs 1 and 2 were euthanized 180 days after infection and were examined for the detection of N. caninum in tissues (brain, muscle, lymph node, liver, lung, heart and bone marrow) by immunohistochemistry and PCR with negative results in both techniques. Bioassay in gerbils with brain of these dogs was also performed and again the results were negative. In conclusion, dogs infected with sporulated oocysts of N. caninum were not able to shed oocysts in feces. However, a higher dose of infection stimulated the production of antibodies against N. caninum in the dogs.

  11. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris). (United States)

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő


    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  12. Rasgos del temperamento de los perros domésticos (Canis familiaris: evaluaciones conductuales

    Directory of Open Access Journals (Sweden)



    Full Text Available Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato psiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos psiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  13. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna Kis

    Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  14. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae from Panama

    Directory of Open Access Journals (Sweden)

    Roberto Miranda C


    Full Text Available Objetive. To determine the distribution of ectoparasites in dogs in Panama. Materials and methods. There were surveyed 720 canines belonging to 57 communities. Results. The results showed that 84% of the dogs were infested with at least one species of ectoparasite. Dogs from lowlands showed a higher percentage of parasitism and a greater biodiversity of parasites than dogs from highlands. There were found seven species of ticks, four species of fleas, two species of lice, and one specie of botfly. The ticks Rhipicephalus sanguineus, Amblyomma cajennense, A. ovale and the flea Ctenocephalides felis were widespread; however Ixodes boliviensis and Pulex simulans showed a much narrower geographic distribution and they were found only in dogs from highlands. The flea species Rhopalopsyllus cacicus and the tick Haemaphysalis juxtakochi were found for the first time in panamanian dogs. Conclusions. The environmental situation in Panama, can encourage that wildlife ectoparasites parasitized dogs in absence of their native hosts. This condition may increase transmission risk of some diseases where the ticks and fleas are vectors.

  15. Influence of different artificial lighting regimes on intraocular pressure circadian profile in the dog (Canis familiaris). (United States)

    Piccione, Giuseppe; Giannetto, Claudia; Fazio, Francesco; Giudice, Elisabetta


    The present study was undertaken to determine the temporal variation in intraocular pressure (IOP) and if this variation is under circadian clock control. The authors exposed five female and five male Beagles to four different artificial lighting regimes: 12/12 light/dark (L/D) period, 12/12 D/L period, constant light, and constant darkness. IOP was measured at 3 h intervals over a 48-h period. Statistical analysis of the data was performed by multivariate ANOVA, one-way repeated measure ANOVA and by the single cosinor method. Results showed no statistical effect of gender, eye and photoperiod on IOP values. A significant effect of time for each gender and each eye during all lighting regimes was seen, except during constant light, and also robust daily rhythmicity of IOP values in all L/D periods, except during constant light. In conclusion IOP values in the dog show a circadian rhythm and this rhythm is driven by a central pacemaker.

  16. Molecular detection of Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli in stray dogs in Mahasarakham province, Thailand. (United States)

    Piratae, Supawadee; Pimpjong, Kiattisak; Vaisusuk, Kotchaphon; Chatan, Wasupon


    Canine tick borne diseases showing distribution worldwide have caused morbidity and mortality in dogs. This study observed the mainly tick borne pathogens described for dogs in Thailand, Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli. From May to July 2014, blood samples were collected from 79 stray dogs from 7 districts of Mahasarakham province to molecular surveyed for 16s rRNA gene of E. canis and 18s rRNA gene of H. canis and B. canis vogeli. Twenty eight (35.44%) of stray dogs showed the infection with tick borne pathogens. The prevalence of E. canis infection was the highest with 21.5% (17/79). DNA of H. canis and B. canis vogeli were detected at the prevalence of 10.1% (8/79) and 6.3% (5/79), respectively. Co-infection between E. canis and B. canis vogeli were identified in 2 (2.5%) dogs. The results indicated that a wide range of tick borne pathogens are circulation in the canine population in Mahasarakham province. This study is the first report on prevalence of E. canis, H. canis and B. canis vogeli in stray dogs in Mahasarakham, a province in northern part of Thailand. This data providing is important to understand the prevalence of E. canis, H. canis and B. canis vogeli infection in stray dogs in this region, which will assist in the management of these blood parasite.

  17. Carl Linnaeus: pictures and propaganda. (United States)

    Fara, Patricia


    How do scientists become famous? Carl Linnaeus was an expert at self-promotion who used portraits to gain patronage and consolidate his reputation. His sexualized classification system was hugely controversial, yet his successors celebrated him as a great hero of botany.

  18. Conejo Oryctolagus cuniculus (Linnaeus, 1758)



    Salgado I. 2016. Conejo Oryctolagus cuniculus (Linnaeus, 1758). En: Calzada J., Clavero M. & Fernández A. (eds). “Guía virtual de los indicios de los mamíferos de la Península Ibérica, Islas Baleares y Canarias”. Sociedad Española para la Conservación y Estudio de los Mamíferos (SECEM). Downloaded on "12/12/2016”

  19. Giardia canis: ultrastructural analysis of G. canis trophozoites transfected with full length G. canis virus cDNA transcripts (United States)

    Giardia canis virus (GCV) is a double-stranded RNA (dsRNA) virus of the family Totiviridae. In this study, the full-length cDNA of the G. canis virus was constructed in pPoly2/sfinot vector and RNA was transcribed in vitro. Virus-free G. canis trophozoites were transfected with in vitro transcribed ...

  20. Fatal Babesia canis canis infection in a splenectomized Estonian dog. (United States)

    Tiškina, Valentina; Capligina, Valentina; Must, Külli; Berzina, Inese; Ranka, Renate; Jokelainen, Pikka


    A previously splenectomized dog from Estonia was presented with a sudden lack of appetite and discoloration of the urine. Despite supportive therapy, its condition deteriorated dramatically during 1 day. Severe thrombocytopenia and high numbers of protozoan hemoparasites were evident in blood smears, and the hematocrit dropped from 46 to 33 %. The dog was euthanized before specific antibabesial treatment was initiated. Blood samples from the dog and from two other dogs in the same household tested positive for Babesia using molecular methods, and the sequences of partial 18S rRNA gene confirmed the causative species as Babesia canis canis. The risk of severe, rapidly progressing babesiosis in splenectomized dogs merits awareness.

  1. Intestinal macro- and microparasites of wolves (Canis lupus L.) from north-eastern Poland recovered by coprological study. (United States)

    Kloch, Agnieszka; Bednarska, Małgorzata; Bajer, Anna


    Wolf scats collected during ecological studies in Mazury lake district in NE Poland were analysed for intestinal micro- and macroparasites. Five nematode species were identified: Ancylostoma caninum (Ercolani, 1859), Uncinaria stenocephala (Railliet, 1884), Trichuris vulpis (Froelich, 1789), Toxocara canis (Werner, 1782) and Toxascaris leonina (von Linstow, 1902). Among cestode species there were identified infections with Dipylidium caninum (Linnaeus, 1785). The overall helminth prevalence was 63.5 % and average intensity was 15.4 +/- 8.0 eggs /1g of sample. The most prevalent parasite was T. vulpis (38.5 %) and the most abundant infections were by T. canis. Almost 55 % of samples (28/51) were positive for C. parvum oocysts and 46.7 % (14/30) for Giardia spp. cysts. The pack factor affected the distribution of some of macro- and microparasites. The identified parasite fauna of wolves in Mazury lake district consists of several micro- and macroparasites of interest for public health.

  2. Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

    NARCIS (Netherlands)

    M.M. Hassan; O.F. Osman; F.M.A. El-Raba'a; H.D.F.H. Schallig; D.E.A. Elnaiem


    Background: The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a re

  3. Neospora caninum exposure in overlapping populations of coyotes (Canis latrans) and feral swine (Sus scrofa). (United States)

    Bevins, Sarah; Blizzard, Emily; Bazan, Luis; Whitley, Pat


    Limited information exists on Neospora caninum transmission dynamics in wildlife. This coccidian parasite, whose presence can lead to substantial economic losses in cattle operations, requires a canid definitive host for reproduction. We examined exposure in a definitive host, coyotes (Canis latrans), and in overlapping populations of feral swine (Sus scrofa) to determine if spatial proximity between a definitive and incidental host influences the likelihood of parasite exposure. Eighteen percent of coyotes (95% confidence interval [CI] = 14.2-21.8) and 15.8% of feral swine (95% CI = 12.5-19.2) had been exposed to N. caninum, and this is the first report of exposure in US feral swine populations. Analyses suggest that the parasite is present throughout the environment and that exposure is not temporally or spatially linked to antibody-positive coyotes. Antibody-positive feral swine were found in an area where the only definitive host is domestic dogs (Canis familiaris), indicating that wild canids are not required to maintain the parasite in the environment.

  4. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)


    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

  5. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus)


    Udell, Monique A.R.


    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' ‘looking back’ behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks mo...

  6. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus). (United States)

    Udell, Monique A R


    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' 'looking back' behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks more generally. In this study, pet dogs, shelter dogs and wolves were given up to three opportunities to open a solvable puzzle box: when subjects were with a neutral human caretaker, alone and when encouraged by the human. Wolves were more persistent and more successful on this task than dogs, with 80% average success rate for wolves versus a 5% average success rate for dogs in both the human-in and alone conditions. Dogs showed increased contact with the puzzle box during the encouragement condition, but only a moderate increase in problem-solving success. Social sensitivity appears to play an important role in pet and shelter dogs' willingness to engage in problem-solving behaviour, which could suggest generalized dependence on, or deference to, human action.

  7. [Molecular and morphological comparison of hookworms from genus Uncinaria invading red fox (Vulpes vulpes) and dog (Canis familiaris)]. (United States)

    Górski, Paweł; Radowańska, Agnieszka; Jaros, Dorota; Wiśniewski, Marcin


    Two species of hookworms from genus Uncinaria have been found so far in Poland. Uncinaria stenocephala infects mainly dog, wolf and red fox, whereas Uncinaria criniformis is a parasite of mustelids (but it was also reported from red fox). 19 male and 29 female hookworms from red foxes have been compared with 10 male and 12 female worms from dogs. Hookworms from dogs were generally smaller than these from foxes, but no other morphological differences could be found. These hookworms were qualified to species Uncinaria stenocephala on the ground of morphology of male. Genomic DNA samples have been isolated from these hookworms and segments of rDNA including part of small subunit of ribosomal RNA gene; internal transcribed spacer 1 (ITS1); 5.8 S ribosomal RNA; internal transcribed spacer 2 (ITS2) and part of large subunit of ribosomal RNA have been amplified and sequenced. Sequences from Uncinaria obtained both from foxes and dogs have shown very high similarity to the sequence of Uncinaria stenocephala, so all examined hookworms have been classified as belonging to this species.

  8. Most domestic dogs (Canis lupus familiaris) prefer food to petting: population, context, and schedule effects in concurrent choice. (United States)

    Feuerbacher, Erica N; Wynne, Clive D L


    Previous research has indicated both petting (McIntire & Colley, 1967) and food (Feuerbacher & Wynne, 2012) have reinforcing effects on dog behavior and support social behavior towards humans (food: Elliot & King, 1960; social interaction: Brodbeck, 1954). Which type of interaction dogs prefer and which might produce the most social behavior from a dog has not been investigated. In the current study, we assessed how dogs allocated their responding in a concurrent choice between food and petting. Dogs received five 5-min sessions each. In Session 1, both food and petting were continuously delivered contingent on the dog being near the person providing the respective consequence. Across the next three sessions, we thinned the food schedule to a Fixed Interval (FI) 15-s, FI 1-min, and finally extinction. The fifth session reversed back to the original food contingency. We tested owned dogs in familiar (daycare) and unfamiliar (laboratory room) environments, and with their owner or a stranger as the person providing petting. In general, dogs preferred food to petting when food was readily available and all groups showed sensitivity to the thinning food schedule by decreasing their time allocation to food, although there were group and individual differences in the level of sensitivity. How dogs allocated their time with the petting alternative also varied. We found effects of context, familiarity of the person providing petting, and relative deprivation from social interaction on the amount of time dogs allocated to the petting alternative.

  9. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris Affected with Hypoadrenocorticism (Addison's Disease.

    Directory of Open Access Journals (Sweden)

    Alisdair M Boag

    Full Text Available Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD or autoimmune polyendocrine syndrome (APS, circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH, CYP17A1 (17-hydroxylase; 17-OH, CYP11A1 (P450 side-chain cleavage enzyme; P450scc and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation. Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016. Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037. Significant associations with breed (p = 0.015 and DLA-type (DQA1*006:01 allele; p = 0.017 were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  10. Intranasally administered oxytocin affects how dogs (Canis familiaris) react to the threatening approach of their owner and an unfamiliar experimenter. (United States)

    Hernádi, Anna; Kis, Anna; Kanizsár, Orsolya; Tóth, Katinka; Miklósi, Bernadett; Topál, József


    Fear and aggression are among the most prominent behavioural problems in dogs. Oxytocin has been shown to play a role in regulating social behaviours in humans including fear and aggression. As intranasal oxytocin has been found to have some analogous effects in dogs and humans, here we investigated the effect of oxytocin on dogs' behaviour in the Threatening Approach Test. Dogs, after having received intranasal administration of oxytocin (OT) or placebo (PL), showed the same reaction to an unfamiliar experimenter, but OT pretreated dogs showed a less friendly first reaction compared to the PL group when the owner was approaching. Individual differences in aggression (measured via questionnaire) also modulated dogs' first reaction. Moreover, subjects that received OT looked back more at the human (owner/experimenter) standing behind them during the threatening approach. These results suggest that oxytocin has an effect on dogs' response to the threatening cues of a human, but this effect is in interaction with other factors such as the identity of the approaching human and the 'baseline' aggression of the dogs.

  11. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris) Affected with Hypoadrenocorticism (Addison's Disease). (United States)

    Boag, Alisdair M; Christie, Michael R; McLaughlin, Kerry A; Syme, Harriet M; Graham, Peter; Catchpole, Brian


    Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD) or autoimmune polyendocrine syndrome (APS), circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH), CYP17A1 (17-hydroxylase; 17-OH), CYP11A1 (P450 side-chain cleavage enzyme; P450scc) and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD) were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation). Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016). Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037). Significant associations with breed (p = 0.015) and DLA-type (DQA1*006:01 allele; p = 0.017) were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  12. Leishmaniosis--a report about the microvascular and cellular architecture of the infected spleen in Canis familiaris. (United States)

    Alexandre-Pires, G; Pais, D; Correia, M; Pina, J A Esperança


    Leishmaniosis is an anthropozoonosis caused by an intracellular protozoan parasite that causes a wide spectrum of diseases in humans and dogs worldwide. In the Mediterranean basin, Portugal, Central and South America, and in the Middle East, visceral leishmaniosis is caused by Leishmania infantum. In these areas, dogs are believed to be the natural reservoirs of this parasite. In the case of visceral leishmaniosis, the spleen is one of the several hematopoietic and immunocompetent organs involved. Since this viscera is a blood filter, the authors investigated the expression of the morphological and microvascular environment and modifications of the spleen cell population related to immunological responses to this parasitic condition. The tools used to perform this study were scanning electronic microscopy of intact tissue and corrosion casts, transmission electronic microscopy, histology and immunohistochemistry. The results reveal three important modifications concerning the spleen's microvascular architecture when compared with its normal pattern, independently of the serological titer obtained with indirect immunofluorescence. (1) A marked scarcity of the sinusoidal system sheet that surrounds the central artery/arteriole of the white pulp; (2) A huge development of pulp venules and veins; (3) The presence of a surprising development of reticular fibers. The authors postulate that independent of the virulence of the parasite involved and the type of immunity prevalent in a particular host, the spleen develops blood dynamic conditions that permit reduction in the speed of blood flow so that cells involved in immunological processes can proliferate and differentiate, and also contributes to trapping lymphocytes within the area through the differentiation of characteristics that resemble those of HEV endothelial cells.

  13. Exploring the mechanical basis for acceleration: pelvic limb locomotor function during accelerations in racing greyhounds (Canis familiaris). (United States)

    Williams, S B; Usherwood, J R; Jespers, K; Channon, A J; Wilson, A M


    Animals in their natural environments are confronted with a regular need to perform rapid accelerations (for example when escaping from predators or chasing prey). Such acceleration requires net positive mechanical work to be performed on the centre of mass by skeletal muscle. Here we determined how pelvic limb joints contribute to the mechanical work and power that are required for acceleration in galloping quadrupeds. In addition, we considered what, if any, biomechanical strategies exist to enable effective acceleration to be achieved. Simultaneous kinematic and kinetic data were collected for racing greyhounds undergoing a range of low to high accelerations. From these data, joint moments and joint powers were calculated for individual hindlimb joints. In addition, the mean effective mechanical advantage (EMA) of the limb and the ;gear ratio' of each joint throughout stance were calculated. Greatest increases in joint work and power with acceleration appeared at the hip and hock joints, particularly in the lead limb. Largest increases in absolute positive joint work occurred at the hip, consistent with the hypothesis that quadrupeds power locomotion by torque about the hip. In addition, hindlimb EMA decreased substantially with increased acceleration - a potential strategy to increase stance time and thus ground impulses for a given peak force. This mechanism may also increase the mechanical advantage for applying the horizontal forces necessary for acceleration.

  14. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics. (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M


    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds.

  15. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...


    Directory of Open Access Journals (Sweden)

    Adriana Jakovcevic


    Full Text Available El estudio de las diferencias individuales en el comportamiento de los perros domésticos tiene un gran valor aplicado dado que permite una mejor selección de los mismos para cumplir las variadas funciones que tienen en la sociedad humanacomo perros guía, policía, compañía, rescatistas de personas, etc. En el trabajo que se informa se presenta una revisión de estudios sobre diferencias individuales en perros, basada únicamente en las baterías conductuales que evalúan un conjunto de rasgos del temperamento. Con este objetivo se realiza una breve descripción de cada batería de pruebas utilizadas en la literatura, analizando las definiciones operacionales de las variables eva luadas y los diferentes tipos de estímulos utilizados. Los rasgos mayormente evaluados son: temerosidad, agresividad, disposición al entrenamiento y sociabilidad. La te merosidad, en general es evaluada a través de la respuesta del animal ante la aparición de un estímulo súbito que puede ser intenso o no, como por ejemplo la reacción frente a un ruido fuerte, la apertura de un paraguas, o la aparición repentina de una figura humana. La agresividad se mide a través de la reacción frentea la amenaza o provocación por parte de un humano, la sustracción de un objeto o la confrontación con un perro dominante. La disposición al entrenamiento es estudiada a través de la respuesta del animal frente a diferentes estímulos como el juego con un trapo o una cuerda, el ejercicio de devolución de un objeto o la obediencia frente a distintos comandos. Por último, la sociabilidad se evalúa con la aparición o el acercamiento de un humano desconocido o con la exposición a un perro no familiar. Se discuten además las limitaciones metodológicas de las baterías así como también los importantes usos aplicados de las mismas.

  17. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris in a Food Choice Task.

    Directory of Open Access Journals (Sweden)

    Judit Abdai

    Full Text Available The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1 Helper UMO and (2 Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3 Non-helper UMO and (4 Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  18. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris) in a Food Choice Task. (United States)

    Abdai, Judit; Gergely, Anna; Petró, Eszter; Topál, József; Miklósi, Ádám


    The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO) can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1) Helper UMO and (2) Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3) Non-helper UMO and (4) Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  19. Anatomia dental de cães (Canis familiaris) e gatos (Felis catus). Considerações cirúrgicas


    Juliana Kowalesky


    Com a rápida evolução da odontologia veterinária na última década, faz-se crescente a busca pelo conhecimento da área e a busca por referências bibliográficas, porém nota-se que as informações existentes de uma área essencial, a anatomia, estão limitadas a descrições básicas. Sabe-se que o conhecimento da anatomia do sistema estomatognático é de fundamental importância para que clínicos e cirurgiões possam diagnosticar e instituir tratamento adequado e preciso. Apesar dos livros de odontologi...

  20. Functional anatomy and muscle moment arms of the pelvic limb of an elite sprinting athlete: the racing greyhound (Canis familiaris). (United States)

    Williams, S B; Wilson, A M; Rhodes, L; Andrews, J; Payne, R C


    We provide quantitative anatomical data on the muscle-tendon architecture and geometry of the pelvic limb of an elite sprint athlete, the racing greyhound. Specifically, muscle masses, muscle lengths, fascicle lengths, pennation angles and muscle moment arms were measured. Maximum isometric force and power of muscles, the maximum muscle torque at joints and tendon stress and strain were estimated. We compare data with that published for a generalized breed of canid, and other cursorial mammals such as the horse and hare. The pelvic limb of the racing greyhound had a relatively large volume of hip extensor muscle, which is likely to be required for power production. Per unit body mass, some pelvic limb muscles were relatively larger than those in less specialized canines, and many hip extensor muscles had longer fascicle lengths. It was estimated that substantial extensor moments could be created about the tarsus and hip of the greyhound allowing high power output and potential for rapid acceleration. The racing greyhound hence possesses substantial specializations for enhanced sprint performance.

  1. Functional anatomy and muscle moment arms of the thoracic limb of an elite sprinting athlete: the racing greyhound (Canis familiaris). (United States)

    Williams, S B; Wilson, A M; Daynes, J; Peckham, K; Payne, R C


    We provide quantitative muscle-tendon architecture and geometry data for the racing greyhound thoracic limb. Muscle mass, belly length, fascicle lengths, pennation angles and moment arms were measured, as were tendon masses and lengths. Maximum isometric force and maximum power were estimated for muscles, and maximum stress and strain were estimated for tendons. Results are compared with other fast quadrupedal runners, and to previously published data in mixed-breed dogs. The implications of the functional adaptations of the greyhound thoracic limb for sprinting performance are discussed. The thoracic limb was found to benefit from a similar proportion of locomotor muscle mass to the pelvic limb, suggesting that it may be used to some extent in propulsion, or alternatively that stabilisation is very important in this animal. Extrinsic muscles, especially latissimus dorsi and pectoralis profundus, were predicted to be powerful and important for generating net positive work during accelerations. Proximal biarticular muscles show specialisation toward preventing collapse of the shoulder and elbow joints to enable strut-like limb function, or some form of dynamic control. Distal muscles did not appear specialised for elastic energy storage, a functional difference to pelvic limb muscles, and the equivalents in horse thoracic limbs. The greyhound thoracic limb appears to possess substantial differences from both that of more 'sub-maximal specialist' quadrupeds, and from the greyhound pelvic limb.

  2. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris. (United States)

    de Oliveira Filho, Jaires Gomes; Sarria, André Lucio Franceschini; Ferreira, Lorena Lopes; Caulfield, John C; Powers, Stephen J; Pickett, John A; de León, Adalberto A Pérez; Birkett, Michael A; Borges, Lígia Miranda Ferreira


    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed, the beagle, is mediated by volatile organic compounds (VOCs) 2-hexanone and benzaldehyde present in beagle odour. Ectoparasite location of animal hosts is affected by variation in these odour components and their ratios. The aim of this study was to quantify the release rate, and the ratio, of 2-hexanone and benzaldehyde from beagles. The odour of three beagles was collected, for four days, over one week (day 0, day 1, day 4 and day 7). The compounds were identified using coupled high-resolution gas chromatography-mass spectrometry (GC-MS), and authentic standards of compounds were used to generate external calibration curves for quantification. Both compounds were found in all dogs on all days. The amount of benzaldehyde was always higher than that of 2-hexanone and so their ratio varied from unity, on average (over time) being 3.128±0.365, 1.902±0.390, 1.670±0.671ngmL(-1) for beagle 1, 2 and 3, respectively. There was no significant (pbenzaldehyde in beagle odour samples covering a 7-day period. This knowledge enables development of repellents to protect dogs from R. sanguineus s. l. infestation.

  3. Bad math in Linnaeus' Philosophia Botanica. (United States)

    Podani, János; Szilágyi, András


    In Philosophia Botanica (1751), Carolus Linnaeus (1707-1778) presented a calculation of the number of plant genera that may be distinguished based on his taxonomic concepts. In order to derive that number, he relied upon the organs of fructification, which represent the flower and the fruit, by selecting over 30 elements from them, and then assuming that each could vary by four dimensions. However, while Linnaeus was good in counting stamens and pistils, he and many of his followers who edited or translated Philosophia Botanica were less careful, basing their calculations of the number of possible genera on flawed assumptions, or even introducing basic arithmetic errors. Furthermore, although mathematics was quite advanced in the eighteenth century, the gap between combinatorial and botanical thinking was too deep, preventing Linnaeus to seek a reasonable solution to the problem he raised. The authors demonstrate this by a historical analysis of 15 editions of Philosophia Botanica, plus many references to it, and conclude that the desired number almost always appeared in error during the past 265 years. The German botanist J. G. Gleditsch (1714-1786) was the most successful with respect to Linnaeus' original intention. Elementary mathematics demonstrates that if Linnaeus' assumptions were taken seriously, then the possible number of genera would be astronomical. The practice he followed in Genera Plantarum (1754) shows, however, that the fructification dimensions served as a universal set for Linnaeus from which he chose only the relevant ones for describing a particular genus empirically. Based on the corrections and modifications implemented in reworked editions, we suggest an evolutionary network for the historical and modern versions or translations of Philosophia Botanica.

  4. Toxocara canis y asma bronquial Toxocara canis and bronchial asthma

    Directory of Open Access Journals (Sweden)

    María de los Ángeles López


    Full Text Available A fin de evaluar la relación entre la infección por Toxocara canis y los síntomas del asma bronquial en niños de una región subtropical con alta prevalencia de toxocariosis, se estudiaron 47 niños con asma y 53 sin asma como grupo control. Se efectuó el examen físico completo, registrándose datos clínicos y epidemiológicos. En los niños con asma se categorizó el patrón de presentación, frecuencia y gravedad de los síntomas con una escala de I a IV. Se investigó la presencia de anticuerpos anti-Toxocara canis en ambos grupos mediante el método de ELISA en fase sólida, empleando antígeno de excreción/secreción y se efectuó dosaje de Ig E total. Los resultados muestran una seropositividad del 55% en el total de los niños, del 57.4% en los niños con asma y del 52.8% en los controles. En los niños con sintomatología más grave (grado II, III y IV hubo un 67.7% de seropositivos, mientras que en los niños con síntomas de grado I la seropositividad fue de 37.5% (p = 0.0470. La infección por T. canis actuaría como un co-factor agravante de los síntomas del asma bronquial.In order to evaluate the association between the infection by Toxocara canis and the symptoms of asthma in children from a subtropical region with high prevalence of toxocariasis, 47 asthmatic children and 53 non-asthmatics as a control group were studied. A complete physical examination was performed and clinical and epidemiological data were registered. In asthmatic children the frequency and severity of symptoms were classified in grades I to IV. The presence of anti-Toxocara canis antibodies in both groups was evaluated employing a solid phase ELISA method with excretion/secretion antigens, and total Ig E was also measured. Results showed a total seropositivity of 55%, 57.4% in children with asthma and 52.8% in the control group. Among asthmatics with severe symptoms (grade II, III and IV, there was a 67.7% of seropositivity while in children with

  5. A Novel Polypeptide from Cervus elaphus Linnaeus

    Institute of Scientific and Technical Information of China (English)

    LiangWENG; QiuLiZHOU; 等


    A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus). The velvet antler polypeptide consists of a single chain of 32 amino acid residues. Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.

  6. Shell repair in the freshwater gastropod Bithynia tentaculata (Linnaeus, 1758)

    NARCIS (Netherlands)

    Cadée, Gerhard C.


    A large sample rich in empty Bithynia tentaculata (Linnaeus, 1758) was collected in a drift-line along Lake IJssel, The Netherlands. Of 400 adult Bithynia shells 62 (15.5%) showed repair of a damaged outer lip, most probably due to failed attacks by predators. The roach Rutilus rutilus (Linnaeus, 17

  7. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available s_NS.png ...

  8. Genetic diversity of Ehrlichia canis in Brazil. (United States)

    Aguiar, D M; Zhang, X; Melo, A L T; Pacheco, T A; Meneses, A M C; Zanutto, M S; Horta, M C; Santarém, V A; Camargo, L M A; McBride, J W; Labruna, M B


    Canine monocytic ehrlichiosis is a highly prevalent disease in Brazil, where the genetic diversity of Ehrlichia canis remains undefined. In this study, we used the TRP36 gene to examine the genetic diversity of E. canis strains from naturally infected dogs residing in five distinct geographic regions in Brazil. E. canis DNA was detected in 82/126 (65%) dogs by dsb-specific PCR and E. canis was isolated in cell culture from 13 dogs. Sequences obtained from dsb genes amplified from the isolates were identical to the US E. canis strain. An extended molecular characterization based on the TRP36 gene identified two major genogroups based on differences among eight isolates. Isolates with tandem repeat amino acid sequence (TEDSVSAPA) identical to the previously reported TRP36 sequence were found in the midwest, northeast and southeast regions of Brazil, and classified into the US genogroup. A novel Brazilian genotype with a different tandem repeat sequence (ASVVPEAE) was also identified in midwest, northern and southern regions. Similarity in the N-terminal sequence of a US genogroup member with the Brazilian genogroup suggested that genomic recombination between the two genogroups may have occurred. Other subtypes within the Brazilian genogroup were also identified using C-terminal amino acid divergence. We identified two distinct major Brazilian genogroups and several subtypes based on analysis of TRP36, and such information will be useful for further genotyping and possible associations with disease severity, understanding of the genetic and antigenic variability of E. canis, and for developing strain-specific vaccines and diagnostic methods based on TRP36.

  9. Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog. (United States)

    Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M


    A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles.

  10. Leaf extracts of Melia azedarach Linnaeus (Sapindales: Meliaceae) act as larvicide against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae) Extratos de folhas de Melia azedarach Linnaeus (Sapindales: Meliaceae) atuam como larvicida de Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae)



    The objective of this study was to compare the larvicidal effect of hydroethanolic extracts of fresh and dry leaves of Melia azedarach Linnaeus (Sapindales: Meliaceae) on Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). All the extracts evaluated induced mortality among the third and fourth instar larvae of Aedes aegypti after 24 and 48 hours of exposure to the products. Although previous studies had demonstrated the action of seeds and fruits of Melia azedarach against the larvae of diff...

  11. Leaf extracts of Melia azedarach Linnaeus (Sapindales: Meliaceae) act as larvicide against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae)



    The objective of this study was to compare the larvicidal effect of hydroethanolic extracts of fresh and dry leaves of Melia azedarach Linnaeus (Sapindales: Meliaceae) on Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). All the extracts evaluated induced mortality among the third and fourth instar larvae of Aedes aegypti after 24 and 48 hours of exposure to the products. Although previous studies had demonstrated the action of seeds and fruits of Melia azedarach against the larvae of diff...

  12. Molecular detection of Ehrlichia canis in dogs in Malaysia. (United States)

    Nazari, Mojgan; Lim, Sue Yee; Watanabe, Mahira; Sharma, Reuben S K; Cheng, Nadzariah A B Y; Watanabe, Malaika


    An epidemiological study of Ehrlichia canis infection in dogs in Peninsular Malaysia was carried out using molecular detection techniques. A total of 500 canine blood samples were collected from veterinary clinics and dog shelters. Molecular screening by polymerase chain reaction (PCR) was performed using genus-specific primers followed by PCR using E. canis species-specific primers. Ten out of 500 dogs were positive for E. canis. A phylogenetic analysis of the E. canis Malaysia strain showed that it was grouped tightly with other E. canis strains from different geographic regions. The present study revealed for the first time, the presence of genetically confirmed E. canis with a prevalence rate of 2.0% in naturally infected dogs in Malaysia.

  13. A Spectroscopic Study of HL Canis Majoris


    Sheets, H. A.; Thorstensen, John R.


    We present optical spectroscopy of the dwarf nova HL Canis Majoris over a span of four years. The observations were made during standstill, outburst, and quiescence. We determine an orbital period of 0.2167867 +/- 0.0000017 days, based on radial velocities determined from H-alpha, H-beta, and He I 5876 emission. We also present equivalent widths of the spectral features in outburst and in quiescence.

  14. Canine vector-borne co-infections: Ehrlichia canis and Hepatozoon canis in the same host monocytes. (United States)

    Baneth, Gad; Harrus, Shimon; Gal, Arnon; Aroch, Itamar


    The protozoon Hepatozoon canis and the rickettsia Ehrlichia canis are tick-borne pathogens, transmitted by Rhipicephalus sanguineus, which cause canine hepatozoonosis and canine monocytic ehrlichiosis, respectively. Co-infection of the same host monocytes with H. canis and E. canis confirmed by molecular characterization of the infecting agents and quantitative assessment of co-infected cells is described for the first time in three naturally-infected dogs. Blood smear evaluation indicated that at least 50% of the leukocytes infected with H. canis gamonts contained E. canis morulae. Co-infection of the same host cell demonstrated in this report suggests that infection with one pathogen may permit or enhance invasion or prolonged cellular survival of the other.

  15. The transmission of Babesia canis to the wild dog Lycaon pictus (Temminck) and black-backed jackal Canis mesomelas Schreber. (United States)

    Van Heerden, J


    Babesia canis was successfully transmitted from the domestic dog to 3 wild dogs Lycaon pictus and 4 black-backed jackals Canis mesomelas. Both wild dogs and black-backed jackals showed no clinical signs or clinical pathological evidence of disease. Trophozoites of Babesia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from both black-backed jackals and wild dogs to the domestic dog.

  16. LINNAEUS: A species name identification system for biomedical literature

    Directory of Open Access Journals (Sweden)

    Nenadic Goran


    Full Text Available Abstract Background The task of recognizing and identifying species names in biomedical literature has recently been regarded as critical for a number of applications in text and data mining, including gene name recognition, species-specific document retrieval, and semantic enrichment of biomedical articles. Results In this paper we describe an open-source species name recognition and normalization software system, LINNAEUS, and evaluate its performance relative to several automatically generated biomedical corpora, as well as a novel corpus of full-text documents manually annotated for species mentions. LINNAEUS uses a dictionary-based approach (implemented as an efficient deterministic finite-state automaton to identify species names and a set of heuristics to resolve ambiguous mentions. When compared against our manually annotated corpus, LINNAEUS performs with 94% recall and 97% precision at the mention level, and 98% recall and 90% precision at the document level. Our system successfully solves the problem of disambiguating uncertain species mentions, with 97% of all mentions in PubMed Central full-text documents resolved to unambiguous NCBI taxonomy identifiers. Conclusions LINNAEUS is an open source, stand-alone software system capable of recognizing and normalizing species name mentions with speed and accuracy, and can therefore be integrated into a range of bioinformatics and text-mining applications. The software and manually annotated corpus can be downloaded freely at

  17. Molecular assessment of the transplacental transmission of Toxoplasma gondii, Neospora caninum, Brucella canis and Ehrlichia canis in dogs. (United States)

    Taques, Isis Indaiara Gonçalves Granjeiro; Barbosa, Tatiane Rodrigues; Martini, Andresa de Cássia; Pitchenin, Letícia Camara; Braga, Ísis Assis; de Melo, Andréia Lima Tomé; Nakazato, Luciano; Dutra, Valéria; de Aguiar, Daniel Moura


    Given the fact that numerous microbial species can be detected in pregnant female dogs, the objective of this study was to assess the transplacental transmission of Brucella canis, Ehrlichia canis, Neospora caninum and Toxoplasma gondii in stillborn puppies. This study involved 41 stillborn puppies, 78.6% of which were positive for T. gondii, 52.4% for N. caninum and 59.5% for B. canis. E. canis was not detected in any of the analyzed puppies. Pregnancy is an important physiological condition for the transmission of infectious agents to puppies and transplacental transmission may be epidemiologically relevant in the spread of these opportunistic agents.

  18. [The prevalence of Babesia canis canis in marsh ticks (Dermacentor reticulatus) in the Saarland]. (United States)

    Beelitz, Pamela; Schumacher, Stefan; Marholdt, Fritz; Pfister, Kurt; Silaghi, Cornelia


    An accumulation of autochthonous cases of canine babesiosis caused by Babesia canis has been registered in a small animal clinic in the Saarland since the beginning of 2006, some cases with fatal outcome. This study aims to contribute to the explanation of strong focal occurrence of infections with B. canis in this region.Therefore, patient owners who had presented their dogs in the years 2006 and 2007 because of babesiosis and who had claimed not having left the Saarland with their dogs at least six months before the outbreak of Babesiosis, were asked for their dog walking habits. Accordingly, a selection often tick collection sites of various landscape structures was made.Tick sampling by flagging the vegetation took place every month from March to December 2008. The collected ticks were identified morphologically. In eight of ten collecting sites a total of 397 adult Dermacentor reticulatus ticks were collected from March to December with the highest frequencies during the months of May, October and November. All collected specimens were examined by genus-specific conventional PCR for the presence of Babesia-DNA. In positive samples, the PCR-products were differentiated by sequencing. ten D. reticulatus (2.5%) ticks examined were found positive for DNA of B. canis canis originating from three out of eight collection sites. Consequently, an endemic distribution of D. reticulatus was confirmed and a natural

  19. Helicobacter canis bacteremia in a renal transplant patient

    NARCIS (Netherlands)

    van der Vusse, M. L.; van Son, W. J.; Ott, A.; Manson, W.


    Here we present a case report of a 41-year-old woman suffering from high fever and bacteremia due to Helicobacter canis, 11months after kidney transplantation. Identification of H.canis was achieved by 16s rDNA sequence analysis of a positive blood culture. The patient was restored fully to health a

  20. Endocarditis caused by Streptococcus canis: an emerging zoonosis? (United States)

    Lacave, Guillaume; Coutard, Aymeric; Troché, Gilles; Augusto, Sandrine; Pons, Stéphanie; Zuber, Benjamin; Laurent, Virginie; Amara, Marlène; Couzon, Brigitte; Bédos, Jean-Pierre; Pangon, Béatrice; Grimaldi, David


    We report a human case of infective endocarditis caused by Streptococcus canis. Identification was carried out from positive blood culture using mass spectrometry and SodA gene sequencing. S. canis related zoonotic invasive infections may have been previously underdiagnosed due to inadequate identification of group G Streptococcus species.


    Directory of Open Access Journals (Sweden)



    Full Text Available The free-ranging urban dog, Canis domesticus (L. carcass decomposition in tropical region, i.e., Takht-i-Bahi, Mardan, Khyber Pakhtunkhwa, Pakistan during 15-25 May 2011 was characterized by 5 stages, i.e., fresh (12 h, bloated (13-48 h, active (49-96 h, advanced (97-144 h and dry (145-265 h and the ecological succession pattern of insect species collected were identified into 11 species of 3 orders. The insect species associated with the carcass of C. domesticus found that the blow flies, Chrysomya rufifacies (Macquart and house fly, Musca domestica (Linnaeus, 1758 were found in the fresh, bloat and active decay stages. However, the blow fly, C. megacephala (Fabricius; flesh fly, Parasarcophaga ruficornis (Meigen and the hornet wasp, Vespa orientalis (Linnaeus were existed in the fresh and bloat stages. Moreover, cheese fly, Piophila casei (Linnaeus was found bloat and active decay stages. Further, the hide beetle, Dermestes maculates (Geer, clown beetle, Hister sp. (Gullenhal; ham beetle, Necrobia rufipes (Fabricus and skin beetle, Trox sp. (Harold completed their life cycle in active decay, advance decay and dry stages. Furthermore, the jummper ant, Myrmecia pilosula (Smith was collected from only fresh stage. The specimens of insect species were collected minimum 0.8% of V. orientalis and maximum 21.3% of 2 species, i.e., C. rufifacies and M. domestica. The temperature, humidity and rainfalls were found affected insect larvae, pupae and adults, and rate of decomposition of C. domesticus. The average temperature, humidity and rainfalls were 35.34±1.54, 38.8% and 3.8 mm, respectively, of 11 experimental days. This research will be helpful for forensic entomologist for a case study of death to investigate of crimes in tropical region of Pakistan.

  2. Individual differences in social and non-social behaviors in domestic dogs (Canis familiaris) during the acquisition, extinction and reacquisition of a problem solving task. (United States)

    Shimabukuro, Carolina; Putrino, Natalia; Helbling, Julia; Tognetti, Sandra; Bentosela, Mariana


    Dogs are able to solve different problems by trial and error learning, but it seems that they cannot understand the means-end connection. Some studies suggest that dogs' performance is influenced by their breed and by the level of familiarity with the person they interact with. In our study, we assess individual differences in both social and non-social responses in a problem-solving task during the acquisition, extinction, and reacquisition phases. In order to investigate the effect of familiarity, in the first experiment, the human present during the task was either a familiar (the dog's owner) or unfamiliar person. In the second experiment, we compared breeds (Retrievers and Shepherds) that had previously shown differences in a communicative task. The results revealed that all groups learned the task and became more efficient in the acquisition trials. These non-social responses diminished during extinction, where an increase in social responses was observed. With regard to individual differences, dogs were more persistent in searching the reward during the second extinction trial when the owner was present (in contrast with a stranger), and also looked longer at the unfamiliar person at the beginning of the acquisition trial. On the other hand, Retrievers showed greater social motivation during reacquisition and Shepherds picked up more bones during the third acquisition trial, thus suggesting a more persistent search of the reward. These findings highlight the relevance of studying different learning schedules as well as individual differences in problem-solving ability so as to improve selection and training techniques.

  3. Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, M.; Sonne, C.; Jakobsen, Jette


    correlated negatively with sigma-dichlorodiphenyldichloroethane (sigma DDT) and and sigma-polybrominated diphenyl ethers (sigma PBDE) for all exposed animals. A negative correlation between kidney -tocopherol and sigma PCB concentrations was observed, whereas two positive significant correlations were...

  4. Effects of long-term dietary exposure to organohalogen contaminants on vitamin and hormonestatus in the Greenland Sledge dog (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, Maja

    lipids and vitamins. The study showed negative correlations between e.g. vitamin A and DDT and PBDE. Also liver vitamin D (25OHD3) in exposed females was signifi cantly lower, although they had received approximately 33% more vitamin D3 than controls. Despite the limited sample size, also testicular...

  5. Shut up and pet me! Domestic dogs (Canis lupus familiaris) prefer petting to vocal praise in concurrent and single-alternative choice procedures. (United States)

    Feuerbacher, Erica N; Wynne, Clive D L


    The nature of the interactions that maintain the social behavior of dogs toward humans and which interactions dogs prefer have not been thoroughly investigated. We focused here on dogs' preference for petting and vocal praise, and the influence that familiarity (owner vs. stranger) has on that preference. We first used concurrent choice to evaluate dogs' preference for petting or vocal praise and measured the initial choice, the time spent with each alternative, and the number of within-session alternations. We assessed dogs' preference for petting or vocal praise in (1) shelter dogs, (2) owned dogs with strangers providing both interactions, and (3) owned dogs with the dog's owner providing the interactions. Across all experimental groups, dogs preferred petting to vocal praise. We next assessed time spent with each alternative when only one alternative was available at a time in shelter dogs and owned dogs (Experiment 2). Shelter dogs were tested with a stranger and owned dogs were tested with their owners providing the interaction. Dogs alternated between petting and vocal praise, vocal praise and no interaction, or received only petting for eight 3-min sessions of each comparison. Both shelter and owned dogs spent significantly longer in proximity to the experimenter when the interaction was petting compared to vocal praise. Vocal praise produced as little proximity-seeking behavior as did no interaction. Additionally, dogs did not show any sign of satiation with petting across all eight sessions. Overall, petting seems to be an important interaction between dogs and humans that might maintain inter-specific social behavior but vocal praise likely has to be specifically conditioned. This article is part of a Special Issue entitled: Canine Behavior.

  6. In vitro hepatic microsomal metabolism of meloxicam in koalas (Phascolarctos cinereus), brushtail possums (Trichosurus vulpecula), ringtail possums (Pseudocheirus peregrinus), rats (Rattus norvegicus) and dogs (Canis lupus familiaris). (United States)

    Kimble, B; Li, K M; Valtchev, P; Higgins, D P; Krockenberger, M B; Govendir, M


    Quantitative and qualitative aspects of in vitro metabolism of the non-steroidal anti-inflammatory drug meloxicam, mediated via hepatic microsomes of specialized foliage (Eucalyptus) eating marsupials (koalas and ringtail possums), a generalized foliage eating marsupial (brushtail possum), rats, and dogs, are described. Using a substrate depletion method, intrinsic hepatic clearance (in vitro Clint) was determined. Significantly, rates of oxidative transformation of meloxicam, likely mediated via cytochromes P450 (CYP), were higher in marsupials compared to rats or dogs. The rank order of apparent in vitro Clint was brushtail possums (n=3) (mean: 394μL/min/mg protein), >koalas (n=6) (50), >ringtail possums (n=2) (36) (with no significant difference between koalas and ringtail possums), >pooled rats (3.2)>pooled dogs (in which the rate of depletion, as calculated by the ratio of the substrate remaining was meloxicam, at a first-order rate constant, 5-hydroxymethyl metabolite (M1) was identified in the brushtail possums and the rat as the major metabolite. However, multiple hydroxyl metabolites were observed in the koala (M1, M2, and M3) and the ringtail possum (M1 and M3) indicating that these specialized foliage-eating marsupials have diverse oxidation capacity to metabolize meloxicam. Using a well-stirred model, the apparent in vitro Clint of meloxicam for koalas and the rat was further scaled to compare with published in vivo Cl. The closest in vivo Cl prediction from in vitro data of koalas was demonstrated with scaled hepatic Cl(total) (average fold error=1.9) excluding unbound fractions in the blood and microsome values; whereas for rats, the in-vitro scaled hepatic Cl fu(blood, mic), corrected with unbound fractions in the blood and microsome values, provided the best prediction (fold error=1.86). This study indicates that eutherians such as rats or dogs serve as inadequate models for dosage extrapolation of this drug to marsupials due to differences in hepatic turnover rate. Furthermore, as in vivo Cl is one of the pharmacokinetic indexes for determining therapeutic drug dosages, this study demonstrates the utility of in vitro to in vivo scaling as an alternative prediction method of drug Cl in koalas.


    Directory of Open Access Journals (Sweden)

    Denise de Mello Bobany


    Full Text Available The present work aimed to investigate, in vitro, the efficacyof the honey of Tetragonisca angustula, against the microorganismsfound in the auditory canal inflammations of dogs. The sampleswere collected through a sterile swab of secretion of the auditorycanal of dogs with clinical otitis. The material was fixed in glassslide by performing the smear, Gram stained, and submittedto microscopic identification. The samples were inoculated inTryptone Soya Broth culture media and incubated at 37°C for24 hours. After verifying that there was growth, the sampleswere cultured in Petri’s plates containing Chapman, Levine andMueller-Hinton, and incubated at 37°C for 24 hours. Filter paperdiscs were adapted, sterilized in autoclave and embedded in honeyfor the antibiogram. The disks impregnated with honey wereplaced in Petri’s plates containing the contamined material andagain incubated at 37°C for 24 hours. This experiment verified theformation of inhibition halos in the antibiograma with the honey ofthe Tetragonisca angustula, showing to be effective in the controlof Staphylococcus sp, Bacillus sp and yeasts.

  8. A Review of Domestic Dogs' ("Canis Familiaris") Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs (United States)

    Udell, Monique A. R.; Wynne, C. D. L.


    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are…

  9. Distribución de los ectoparásitos de Canis lupus familiaris L. (Carnivora: Canidae) de Panamá


    Bermúdez, Sergio; Miranda, Roberto


    Objetivo. Determinar la distribución de ectoparásitos de perros en Panamá. Materiales y métodos. Se examinaron 720 individuos en 57 comunidades. Resultados. Los resultados demostraron que el 84% de los perros presentaron al menos una especie de ectoparásito. Los perros de tierras bajas mostraron un mayor porcentaje de parasitismo y mayor biodiversidad de parásitos que los animales de tierras altas. Se encontraron siete especies de garrapatas, cuatro de pulgas, dos de piojos y una de mosca. La...

  10. Mira lo que te muestro: ¿Comunicación referencial entre perros domésticos (canis familiaris) y humanos?



    Históricamente, la comunicación referencial fue considerada como exclusivamente humana. No obstante, recientemente se observó que los animales también pueden referirse hacia objetos externos. Para los perros domésticos, las personas proveen el acceso a los recursos valiosos, por lo que una adecuada comunicación con las mismas resulta fundamental. En este contexto, la comprensión y producción de señales comunicativas visuales cobran especial relevancia. Las evidencias revisadas indican que los...

  11. Mira lo que te muestro: ¿Comunicación referencial entre perros domésticos (canis familiaris y humanos?

    Directory of Open Access Journals (Sweden)



    Full Text Available Históricamente, la comunicación referencial fue considerada como exclusivamente humana. No obstante, recientemente se observó que los animales también pueden referirse hacia objetos externos. Para los perros domésticos, las personas proveen el acceso a los recursos valiosos, por lo que una adecuada comunicación con las mismas resulta fundamental. En este contexto, la comprensión y producción de señales comunicativas visuales cobran especial relevancia. Las evidencias revisadas indican que los perros detectan el estado atencional humano, siguen la orientación de la cabeza para hallar comida oculta y dirigen la atención del humano hacia un objeto fuera de su alcance, mediante la alternancia de la mirada. En función de ello, se sugiere que los perros se comunican de manera referencial con las personas. Sin embargo, esto no necesariamente implica que comprendan al otro como un agente intencional. Se discuten los posibles mecanismos involucrados así como las hipótesis acerca del origen de dichas capacidades.

  12. Trypanosoma caninum n. sp. (Protozoa: Kinetoplastida) isolated from intact skin of a domestic dog ( Canis familiaris) captured in Rio de Janeiro, Brazil. (United States)

    Madeira, M F; Sousa, M A; Barros, J H S; Figueiredo, F B; Fagundes, A; Schubach, A; DE Paula, C C; Faissal, B N S; Fonseca, T S; Thoma, H K; Marzochi, M C A


    An unknown Trypanosoma species was isolated from an axenic culture of intact skin from a domestic dog captured in Rio de Janeiro, Brazil, which was co-infected with Leishmania (Viannia) braziliensis. Giemsa-stained smears of cultures grown in different media revealed the presence of epimastigotes, trypomastigotes, spheromastigotes, transitional stages, and dividing forms (epimastigotes or spheromastigotes). The highest frequency of trypomastigotes was observed in RPMI (15.2%) and DMEM (9.2%) media containing 5% FCS, with a mean length of these forms of 43.0 and 36.0 mum, respectively. Molecular analysis by sequential application of PCR assays indicated that this trypanosome differs from Trypanosoma cruzi and T. rangeli when specific primers were applied. On the other hand, a PCR strategy targeted to the D7 domain of 24salpha rDNA, using primers D75/D76, amplified products of about 250 bp in that isolate (stock A-27), different from the amplification products obtained with T. cruzi and T. rangeli. This organism differs from T. cruzi mainly by the size of its trypomastigote forms and kinetoplasts and the absence of infectivity for macrophages and triatomine bugs. It is also morphologically distinct from salivarian trypanosomes reported in Brazil. Isoenzyme analysis at 8 loci demonstrated a very peculiar banding pattern clearly distinct from those of T. rangeli and T. cruzi. We conclude that this isolate is a new Trypanosoma species. The name T. caninum is suggested.

  13. Síndrome de Kartagener em um cão (Canis lupus familiaris da raça Cocker Spaniel Inglês

    Directory of Open Access Journals (Sweden)

    P. Souza Junior


    Full Text Available Kartagener is syndrome is a rare disorder described in dogs determined by the triad situs inversus totalis, chronic sinusitis, and bronchial disease. The clinical signs of chronic respiratory and other less common presentations (such as hydrocephalus and subfertility are due to a concomitant ciliary dysfunction. This article describes the clinical, radiographic, and computed tomography findings and treatment in a dog affected by Kartagener is syndrome since early months of life. This is the first case report of this syndrome in a domestic dog in Brazil and the only known scientific report in the English Cocker Spaniel.


    Directory of Open Access Journals (Sweden)

    Millena Vidal Freitas


    Full Text Available Cardiac markers, especially CK-MB mass and cTnI, have an essential role in both human and veterinary clinical and surgical cardiology, allowing a more precise and accurate diagnosis in myocardial lesions. The goal of this work was to measure these cardiac markers in veterinary medicine, improve their use and provide information about these laboratory methods that allow non-invasive health monitoring of the myocardial cell. Parameters quantification was obtained from sera of healthy dogs examined during routine procedures at the Small Animal Veterinary Hospital of Universidade Estadual do Norte Fluminense Darcy Ribeiro. The human chemiluminescence essay turbo kit (IMMULITE Turbo, Siemens ® test proved to be effective in canine species for both CK-MB mass and cTnI. In addition, the values found for CK-MB will significantly contribute to clinical routine or experimental work with dogs.

  15. Estructuración y función del miocardio ventricular canino (Canis lupus familiaris): banda miocárdica ventricular


    De Lavalle, Rodrigo; Rendón, Luis


    Introducción: actualmente se está presenciando la aparición de nuevas herramientas de diagnóstico y terapias para enfermedades del corazón, pero sin consenso científico serio sobre los interrogantes sobre la estructura normal del corazón y su función. La banda helicoidal miocárdica ventricular de Torrent-Guasp es el nuevo y revolucionario concepto en la comprensión global, en tres dimensiones de la arquitectura funcional del miocardio ventricular. Este concepto define la arquitectura de tejid...


    Directory of Open Access Journals (Sweden)

    Eduardo Negri Mueller


    Full Text Available We evaluated the help effect of ceruminolytic in ceruminous external otitis in dog’s ears. Dogs with bilateral ceruminous external otitis, whose ears were evaluated by palpation, inspection, otoscopy and fungal and bacterial culture were studied. For the treatment, carried out twice a day during 15 days, the animals were divided into two groups, A and B. The animals in group A were treated with ceruminolytic and otological solution, containing, respectively, salicylic acid and aminoglycoside, while the animals in group B were treated only with otological solution. Clinical and microbiologic evaluations were performed on 0 and 15 days of treatment. Twenty dogs (n=40 ears, with at least erythema in the otoscopy and moderate to intense ceruminous exsudate. Besides these, we observed more erythema (n=16 in both groups and exsudate in the acoustic conch (n=14 and n=11, respectively, groups A and B and itch (n=13 and n=11, respectively, groups A and B. On the 15th day, we observed reduction of all clinical signals, except stenosis, which did not change in any of the groups, and pain, which increased in group A. The microorganisms Malassezia pachydermatis e Staphylococcus sp. reduced in treatment B with statistical significance. Bacteria were more sensitive to gentamicin. The use of ceruminolytic associated to otological solution reduced the external ottis clinical signals, mainly exsudate and smell in the acoustic conch and the quantity of cerumen in the otoscopy, without interfering in the microorganisms reduction.

  17. Antibody response to Hepatozoon canis in experimentally infected dogs. (United States)

    Baneth, G; Shkap, V; Samish, M; Pipano, E; Savitsky, I


    Canine hepatozoonosis is a disease caused by the tick-borne protozoan Hepatozoon canis. Five puppies were inoculated by ingestion of Rhipicephalus sanguineus ticks experimentally infected with H. canis, and all became infected with H. canis: gametocytes were detected in blood smears from four dogs and schizonts were observed in the spleen and bone marrow of the fifth. Antibodies reactive with H. canis gametocytes were detected by the indirect fluorescent antibody test (IFA), with IgM detected initially in all dogs 16 to 39 days post infection (PI) and IgG 22 to 43 days PI. The presence of gametocytes was first observed within peripheral blood neutrophils in Giemsa-stained blood smears between days 28 and 43 PI. Gametocyte-reactive antibodies were detected before the appearance of blood gametocytes in three of the four parasitemic dogs and also in a dog with no observed parasitemia. The detection of serum antibodies prior to the detection of blood gametocytes, or without apparent parasitemia, suggests that antibodies reactive with gametocytes may be formed against earlier forms of the parasite developing in the parenchymal tissues. Sera of dogs experimentally infected with Babesia canis, Babesia gibsoni and Ehrlichia canis exhibited no reactivity when tested with H. canis antigen. Additionally, sera positive for H. canis were not reactive with antigens of Toxoplasma gondii, Neospora caninum, Leishmania donovani and E. canis. In conclusion, incoculation of dogs with ticks infected with H. canis results in production of antibodies reactive with peripheral blood gametocytes. Detection of IgG titres would be beneficial for the diagnosis of progressive infections with undetectable parasitemia, for seroprevalence studies, and as an adjunct to IgM titres in early infections.

  18. Multiplex real-time qPCR for the detection of Ehrlichia canis and Babesia canis vogeli. (United States)

    Peleg, Ofer; Baneth, Gad; Eyal, Osnat; Inbar, Jacob; Harrus, Shimon


    Ehrlichia canis and Babesia canis vogeli are two tick-borne canine pathogens with a worldwide importance. Both pathogens are transmitted by Rhipicephalus sanguineus, the brown dog tick, which has an increasing global distribution. A multiplex quantitative real-time PCR (qPCR) assay for the simultaneous detection of the tick-borne pathogens E. canis and B. canis vogeli was developed using dual-labeled probes. The target genes were the 16S rRNA of E. canis and the heat shock protein 70 (hsp70) of B. canis vogeli. The canine beta actin (ACTB) gene was used as an internal control gene. The assay was conducted without using any pre-amplification steps such as nested reactions. The sensitivity of each reaction in the multiplex qPCR assay was tested in the presence of high template concentrations of the other amplified genes in the same tube and in the presence of canine DNA. The detection threshold of the multiplex assay was 1-10 copies/μl in all channels and the amplifications of the B. canis hsp70 and ACTB were not affected by the other simultaneous reactions, while minor interference was observed in the amplification of the E. canis 16S rRNA gene. This assay would be useful for diagnostic laboratories and may save time, labor and costs.

  19. Nematodes in the mallard (Anas platyrhynchos Linnaeus, 1758) and the common goldeneye (Bucephala clangula Linnaeus, 1758) (Anatidae) from Northern Europe. (United States)

    Lebedeva, Daria I; Yakovleva, Galina A; Ieshko, Evgeny P


    There are first data on nematodes of Anas platyrhynchos Linnaeus, 1758 (mallard) and Bucephala clangula Linnaeus, 1758 (common goldeneye) from Northern Europe (Ladoga Lake region). The ducks were found to be infected with nine nematode species. A. platyrhynchos hosted eight nematode species and B. clangula was host to four nematode species. All species except Capillaria anatis were found in the region for the first time. Nematodes Amidostomum acutum, Streptocara crassicauda, and Tetrameres fissispina parasitized on both hosts and were the most abundant. The biggest number of parasites revealed was biohelminths with a direct life cycle.

  20. Leaf extracts of Melia azedarach Linnaeus (Sapindales: Meliaceae) act as larvicide against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). (United States)

    Prophiro, Josiane Somariva; Rossi, Juliana Chedid Nogared; Pedroso, Murilo Fernandes; Kanis, Luiz Alberto; Silva, Onilda Santos


    The objective of this study was to compare the larvicidal effect of hydroethanolic extracts of fresh and dry leaves of Melia azedarach Linnaeus (Sapindales: Meliaceae) on Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). All the extracts evaluated induced mortality among the third and fourth instar larvae of Aedes aegypti after 24 and 48 hours of exposure to the products. Although previous studies had demonstrated the action of seeds and fruits of Melia azedarach against the larvae of different Aedes aegypti populations, the present report is the first to show the larvicidal effect of the fresh and dry leaves of this plant.

  1. Toxocara canis and the allergic process (United States)

    Zaia, Mauricio Grecco; de Oliveira, Sandra Regina Pereira; de Castro, Cynthia Aparecida; Soares, Edson Garcia; Afonso, Ana; Monnazzi, Luis Gustavo S; Peitl, Oscar; Faccioli, Lúcia Helena; Anibal, Fernanda de Freitas


    The protective effect of infectious agents against allergic reactions has been thoroughly investigated. Current studies have demonstrated the ability of some helminths to modulate the immune response of infected hosts. The objective of the present study was to investigate the relationship between Toxocara canis infection and the development of an allergic response in mice immunised with ovalbumin (OVA). We determined the total and differential blood and bronchoalveolar lavage fluid cells using BALB/c mice as a model. To this end, the levels of interleukin (IL)-4, IL-5 and IL-10 and anti-OVA-IgE were measured using an ELISA. The inflammatory process in the lungs was observed using histology slides stained with haematoxylin and eosin. The results showed an increase in the total number of leukocytes and eosinophils in the blood of infected and immunised animals at 18 days after infection. We observed a slight lymphocytic inflammatory infiltrate in the portal space in all infected mice. Anti-OVA-IgE levels were detected in smaller proportions in the plasma of immunised and infected mice compared with mice that were only infected. Therefore, we concluded that T. canis potentiates inflammation in the lungs in response to OVA, although anti-OVA-IgE levels suggest a potential reduction of the inflammatory process through this mechanism. PMID:26517650

  2. Toxocara canis and the allergic process

    Directory of Open Access Journals (Sweden)

    Mauricio Grecco Zaia


    Full Text Available The protective effect of infectious agents against allergic reactions has been thoroughly investigated. Current studies have demonstrated the ability of some helminths to modulate the immune response of infected hosts. The objective of the present study was to investigate the relationship between Toxocara canis infection and the development of an allergic response in mice immunised with ovalbumin (OVA. We determined the total and differential blood and bronchoalveolar lavage fluid cells using BALB/c mice as a model. To this end, the levels of interleukin (IL-4, IL-5 and IL-10 and anti-OVA-IgE were measured using an ELISA. The inflammatory process in the lungs was observed using histology slides stained with haematoxylin and eosin. The results showed an increase in the total number of leukocytes and eosinophils in the blood of infected and immunised animals at 18 days after infection. We observed a slight lymphocytic inflammatory infiltrate in the portal space in all infected mice. Anti-OVA-IgE levels were detected in smaller proportions in the plasma of immunised and infected mice compared with mice that were only infected. Therefore, we concluded that T. canis potentiates inflammation in the lungs in response to OVA, although anti-OVA-IgE levels suggest a potential reduction of the inflammatory process through this mechanism.

  3. Parasites of Periplaneta americana linnaeus "domestic cockroach" from Ica.

    Directory of Open Access Journals (Sweden)

    Mary Fernádez B.


    Full Text Available 244 specimens of Periplaneta americana Linnaeus from 13 localities of Ica were studied. Nematodes and protozoa were identified. They are Lophomonas blattarum, Leptomonas sp., Leidynema appendiculatum and Hammerschmidtiella diesingi. Also, parasites of man were found, three of which are pathogenic: Giardia lamblia, Blastocystis hominis and Cryptosporidium sp.

  4. Leaf extracts of Melia azedarach Linnaeus (Sapindales: Meliaceae act as larvicide against Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae Extratos de folhas de Melia azedarach Linnaeus (Sapindales: Meliaceae atuam como larvicida de Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Josiane Somariva Prophiro


    Full Text Available The objective of this study was to compare the larvicidal effect of hydroethanolic extracts of fresh and dry leaves of Melia azedarach Linnaeus (Sapindales: Meliaceae on Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae. All the extracts evaluated induced mortality among the third and fourth instar larvae of Aedes aegypti after 24 and 48 hours of exposure to the products. Although previous studies had demonstrated the action of seeds and fruits of Melia azedarach against the larvae of different Aedes aegypti populations, the present report is the first to show the larvicidal effect of the fresh and dry leaves of this plant.O objetivo deste trabalho foi comparar o efeito larvicida de extratos hidro-etanólicos de folhas verdes e secas de Melia azedarach Linnaeus (Sapindales: Meliaceae em Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae. Todos os extratos avaliados induziram mortalidade em larvas de 3º e 4º estágios de Aedes aegypti, após 24 e 48 horas de exposição aos produtos. Embora estudos prévios tenham demonstrado a ação de sementes e frutos de Melia azedarach em larvas de diferentes populações de Aedes aegypti, o presente estudo é o primeiro a reportar o efeito larvicida de folhas verdes e secas desta planta.

  5. New localities of Dermacentor reticulatus tick (vector of Babesia canis canis) in central and eastern Poland. (United States)

    Zygner, W; Górski, P; Wedrychowicz, H


    Dermacentor reticulatus tick is a vector and final host of Babesia canis canis, protozoan parasite of the dog. In Poland and other European countries, endemic regions for canine babesiosis caused by B. canis canis are the same as endemic regions for D. reticulatus. In many of these regions, canine babesiosis is the most prevalent tick-borne disease in dogs. In Europe, increasing range of geographical distribution of D. reticulatus is observed. A consequence of this fact may be increasing range of canine babesiosis. D. reticulatus is one of the most common ticks occurring in Poland, however, it occurs mainly in the north-eastern and eastern part of the country, and there are many areas in which this species has not been reported yet. In this study, D. reticulatus ticks were collected from March 2007 to November 2008 in central and eastern Mazowsze region, and in some localities in Białystok and Lublin regions. Twenty four new sites for D. reticulatus, mainly in central and eastern regions of Mazowsze Province have been found. 18 localities are placed on banks of the fishing ponds or in river valleys and 6 are forests borders or barren lands and meadows, not situated near rivers or other water reservoirs. All tick-rich sites are localized in river valleys or on pond banks. However, statistical analysis showed that there were no differences in the density of ticks between groups of areas. These results show that the occurrence of D. reticulatus in newly detected areas has became endemic. Probably woodless, unregulated river valleys are important migration tracts for this species of tick and enable them to penetrate new territories. It seems likely that geographical range of D. reticulatus is widening from east to west of Poland what can induce an increase in the number of canine babesiosis cases in areas non-endemic for B. canis canis and its vector. Climate change may be also partially responsible for earlier beginning of tick's seasonal activity as well as for

  6. Ehrlichia canis in Rhipicephalus sanguineus ticks in the Ivory Coast. (United States)

    Socolovschi, Cristina; Gomez, José; Marié, Jean-Lou; Davoust, Bernard; Guigal, Pierre-Michel; Raoult, Didier; Parola, Philippe


    Canine monocytic ehrlichiosis caused by Ehrlichia canis is distributed globally, but its prevalence in Africa is poorly known. In the study reported herein, 27% of Rhipicephalus sanguineus ticks collected from watchdogs in Abidjan, Ivory Coast, were positive for E. canis using quantitative real-time PCR. A new molecular strategy is proposed that can be used not only for epidemiological study, but also for the diagnosis of canine monocytic ehrlichiosis. Our findings show for the first time the presence of E. canis using molecular tools in the Ivory Coast, providing direct evidence for the presence of this pathogen.

  7. Diagnosis of canine monocytotropic ehrlichiosis (Ehrlichia canis): an overview. (United States)

    Harrus, Shimon; Waner, Trevor


    Canine monocytotropic ehrlichiosis (CME), caused by the rickettsia Ehrlichia canis, an important canine disease with a worldwide distribution. Diagnosis of the disease can be challenging due to its different phases and multiple clinical manifestations. CME should be suspected when a compatible history (living in or traveling to an endemic region, previous tick exposure), typical clinical signs and characteristic hematological and biochemical abnormalities are present. Traditional diagnostic techniques including hematology, cytology, serology and isolation are valuable diagnostic tools for CME, however a definitive diagnosis of E. canis infection requires molecular techniques. This article reviews the current literature covering the diagnosis of infection caused by E. canis.

  8. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani


    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  9. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog


    Tsachev Ilia; Simeonov R.; Petrov Vladimir


    A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  10. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog

    Directory of Open Access Journals (Sweden)

    Tsachev Ilia


    Full Text Available A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  11. Genetic blueprint of the zoonotic pathogen Toxocara canis

    DEFF Research Database (Denmark)

    Zhu, Xing-Quan; Korhonen, Pasi K.; Cai, Huimin;


    Toxocara canis is a zoonotic parasite of major socioeconomic importance worldwide. In humans, this nematode causes disease (toxocariasis) mainly in the under-privileged communities in developed and developing countries. Although relatively well studied from clinical and epidemiological perspectives...

  12. Streptococcus canis arthritis in a cat breeding colony. (United States)

    Iglauer, F; Kunstýr, I; Mörstedt, R; Farouq, H; Wullenweber, M; Damsch, S


    This is the first description of a pathologic condition--arthritis in cats affecting mainly one joint, i.e. monarthritis--caused by Streptococcus canis (S. canis), of the Lancefield serologic group G. Six cases were recorded in a closed cat breeding colony during a 6 month period in 1988, and one additional case in 1990. Therapy with penicillin and streptomycin led to full recovery in four of six cases. The bacterium had been detected from different purulent processes sporadically--including one case of purulent arthritis in 1982--as a nosocomial infection since 1980, the year the breeding colony was established. A possible genetic predisposition (high inbreeding) may have contributed to the accumulation of the six cases in 1988. Although S. canis was isolated in mouse, rat, rabbit and dog, cat and man seem to be more frequently affected. There are some similarities between S. canis-arthritis in cat and man.




    Lo studio si prefigge di indagare, mediante immunofluorescenza indiretta e citometria a flusso, se la presenza di anticorpi anti-piastrine può essere associata all’occorrenza di trombocitopenia immunomediata in cani naturalmente infetti da Leishmania infantum.

  14. Molecular characterization of Ehrlichia canis infecting dogs, Buenos Aires. (United States)

    Cicuttin, Gabriel L; De Salvo, María N; Gury Dohmen, Federico E


    Canine monocytic ehrlichiosis (CME) is a worldwide potentially fatal tick-borne rickettsial disease of dogs caused by Ehrlichia canis and transmitted by Rhipicephalus sanguineus sensu lato. CME diagnosis includes indirect (serology) and direct (e.g. blood smears and PCR) methods. PCR is more sensitive and specific than direct microscopic examination and positive PCR results confirm infection, whereas positive serologic test results only confirm exposure. The aim of the present study was to perform a molecular characterization of E. canis from canine samples of the Metropolitan Area of Buenos Aires. We studied 223 blood samples of dogs submitted to our institute for CME diagnoses. The samples were initially screened for Anaplasmataceae family by PCR, resulting in 30 positive dogs (13.4%). Subsequently, positive DNAs were analyzed by nested PCR 16S rRNA specific for E. canis or Anaplasma platys, resulting in 15 (6.7%) and 16 (7.2%) positive dogs, respectively. For molecular characterization, samples positive for E. canis were subjected to amplification of a fragment of the dsb and p28 genes. The nucleotide sequences obtained for the dsb fragment resulted in 100% identity with others E. canis found in dogs from different regions of worldwide. The nucleotide sequences obtained for p28 gene resulted in 100% of identity with each other and closely with E. canis str. Jaboticabal (Brazil). Identity with others sequences of E. canis ranged from 76.9 to 79.7%. The occurrence of canine cases molecularly confirmed in Metropolitan Area of Buenos Aires highlights the need for more studies in order to understand epidemiological factors associated with CME, especially the disease transmission dynamic in South America given the existence of two lineages of R. sanguineus sensu lato with different vectorial capacity for transmission of E. canis.

  15. The Role of Anthropogenic Influence on Biological Signal Field (BSF Characteristics of the Wolf, Canis lupus lupus (Canidae, Carnivora

    Directory of Open Access Journals (Sweden)

    Shkvyria M. G.


    Full Text Available The main goal of the current research includes studying the biological signal field (BSF characteristics of the wolf (Canis lupus lupus Linnaeus, 1758 at different values of anthropogenic load on territories with conservation (Białowieża National park (Poland and hunting status of the species (Chornobyl Exclusion Zone (Ukraine. The research in Białowieża Primeval Forest was conducted in two stages: study of the BSF characteristics of the wolf and finding correlation between data acquired from Ukraine (the first stage, and over-time study of intensity of the biological signal field (the second stage. In result of the first stage, there was no significant dependence on the characteristics of the territory and the differences between the behavior of wolves in the Białowieża Primeval Forest (conservation status of the species and the Exclusion Zone (game status. During the second stage it was determined that provided variance of the intensity between territory groups was insufficient, the degree of significance to animals of area categories varied with the stages of the pack’s life. It was found that the main factors which govern the character of wolf activity are not the level of the anthropic load and hunting pressure, but periods of the life cycle and spatial structure of groups.

  16. Tejón europeo Meles meles (Linnaeus, 1758)



    Salgado I (2014) Tejón europeo Meles meles (Linnaeus, 1758). En: Calzada J, Clavero M, Fernández A (eds). Guía virtual de los indicios de los mamíferos de la Península Ibérica, Islas Baleares y Canarias. Sociedad Española para la Conservación y Estudio de los Mamíferos (SECEM). http://www.

  17. Molecular detection of Ehrlichia canis, Anaplasma bovis, Anaplasma platys, Candidatus Midichloria mitochondrii and Babesia canis vogeli in ticks from Israel. (United States)

    Harrus, S; Perlman-Avrahami, A; Mumcuoglu, K Y; Morick, D; Eyal, O; Baneth, G


    : Ticks are vectors of important pathogens of human and animals. Therefore, their microbial carriage capacity is constantly being investigated. The aim of this study was to characterize the diversity of domestic animal pathogens in ticks collected from vegetation and the ground, from different parts of Israel. Non-engorged questing adult ticks were collected from 13 localities. A total of 1196 ticks in 131 pools-83 pools of Rhipicephalus turanicus and 48 of Rhipicephalus sanguineus (with two to ten ticks per pool)-were included in this study. In addition, 13 single free-roaming Hyalomma spp. ticks were collected. Screening by molecular techniques revealed the presence of Ehrlichia canis, Anaplasma platys, Anaplasma bovis and Babesia canis vogeli DNA in R. turanicus ticks. E. canis, A. bovis, B. canis vogeli and Candidatus Midichloria mitochondrii DNA sequences were detected in R. sanguineus ticks. Candidatus Midichloria mitochondrii DNA was also detected in Hyalomma spp. ticks. Neither Hepatozoon spp. nor Bartonella spp. DNA was detected in any of the ticks examined. This study describes the first detection of E. canis in the tick R. turanicus, which may serve as a vector of this canine pathogen; E. canis was the most common pathogen detected in the collected questing ticks. It also describes the first detection of A. bovis and Candidatus Midichloria mitochondrii in Israel. To the best of the author's knowledge, this is the first report describing the detection of DNA of the latter two pathogens in R. sanguineus, and of A. bovis in R. turanicus.

  18. Single nucleotide polymorphism (SNP) variation of wolves (Canis lupus) in Southeast Alaska and comparison with wolves, dogs, and coyotes in North America. (United States)

    Cronin, Matthew A; Cánovas, Angela; Bannasch, Danika L; Oberbauer, Anita M; Medrano, Juan F


    There is considerable interest in the genetics of wolves (Canis lupus) because of their close relationship to domestic dogs (C. familiaris) and the need for informed conservation and management. This includes wolf populations in Southeast Alaska for which we determined genotypes of 305 wolves at 173662 single nucleotide polymorphism (SNP) loci. After removal of invariant and linked SNP, 123801 SNP were used to quantify genetic differentiation of wolves in Southeast Alaska and wolves, coyotes (C. latrans), and dogs from other areas in North America. There is differentiation of SNP allele frequencies between the species (wolves, coyotes, and dogs), although differentiation is relatively low between some wolf and coyote populations. There are varying levels of differentiation among populations of wolves, including low differentiation of wolves in interior Alaska, British Columbia, and the northern US Rocky Mountains. There is considerable differentiation of SNP allele frequencies of wolves in Southeast Alaska from wolves in other areas. However, wolves in Southeast Alaska are not a genetically homogeneous group and there are comparable levels of genetic differentiation among areas within Southeast Alaska and between Southeast Alaska and other geographic areas. SNP variation and other genetic data are discussed regarding taxonomy and management.


    Directory of Open Access Journals (Sweden)



    Full Text Available Twenty Patients, a family, their neighbors, and friends; with lesions suspicious of Ringworm infection, were referred to us within a period of 80 days. The Source of infection was found to be 3 persian Cats (a mother and two kittens living with the family. The cats had multiple lesions around their nose and on abdomen which reveales the Prevalence of cutaneous fungi both on direct microscopic examination and culture. Sixteen of the 20 pateints examined 80% were positive both in Microscopic examination and culture. The rest were negative because they have used topical and systemic antifungal drugs. Of these positives 12(75% had Tinea corporis and 4(25% had Tinea capitis. The ege range of the patients with Tinea corporis was 2-9 years and for those with Tinea corpois was 5- 48 years. The causative agent in this epidemic was Microsporum canis which was most probably transmitted from the cats to this family, their friends and neighbors.

  20. Trophic cascades linking wolves (Canis lupus), coyotes (Canis latrans), and small mammals (United States)

    Miller, B.J.; Harlow, H.J.; Harlow, T.S.; Biggins, D.; Ripple, W.J.


    When large carnivores are extirpated from ecosystems that evolved with apex predators, these systems can change at the herbivore and plant trophic levels. Such changes across trophic levels are called cascading effects and they are very important to conservation. Studies on the effects of reintroduced wolves in Yellowstone National Park have examined the interaction pathway of wolves (Canis lupus L., 1758) to ungulates to plants. This study examines the interaction effects of wolves to coyotes to rodents (reversing mesopredator release in the absence of wolves). Coyotes (Canis latrans Say, 1823) generally avoided areas near a wolf den. However, when in the proximity of a den, they used woody habitats (pine or sage) compared with herbaceous habitats (grass or forb or sedge)- when they were away from the wolf den. Our data suggested a significant increase in rodent numbers, particularly voles (genus Microtus Schrank, 1798), during the 3-year study on plots that were within 3 km of the wolf den, but we did not detect a significant change in rodent numbers over time for more distant plots. Predation by coyotes may have depressed numbers of small mammals in areas away from the wolf den. These factors indicate a top-down effect by wolves on coyotes and subsequently on the rodents of the area. Restoration of wolves could be a powerful tool for regulating predation at lower trophic levels.

  1. Toxocara canis y Síndrome Larva Migrans Visceralis (Toxocara canis and Syndrome Larva Migrans Visceralis

    Directory of Open Access Journals (Sweden)

    Dr. MV Pedro De la Fé Rodríguez


    Full Text Available RESUMEN.- Se abordaron las principales características biológicas y ecológicas de Toxocara canis, resaltando su clasificación taxonómica, morfología y relación con el medio ambiente. Sobre la interacción de este parásito con los hospedadores definitivos (cánidos y parténicos (humanos se consideraron su ciclo biológico, patogenia, características clínicas, diagnóstico, epidemiología, control y pronóstico. ABSTRACT.- In the present article was broached the main biological and ecological characteristics of Toxocara canis, taking in consideration its taxonomic classification, morphology and relationship with the environment. On the aspect concerning to the interaction of this parasite with the definitive host (canids and the paratenic host (humans they were considered its biological cycle, pathogeny, clinical symptoms, diagnosis, epidemiology, control and prognosis.

  2. Estudo comparativo entre toracotomia intercostal, esternotomia mediana parcial e total em cães sadios (Canis familiaris : avaliação clínica e hemogasométrica Comparative study among intercostal thoracotomy, parcial median sternotomy and total in health dogs (Canis familiaris: clinical and hemogasometric avaliation

    Directory of Open Access Journals (Sweden)

    Marcus Paulo de Souza Ferreira Pinto


    Full Text Available O objetivo deste experimento foi comparar as alterações hemogasométricas e as possíveis complicações trans e pós-operatórias encontradas na toracotomia intercostal direita, esternotomia mediana parcial e esternotomia mediana total, determinando qual das técnicas produziu menor grau de intercorrências. Foram utilizados dezoito cães, sem raça definida, adultos, machos e fêmeas, com peso entre quinze e vinte quilos e em condições de saúde julgadas satisfatórias para o experimento. Os cães foram divididos em três grupos de seis animais, de acordo com a técnica cirúrgica empregada: GRUPO A -animais submetidos à toracotomia intercostal direita; GRUPO B - animais submetidos à esternotomia mediana parcial e GRUPO C - animais submetidos à esternotomia mediana total. Os cães foram avaliados quanto às possíveis intercorrências intra e pós-operatórias, alterações das freqüências cardíaca e respiratória, temperatura, oxigenação, ventilação, equilíbrio ácido-básico e dor. Durante sete dias foi feita avaliação da ferida cirúrgica, não observando-se intercorrências com cicatrização, infecção, presença de fístulas e deiscência de sutura. Os resultados obtidos foram analisados estatisticamente. Concluiu-se que as três técnicas foram exeqüíveis em cães, pois permitiram recuperação pós-operatória satisfatória e comparativamente não foram verificadas alterações significativas quanto ao pH, gases sangüíneos e dor.The experiment’s objective was to compare hemogasometric changes and possible complications during and after Right Intercostal Thoracotomy, Partial Median Sternotomy and Total Median Sternotomy; determining which technique(s would produce less problems. Eighteen dogs were used, without any breeding, all adults, males and females, weighting between fifteen and twenty kilos and with health judged satisfactory for the experiment. The dogs were divided in three groups of six, according to the operative technique established: GROUP A - animals submitted to right intercostal thoracotomy; GROUP B - animals submitted to partial median sternotomy and GROUP C - animals submitted to total median sternotomy. Complications trans and postoperative, cardiac frequency, respiratory frequency, temperature, oxygenation, ventilation, acid-basic status, fistula presence and suture dehiscence were explored. As result the three techniques were available, because allowed satisfactory postoperative recuperation. Comparatively it didn’t have any important alteration of pH, blood gases and pain.

  3. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in Canis familiaris

    Directory of Open Access Journals (Sweden)

    Expedito Jr Matos Santana


    Full Text Available O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC e a altura (H de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR e do índice de pulsatilidade (IP do ramo principal da artéria renal. No estudo foram utilizados 22 cães adultos sem raça definida, sendo 11 machos e 11 fêmeas. Os animais foram previamente aferidos quanto a DAC e a H. Os exames ultra-sonográficos foram realizados com um aparelho HDI 4000 PHILIPS munido de um transdutor microconvexo multifreqüêncial (5-8 MHz, dispositivos Doppler Colorido e Doppler de Fluxo. Os animais foram posicionados em decúbito lateral direito ou esquerdo, de acordo com o rim a ser avaliado. Os diâmetros longitudinal (DL e dorsoventral (DDV dos rins foram mensurados na secção longitudinal e, o diâmetro transversal (DT foi aferido no plano transversal. O volume (V foi calculado automaticamente pelo software do ultra-som. Com o uso do Triplex Doppler, o IR e o IP das artérias renais direita e esquerda foram obtidos. Todos os dados foram apresentados em média ± EPM. Análises de regressão linear foram realizadas tendo o DL, DDV, DT e V como variáveis dependentes e a DAC e H como variáveis independentes. Os IR e IP dos rins direito e esquerdo foram comparados pelo teste t de Student. A DAC variou de 54-78cm para machos e 37-71cm para fêmeas e a altura variou entre 34-64 cm para os machos e 24-57cm para as fêmeas. As médias obtidas para DL, DDV, DT e V dos rins esquerdo e direito foram: 5,24±0,27cm, 3,07±0,15cm, 3,07±0,9cm, 28,01±3,4mL e 4,50±0,19cm, 2,88±0,14cm, 2,71±0,15cm, 21,27±2,6mL, respectivamente. As análises de regressão linear entre as medidas lineares e volume renal com a DAC e a H foram significativas para os interceptos e coeficientes de regressão (PThe aim of this paper was to establish the relation between the kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in adult healthy dogs, to obtain normality parameters for assessment of renal size and volume, as well as establish reference values to evaluate kidney blood perfusion by the resistivity index (RI and pulsatility index (PI of main renal artery. The study was applied at 22 adult dogs, 11 males and 11 females. Previously, the DAC and H of all animals were measured. For ultrasonographic examination, the ultra-sound system HDI 4000 PHILIPS equipped with a multi-frequency microconvex transducer, Color Doppler and Spectral Doppler devices was used. The animals were placed into right or left lateral decubitus position, in agreement with the kidney to be assessed. The longitudinal (LD and dorsoventral diameters (DVD of kidney were measured in longitudinal plane, and the transverse diameter (TD was determined in transversal section. The renal volume (V was automatically calculated by the ultrasound software. With Triplex Doppler, the RI and PI of right and left main renal arteries were obtained. All data were represented in mean ± SEM. Linear regression analyses were performed with renal LD, DVD, TD and V as dependent variable, and ACD and H as independent variable. RI and PI were compared between right and left renal arteries with Student's t-test. The LD, DVD, TD (cm and V (ml mean measurements for the left and right kidneys were: 5.24±0.27, 3.07±0.15, 3.07±0.9, 28.01±3.4 and 4.50±0.19, 2.88±0.14, 2.71±0.15, 21.27±2.6. All regression analyses were significant for the intercept and regression coefficient (P<0.01. There were statistical differences on RI and PI means between right and left renal arteries (P=0.001. The RI and PI means of left and right renal artery obtained were: 0.62±0.08 and 1.34±0.18; 0.70±0.06 and 1.62±0.13. The data obtained in the present paper can be used as parameters for evaluation of the renal size, volume and perfusion in adult dogs.

  4. Angiostrongylus vasorum in 20 cani della provincia di Chieti, Italia

    Directory of Open Access Journals (Sweden)

    Daniela Morelli


    Full Text Available A seguito di un caso di Angiostrongylus vasorum, diagnosticato all’inizio del 2008 nella provincia di Chieti, è stata organizzata una ricerca parassitologica al fine di indagare la presenza del parassita nei cani nella stessa area. Da gennaio a settembre 2008 sono stati esaminati 178 cani, 56 carcasse e 122 campioni di feci. Nelle carcasse sono stati ricercati i parassiti adulti nel ventricolo destro e nell’arteria polmonare e le forme larvali in tessuti di organi interni e cervello. Nelle feci è stata ricercata la forma larvale L1 con tre metodiche diagnostiche utilizzate correntemente per la ricerca di endoparassiti e larve di strongili broncopolmonari. Sono stati diagnosticati 20 casi (8,9% con identificazione di parassiti adulti in 5 cani e larve L1 in altri 15 soggetti. L’esame anatomopatologico delle carcasse dei cani con nematodi adulti ha evidenziato polmonite, pleurite, schiuma rossastra in trachea, versamento di liquido sieroemorragico in cavità toracica e ingrossamento di linfonodi medinici e meseraici. L’esame istologico dei tessuti ha evidenziato quadri gravi e sovrapponibili con lesioni da localizzazione dei parassiti in reni, linfonodi e cervello. Il numero cospicuo di casi riscontrati ha reso indispensabile considerare l’angiostrongilosi nelle diagnosi differenziali degli esami clinici e autoptici di cani della provincia di Chieti (Italia e dei territori confinanti.

  5. Morfologia externa dos imaturos de Caligo teucer (Linnaeus (Lepidoptera, Nymphalidae External morphology of the immatures of Caligo teucer (Linnaeus (Lepidoptera, Nymphalidae

    Directory of Open Access Journals (Sweden)

    Neuda A. de Souza


    Full Text Available Este trabalho descreve os imaturos de Caligo teucer (Linnaeus, 1758. O material criado é proveniente do nordeste do Brasil. As larvas se alimentam de folhas de bananeira Musa spp. (Musaceae, Heliconia bihai (Heliconiaceae, Canna indica (Cannaceae e Alpinia purpurata (Zingiberaceae.This paper describes the immatures of Caligo teucer teucer (Linnaeus,1758, from material reared in northeast Brazil. The larva feed on leaves of Musa spp. (Musaceae, Heliconia bihai (Heliconiaceae, Canna indica (Cannaceae and Alpinia purpurata (Zingiberaceae.

  6. Dicty_cDB: Contig-U06379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 47RE5.T0 BedlingtonTerrier Canis familiari... 46 0.65 1 ( BV258716 ) S235P6265FH5.T0 ItalianGreyhound Canis ...familiaris... 46 0.65 1 ( BV258272 ) S235P6198FF7.T0 ItalianGreyhound Canis famil...iaris... 46 0.65 1 ( BV255857 ) S235P6319RD12.T0 ItalianGreyhound Canis familiari... 46 0.65 1 ( CU467494 )

  7. Prevalence of antibodies against Rickettsia conorii, Babesia canis, Ehrlichia canis, and Anaplasma phagocytophilum antigens in dogs from the Stretto di Messina area (Italy). (United States)

    Pennisi, Maria-Grazia; Caprì, Alessandra; Solano-Gallego, Laia; Lombardo, Gabriella; Torina, Alessandra; Masucci, Marisa


    The aims of this study were to determine the seroprevalence for Rickettsia conorii, Ehrlichia canis, Anaplasma phagocytophilum, and Babesia canis in outdoor-kennelled dogs (n=249) from the Stretto di Messina (Italy) and to compare seroprevalence in 2 public shelters and 4 privately-owned kennels where different tick-preventive measures were implemented in order to focus on the specific sanitary risk posed by public shelters in southern Italy for tick-borne pathogens. R. conorii (72%) and B. canis (70%) were the most prevalent infections when compared to E. canis (46%) and A. phagocytophilum (38%). Seroprevalence for R. conorii, E. canis, and A. phagocytophilum was significantly higher in public shelters than in private kennels. However, B. canis seropositivity was similar in both types of kennels. In addition, in private kennels where a regular ectocide treatment was carried out by means of spot-on devices, dogs did not present E. canis and A. phagocytophilum antibodies. One hundred fifty-one dogs out of 249 (61%) were seropositive to more than one pathogen with R. conorii and B. canis the most common ones. Coinfections were more frequently found in public-shelter dogs. This study demonstrated high seroprevalences against R. conorii, B. canis, E. canis, and A. phagocytophilum in kennelled dogs from both coastal sites of the Stretto di Messina and the importance of regular tick-bite prevention by means of individual spot-on devices.

  8. Partial characterization of proteolytic enzymes of Microsporum canis and Microsporum cookei. (United States)

    Simpanya, M F; Baxter, M


    Characterization by proteinase inhibitors of the enzymes produced by Microsporum spp. revealed that Microsporum canis and Microsporum cookei produce serine proteinase(s), but only M. canis expresses aspartic and cysteine proteinases and probably a metalloproteinase. Both M. canis and M. cookei expressed metalloelastinolytic proteinases. All the proteinase types have been implicated in the pathogenicity of a wide range of microorganisms.

  9. Stability of CaNi5Hx stored at temperatures between 20 and 150 degrees C

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Møller, T.S.; Bjerrum, Niels


    The stability of CaNi5Hx stored at different temperatures was studied as a function of time. In general AB(5) metal hydrides are known to be metastable with a tendency to disproportionate at elevated temperatures. In the present study samples of CaNi5 were stored in the hydrided state (as CaNi5...

  10. Mycoplasma canis and urogenital disease in dogs in Norway

    DEFF Research Database (Denmark)

    L'Abee-Lund, T.M.; Heiene, R.; Friis, N.F.


    Mycoplasmas identified as Mycoplasma canis were isolated from nine dogs with clinical signs of urogenital disease in Norway over a period of 20 months. Some of the dogs had been treated unsuccessfully with antibiotics, and three were euthanased as a result of severe persistent disease. Seven...... of the dogs had a urinary tract infection, one had chronic purulent epididymitis and one had chronic prostatitis. Overt haematuria was frequently observed among the dogs with cystitis. M canis was isolated in pure culture from seven of the dogs and in mixed culture from the other two. In three cases...... the mycoplasma was cultivated only from urinary sediment, and it was typically obtained in smaller numbers than would be considered indicative of a urinary tract infection. In contrast with most mycoplasmas, the M canis isolated from all the dogs grew on ordinary blood agar plates used for routine...

  11. Book review, Amati cani, José Jorge Letria

    Directory of Open Access Journals (Sweden)

    Manuel Graziani


    Full Text Available Con Amati cani ci discostiamo per una volta dalle pubblicazioni a carattere scientifico, per dare il giusto risalto ad un’interessante raccolta di narrativa che esplora il rapporto tra l'uomo e il suo miglior amico. José Jorge Latria, noto soprattutto per essere un esponente di spicco della canzone politica portoghese e per le sue opere poetiche, teatrali e di letteratura per ragazzi, nello scrivere questo libro compie un vero e proprio atto d’amore verso i cani, con il preciso intento di costringere i lettori ad eliminare dal proprio vocabolario il gratuito modo di dire ‘mondo cane’. L’Autore delinea brevi ritratti di cani che, da Argo in poi, hanno accompagnato da amici veri i loro celebri padroni nella buona e nella cattiva sorte: racconta cioè la storia di quei cani che non sono sprofondati nella voragine dell’oblio perchè i loro padroni hanno raggiunto la celebrità nel mondo della letteratura, della politica, del cinema, delle scienze o della musica. Con a fianco un amico fedele come un cane, la vita ha avuto un sapore diverso per Ernest Hemingway, Isaac Newton, Sigmund Freud, Buster Keaton, Marilyn Monroe, Pablo Picasso, John Steinbeck, Lord Byron, Tim Burton e altri ancora, tutti personaggi che sono presenti in questo libro grazie ai cani che hanno condiviso con loro la vita e le memorie. La lettura di Amati cani dà piacere poichè in ognuno di questi racconti batte, affettuoso e delicato, il cuore di un cane; ma dà anche un pò da pensare in quanto celebra in maniera molto tenera l’amore, la fedeltà e la solidarietà tra l’uomo e il suo speciale amico a quattro zampe.

  12. Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs


    Ciarmela, M. L.; Arambarri, A. M.; Basualdo, J. A.; Minvielle, M. C.


    The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated a...

  13. Systematic B-metal substitution in CaNi5

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Bjerrum, Niels


    The aim of this work has been to study the effect of B metal substitutions in CaNi5 (AB(5)) which is known to suffer from poor cycling stability as a hydride electrode material. Systematic monosubstitutions of nickel with the most common other B metals (i.e. Al, Cr, Mn, Fe, Co, Cu, Zn and Sn...... be concluded that CaNi5 is much less tolerant towards B-metal substitution than LaNi5. This fact makes it less possible that the problem with cycling stability of Ca-based hydride electrodes can be solved by substitutions. (C) 1999 Elsevier Science S.A. All rights reserved....

  14. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  18. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  19. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  2. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  3. Serodetection of Ehrlichia canis amongst dogs in central Namibia. (United States)

    Manyarara, Rutendo; Tubbesing, Ulf; Soni, Minty; Noden, Bruce H


    Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories). The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6%) compared with apparently healthy dogs (41.6%) (P = 0.00). Location of habitation was significant (P canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.

  4. Serodetection of Ehrlichia canis amongst dogs in central Namibia

    Directory of Open Access Journals (Sweden)

    Rutendo Manyarara


    Full Text Available Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories. The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6% compared with apparently healthy dogs (41.6% (P = 0.00. Location of habitation was significant (P < 0.017, with a high percentage of dogs exposed to E. canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.

  5. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)


    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  6. Investigation of tick vectors of Hepatozoon canis in Brazil. (United States)

    Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena


    Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil.

  7. First record of Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae in Brazil

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins


    Full Text Available Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae is recorded for the first time in Brazil (Bahia. It was originally described from Europe and is currently widely distributed in that continent and Asia.

  8. Detection of genotype-specific Ehrlichia canis exposure in Brazilian dogs by TRP36 peptide ELISA. (United States)

    Aguiar, Daniel M; Zhang, Xiaofeng; Braga, Isis A; Taques, Isis I G G; McBride, Jere W


    We recently characterized a novel genotype of Ehrlichia canis based on the tandem repeat (TR) sequence of the TRP36 gene in Brazil. The TR amino acid sequence of the Brazilian (Br) genotype (ASVVPEAE) was divergent from the previously described US genotype (TEDSVSAPA) of E. canis. In this study, we developed an ELISA based on TRP36 TR synthetic peptides from both Br and US E. canis TRP36 genotypes to serologically detect and distinguish infections caused by these genotypes. Sera from 30 Brazilian dogs naturally infected with E. canis, sera from dogs experimentally infected E. canis (Jake and Cuiabá #1 strains) and E. chaffeensis (Arkansas strain) and 12 seronegative E. canis dogs were evaluated. Fifteen naturally infected Brazilian dogs had antibodies that reacted with the US TRP36 (n=9) or Br TRP36 (n=6) only, and 13 dogs had antibodies that reacted with both TPR36 peptides suggesting that these dogs were exposed to both genotypes. Most dogs (n=28) had antibodies that reacted with the highly conserved E. canis TRP19 peptide; however, two dogs had antibodies to E. canis TRP19, but did not have TRP36 antibodies, raising the possibility that another novel TRP36 genotype is circulating in Brazil. Our results demonstrate that synthetic peptides based on the TR region of E. canis TRP36 can be used to serologically distinguish infections or identify coinfections by different genotypes, and to determine the seroprevalence of various E. canis genotypes in Brazil.

  9. Dicty_cDB: SHH577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0334758850 Dog Library Canis familiaris genomic,genomic survey sequence. 30 0.052... 3 CE699805 |CE699805.1 tigr-gss-dog-17000368830355 Dog Library Canis familiaris genomic, genomic survey seq...uence. 40 0.16 2 CE011802 |CE011802.1 tigr-gss-dog-17000321033562 Dog Library Canis familiaris genomic, genomic survey...og Library Canis familiaris genomic, genomic survey sequence. 46 0.59 1 CE427774 |CE427774.1 tigr-gss-dog-17...000362871784 Dog Library Canis familiaris genomic, genomic survey sequence. 30 1.5 3 CE637188 |CE637188.1 ti

  10. Dicty_cDB: VSE320 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available og Library Canis familiaris genomic, genomic survey sequence. 40 0.001 2 AC106112 |AC106112.6 Rattus norvegi...003 3 CE198350 |CE198350.1 tigr-gss-dog-17000372200949 Dog Library Canis familiaris genomic, genomic survey ...sequence. 50 0.005 1 CE120051 |CE120051.1 tigr-gss-dog-17000325900106 Dog Library Canis familiaris genomic, genomic survey...804 Dog Library Canis familiaris genomic, genomic survey sequence. 38 0.005 2 AC139061 |AC139061.3 Mus muscu... |CE001298.1 tigr-gss-dog-17000320774441 Dog Library Canis familiaris genomic, genomic survey

  11. Attempted eradication of Porphyrio porphyrio Linnaeus in the Florida Everglades

    Directory of Open Access Journals (Sweden)

    Dave EGGEMAN


    Full Text Available Porphyrio porphyrio (Fulica porphyrio Linnaeus was reported to the South Florida Water Management District in a Water Conservation Area and in constructed wetlands in the Everglades in 2006. A rapid assessment, including casual observations and surveys of land managers, indicated a limited number of P. porphyrio (~300 birds was present, and an eradication attempt was initiated. From 2006 – 2008, more than 3100 P. porphyrio were killed by shotgun from airboats during 73 hunts, suggesting the initial population assessment was severely underestimated. After removing nearly 1500 P. porphyrio in 2008, we concluded that eradication was not possible. Failure of this eradication attempt is attributed to P. porphyrio’s affinity with dense emergent vegetation, which greatly limited shooting effectiveness. Further, the failed eradication underscores the importance of a reporting network to improve early detection and the chance to eliminate naturalized or feral populations of non‐native species.

  12. Helminths of the guinea pig, Cavia porcellus (Linnaeus, in Brazil

    Directory of Open Access Journals (Sweden)

    Roberto Magalhães Pinto


    Full Text Available Worm burdens were evaluated and compared in two groups of the guinea pig, Cavia poreellus (Linnaeus, 1758: animals of the first group were conventionally maintained in an institutional animal house and those of the second group were openly kept in pet shops in Brazil. Animals from both sources were infected only with the nematode Paraspidodera uncinata (Rudolphi, 1819 Travassos, 1914 (10% of prevalence in guinea pigs from lhe institutional facility and 40% in those animals from the pet shop. Other helminth samples recovered from Brazilian guinea pigs during 52 years and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute (CHIOC were also analyzed. Paraspidodera uncinata and the cestode Monoecocestus parcitesticulatus Rêgo, 1960 were identified in these samples.

  13. [Factors associated with Ehrlichia canis infection in dogs infested with ticks from Huanuco, Peru]. (United States)

    Huerto-Medina, Edward; Dámaso-Mata, Bernardo


    The aim of the study was to determine the frequency and associated factors of Ehrlichia canis infection in dogs. Blood samples from 150 dogs infested with ticks in 10 veterinary clinics in the city of Huanuco in Peru were collected. The dogs were randomly selected without regard to breed, age or sex. Ehrlichia canis antibodies were detected by chromatographic immunoassay.51.3% of dogs were infected with Ehrlichia canis. In the multivariate analysis, factors associated with the presence of Ehrlichia canis were: poor health of the dog (p = 0.049), a higher average of tick infestation (p = 0.018), and adult dogs (p = 0.038). The frequency of Ehrlichia canis in dogs of this city is high. Control of the brown dog tick (Rhipicephalus sanguineus) vector of Ehrlichia canis is recommended.

  14. Disodium cromoglycate prevents ileum hyperreactivity to histamine in Toxocara canis-infected guinea pigs. (United States)

    Sá-Nunes, A; Corrado, A P; Baruffi, M D; Faccioli, L H


    The aim of this study was to investigate whether Toxocara canis infection in guinea pigs provokes changes in ileum responsiveness to histamine. Ileum segments from control and T. canis-infected groups were placed at isometric conditions and submitted to various doses of histamine. No changes were observed between controls and T. canis-infected groups at days 3, 6 and 12 after infection. However, at days 18 and 24 after infection, there was a significant increase in ileum responsiveness to histamine in T. canis-infected group. Pre-incubation of ileum segments with 1mgml(-1) disodium cromoglycate (DSCG) prevented the increased responsiveness to histamine in T. canis-infected guinea pigs and did not affect ileum contractility in non-infected animals. These results indicate that T. canis-infected guinea pigs develop increased intestinal responsiveness to histamine and that DSCG prevents alterations in smooth-muscle contractility.

  15. Divergence of the TRP36 protein (gp36) in Ehrlichia canis strains found in Brazil. (United States)

    Aguiar, Daniel M; Melo, Andreia L T


    The molecular characterization of 16S rRNA gene and immunoreactive proteins of Ehrlichia canis usually provide little information about the overall diversity of this organism. On the other hand, distinct sequences of the Tandem Repeat Protein 36 (TRP36/gp36) gene of E. canis have been reported, indicating substantial degree of diversity. The present letter aims to update and discuss the molecular divergence of the TRP36 protein between strains of E. canis isolated in different countries including Brazil.

  16. Detection of Antibodies Reactive with Ehrlichia canis in a Kennel in Bulgaria


    Tsachev, Ilia


    A seroepidemiological study on Ehrlichia canis infection was performed in 16 dogs in a kennel in the region of Plovdiv in Bulgaria. For this purpose, anti-E. canis antibodies were detected by the indirect immunofluorescence antibody test. The results showed that 75% of the dogs examined were positive to E. canis. The antibody titres 1:100, 1:200 and 1:400 were detected.

  17. Prevalence and Risk Factors Associated with Toxocara canis Infection in Children


    Camilo Romero Núñez; Germán David Mendoza Martínez; Selene Yañez Arteaga; Martha Ponce Macotela; Patricia Bustamante Montes; Ninfa Ramírez Durán


    The objective of this study was to determine seroprevalence and identify risk factors associated with Toxocara canis infection. A clinical and epidemiological questionnaire and body mass index were used to assess the risk factors associated with human toxocariasis in 108 children with an age range of 2–16 years. Antibodies against Toxocara canis were detected using an ELISA test kit. Chi-square analysis and odds ratio (OR) were used to identify risk factors associated with Toxocara canis sero...

  18. A new star-forming region in Canis Major

    CERN Document Server

    Magakian, T Yu; Bally, J


    A new southern star-formation region, located at an estimated distance of ~1.5 kpc in the Lynds 1664 dark cloud in Canis Major, is described. Lynds 1664 contains several compact star clusters, small stellar groups, and young stars associated with reflection nebulae. Narrow-band H{\\alpha} and [SII] images obtained with 4-m CTIO telescope reveal more than 20 new Herbig-Haro objects associated with several protostellar outflows.

  19. SCM, the M Protein of Streptococcus canis Binds Immunoglobulin G (United States)

    Bergmann, Simone; Eichhorn, Inga; Kohler, Thomas P.; Hammerschmidt, Sven; Goldmann, Oliver; Rohde, Manfred; Fulde, Marcus


    The M protein of Streptococcus canis (SCM) is a virulence factor and serves as a surface-associated receptor with a particular affinity for mini-plasminogen, a cleavage product of the broad-spectrum serine protease plasmin. Here, we report that SCM has an additional high-affinity immunoglobulin G (IgG) binding activity. The ability of a particular S. canis isolate to bind to IgG significantly correlates with a scm-positive phenotype, suggesting a dominant role of SCM as an IgG receptor. Subsequent heterologous expression of SCM in non-IgG binding S. gordonii and Western Blot analysis with purified recombinant SCM proteins confirmed its IgG receptor function. As expected for a zoonotic agent, the SCM-IgG interaction is species-unspecific, with a particular affinity of SCM for IgGs derived from human, cats, dogs, horses, mice, and rabbits, but not from cows and goats. Similar to other streptococcal IgG-binding proteins, the interaction between SCM and IgG occurs via the conserved Fc domain and is, therefore, non-opsonic. Interestingly, the interaction between SCM and IgG-Fc on the bacterial surface specifically prevents opsonization by C1q, which might constitute another anti-phagocytic mechanism of SCM. Extensive binding analyses with a variety of different truncated SCM fragments defined a region of 52 amino acids located in the central part of the mature SCM protein which is important for IgG binding. This binding region is highly conserved among SCM proteins derived from different S. canis isolates but differs significantly from IgG-Fc receptors of S. pyogenes and S. dysgalactiae sub. equisimilis, respectively. In summary, we present an additional role of SCM in the pathogen-host interaction of S. canis. The detailed analysis of the SCM-IgG interaction should contribute to a better understanding of the complex roles of M proteins in streptococcal pathogenesis.

  20. Stellar populations in the Canis Major over-density

    CERN Document Server

    Carraro, Giovanni; Vazquez, Ruben A


    We performed a photometric multicolor survey of the core of the Canis Major over-density at l 244, -8.0, reaching V = 22 and covering 0.3 x 1 degree. The main aim is to unravel the complex mixture of stellar populations toward this Galactic direction, where in the recent past important signatures of an accretion event have been claimed to be detected. While our previous investigations were based on disjointed pointings aimed at revealing the large scale structure of the third Galactic Quadrant, we now focus on a complete coverage of a smaller field centered on the Canis Major over-density. A large wave-length baseline, in the UBVRI bands, allows us to build up a suite of colour colour and colour magnitude diagrams, providing a much better diagnostic tool to disentangle the stellar populations of the region. In fact, the simple use of one colour magnitude diagram, widely employed in all the previous studies defending the existence of the Canis Major galaxy, does not allow one to separate the effects of the dif...

  1. Seroprevalence of Ehrlichia canis infection in stray dogs from Serbia

    Directory of Open Access Journals (Sweden)

    Nataša Bogićević


    Full Text Available Canine Monocytic Ehrlichiosis is a zoonotic bacterial disease with worldwide distribution. With regards to the population of stray dogs, the disease is facilitated due to their lifestyle and the lack of anti-parasitic protection. The aim of this study was to provide serological data on the presence of a specific Ehrlichia canis IgG antibodies in stray dogs, originating from 7 municipalities in Serbia. During the period from April 2013 to June 2014, 217 canine sera were submitted to the laboratory of the Department of Infectious Diseases of Animals and Bees, Faculty of Veterinary Medicine in Belgrade. An immunofluorescent antibody test (IFAT was performed to detect antibodies to Ehrlichia canis (cut off, 1:50. Seropositive dogs were found in 5 out of 7 counties with a seroprevalence varying from 3.57% to 20% and an overall seroprevalence of 11.06% (24/217. There was no statistically significant difference between the prevalence of infection and the host age or gender. Results showed that stray dogs contribute to maintaining and spreading of Ehrlichia canis in Serbia. Due to the close relationship between people and dogs, it is of great importance to constantly monitor and improve prevention of this disease.

  2. Studies on the control of Toxocara canis in breeding kennels. (United States)

    Fisher, M A; Jacobs, D E; Hutchinson, M J; Dick, I G


    The control of Toxocara canis was investigated in naturally infected unweaned puppies. Anthelmintic treatments were administered to three litters of pups at 2, 4 and 6 weeks of age. When either a new combination anthelmintic containing febantel, pyrantel embonate and praziquantel or fenbendazole was used, the faecal egg output over the first 7 weeks of life was reduced by more than 80% and worm burdens by over 90%. In contrast, piperazine adipate had no appreciable effect on T. canis egg output, even though worm burdens were reduced by 86% by 7 weeks of age. In a further trial using three litters, the worm burden of pups treated with the combination anthelmintic was profiled before and after the 2 week dose and after the 4 week dose. Although worm numbers were substantially reduced by treatment, there was evidence of significant reinfection taking place throughout the control programme. It is concluded that more potent anthelmintics can provide longer term benefits by reducing the numbers of T. canis eggs shed into the environment, but that multiple dosing remains essential for this purpose.


    Directory of Open Access Journals (Sweden)

    Ana Pardo D


    Full Text Available Objetivo. Determinar la presencia de anticuerpos a B. canis en perros domésticos y callejeros del municipio de Villavicencio, Colombia. Materiales y métodos. Se utilizó la prueba de aglutinación rápida en placa con antígeno menos mucoide (M- en 201 muestras de suero. En dos animales seropositivos se realizó intento de aislamiento por hemocultivo en medio selectivo para Brucella (oxoid®. En un animal seropositivo, con crecimiento bacteriano con características morfológicas sugestivas a B. canis se realizó histopatología de testículo, bazo e hígado. Resultados. La seropositividad general fue de 1.49% y correspondió a tres caninos machos, dos de los cuales presentaron signos clínicos de epididimitis y orquitis (unilateral. El cultivo y la histopatología no fueron concluyentes para el diagnostico de B. canis. Conclusiones. La seropositividad fue baja y sugiere que la población estudiada no ha estado en contacto con la bacteria. La presencia de reactores puede estar asociado con falsos positivos. El no aislamiento de la bacteria no indica que la enfermedad no exista por lo que se requiere de nuevos estudios.

  4. Vertical transmission of Toxocara canis in successive generations of mice

    Directory of Open Access Journals (Sweden)

    Elizandra Roselaine Schoenardie

    Full Text Available Visceral toxocariasis is a neglected zoonosis caused byToxocara canis larvae in unusual hosts. In dogs, the definitive host, the infection occurs mainly through transplacental and transcolostral transmission. Studies on experimental models have shown that vertical transmission may result from acute infections. Considering that toxocariasis is characterized as a chronic infection, with possible reactivation of larvae present in the brain, this study evaluated the presence of larvae in the brain of female BALB/c mice and their offspring with chronic infection during three successive pregnancies. ELISA-TES was used to evaluate the antibody levels. T. canis larvae were detected in the brain tissue of the mice during the three successive generations evaluated. The offspring's IgG level gradually decreased, and mean absorbance (ABS above the cutoff point (0.070 was observed only at 30 (0.229 and 50 (0.096 days of age, while IgM was not detected. The infections in the offspring confirmed that vertical transmission of T. canis larvae occurred during chronic toxocariasis in three successive generations of mice.

  5. Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs

    Directory of Open Access Journals (Sweden)

    Ciarmela, M. L.


    Full Text Available The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated and scored according to Lỳsek’s ovicidal effect classification. These procedures were repeated three times which each fungal species. Chrysosporium merdarium and F. oxysporum showed very high ovicidal activity, F. sulphureum high ovicidal activity, F. moniliforme intermediate ovicidal activity and T. harzianum did not affect the viability of T. canis eggs. Taking into account the effects on human and animal health and the environment, the species with better prospects for studying its potential use as biological control was F. sulphureum.

  6. Molecular and serological detection of Ehrlichia canis and Babesia vogeli in dogs in Colombia. (United States)

    Vargas-Hernández, G; André, M R; Faria, J L M; Munhoz, T D; Hernandez-Rodriguez, M; Machado, R Z; Tinucci-Costa, M


    Ehrlichiosis and babesiosis are tick-borne diseases, caused mainly by Ehrlichia canis and Babesia canis, respectively, with a worldwide occurrence in dogs, whose main vector is the brown-dog tick, Rhipicephalus sanguineus. The present work aimed to detect the presence of E. canis and Babesia sp. in 91 dog blood samples in Colombia, by molecular and serological techniques. We also performed sequence alignment to indicate the identity of the parasite species infecting these animals. The present work shows the first molecular detection of E. canis and B. vogeli in dogs from Colombia. Immunoglobulin-G (IgG) antibodies to E. canis and Babesia vogeli were found in 75 (82.4%) and 47 (51.6%) sampled dogs, respectively. Thirty-seven (40.6%) and 5 (5.5%) dogs were positive in PCR for E. canis and Babesia sp., respectively. After sequencing, amplicons showed 99% of identity with isolates of E. canis and B. vogeli. The phylogenetic trees based on 16S rRNA-Anaplasmataceae sequences and 18S rRNA-piroplasmid sequences supported the identity of the found E. canis and B. vogeli DNAs, respectively. The present work shows the first molecular detection of E. canis and B. vogeli in dogs in Colombia.

  7. [Molecular identification of Ehrlichia canis in a dog from Arica, Chile]. (United States)

    López, Javier; Abarca, Katia; Mundaca, M Isabel; Caballero, Carla; Valiente-Echeverría, Fernando


    We report a molecular confirmed case of canine ehrlichiosis caused by Ehrlichia canis. A 10-year old female crossbred Siberian from the city of Arica, which was infested by ticks, presented hemorrhagic manifestations (hematomas and snout bleeding) and prostration. Blood cell count revealed thrombocytopenia (30,000 platelets/ mm³). Immunochromatographic rapid testing for E. canis IgG was positive. Amplification and sequencing of a fragment of the 16S rRNA gen from a blood sample showed 100% homology with E. canis from Perú. This is the first report of E. canis in Chile, an agent with known zoonotic potential.

  8. A survey for infection with Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi, and Babesia canis in feral and client-owned dogs in the Turks and Caicos Islands, British West Indies


    Hoff, Brent; McEwen, Beverly; Peregrine, Andrew S.


    The frequency of infection with Dirofilaria immitis and Babesia canis and seropositivity to Ehrlichia canis and Borrelia burgdorferi in feral and client-owned dogs was determined. Feral dogs were 14.8 and 11.2 times more likely to be seropositive to D. immitis and E. canis, respectively, than were client-owned dogs. None of the dogs tested positive for B. burgdorferi or B. canis.

  9. Infracommunities of intestinal helminths of the Red Fox Vulpes vulpes (Linnaeus, 1758 from Italian Alps

    Directory of Open Access Journals (Sweden)

    Anna Rita Di Cerbo


    Full Text Available Vulpes vulpes (Linnaeus, 1758 is one of the most common carnivore in Italy and its spread includes almost the whole national territory. The species shows an high ecological plasticity and a variable diet composition connected in part to human sources. This high adaptability permits the red foxes to colonize different habitats like the suburbs of large cities as well as the small villages located in mountain areas. On the other hand, the tourism pressure seems to assume a great importance in the Alps, also in those areas where the foxes live. So, indirect interactions could take place between these animals and the humans. The role of V. vulpes in the zoonoses has not to be understated since this carnivore could transmit parasitic diseases that are able to cause serious pathologies in humans. This study aims just to investigate on intestinal communities of helmiths of V. vulpes in order to make progress in current knowledge on epidemiological situation in Italian Alps. During 1998-2003, we have examined 450 foxes from Trentino Alto Adige, Veneto, Lombardia and Valle d'Aosta. The specimens collected were found dead or have been hunted (according to national law n. 157/92 in localities situated between 170 and 2200 m a.s.l. The carcasses were carried to the provincial sections of Zooprofilattici Institutes, where the intestine was drawn by each sample and all the material was sent to the Faculty of Veterinary Medicine of Milan. Parasitological examination of the small intestines was performed by the analysis of the whole sediment and counting technique (SCT. Parasites were preserved in alcohol 70° before to be clarified or stained and identified by microscope (Zeiss Axioscop. Mean abundance, mean intensity and prevalence were calculated for each taxon of helminth. Dates of sampling were grouped within the four seasons. Statistic tests were performed with software package SPSS rel. 11.5 and spatial analysis with the

  10. 75 FR 24741 - Endangered and Threatened Wildlife and Plants; Mexican Wolf (Canis lupus baileyi) Conservation... (United States)


    ... Fish and Wildlife Service Endangered and Threatened Wildlife and Plants; Mexican Wolf (Canis lupus... availability of the Mexican Wolf Conservation Assessment (assessment). The assessment provides scientific information relevant to the conservation of the Mexican wolf (Canis lupus baileyi) in Arizona and New...

  11. A critical reflection on current control of Toxocara canis in household dogs

    NARCIS (Netherlands)

    Nijsse, E.R.


    Toxocara canis is a roundworm that is common worldwide and also in Dutch household dogs. Adult stages of T. canis can be present in the small intestines of dogs where they produce large numbers of eggs that are shed in the environment (patent infection). Because very young dogs and humans can develo

  12. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus... (United States)


    ... and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus) in the Western...-AX57 Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus... Minnesota population of gray wolves (Canis lupus) to conform to current statutory and policy...

  13. Descripción de una grahamella del perro, Grahamella canis n. sp.

    Directory of Open Access Journals (Sweden)

    Arístides Herrer


    Full Text Available En tres perros, de un total de 75 que fueron sometidos a hemocultivos, se ha recogido una grahamella que se describe con el nombre de Grahamella canis n. sp. La infección natural del perro parece ser imperceptible por medio de frotis de sangre. La G. canis se aisla fácilmente en cultivo en el medio semisólido de Noguchi y el agar sangre, consiguiéndose resiembras con regularidad solamente en este último. Los hemocultivos desarrollan tanto a 28º como a 37ºC. y son infectantes para su huésped. Tanto perros normales como esplenectomizados se pueden infectar experimentalmente con cultivos, obteniéndose mayor parasitismo en los esplenectomizados. Al mismo tiempo es posible obtener infecciones mixtas de Grahamella canis y Bartonella canis. La G. canis desarrolla in vitro en sangre citratada.

  14. A study of the type series of Nautilus pompilius Linnaeus, 1758 (Mollusca, Cephalopoda, Nautilida). (United States)

    Nikolaeva, Svetlana V


    Few animals are treasured by zoologists more than Nautilus, and Nautilus pompilius Linnaeus, 1758, the type species of the genus, in particular. However, the type series of this species has not been studied in great detail. According to the rules of zoological nomenclature the type series consists of all the specimens included by the author in the new nominal taxon at the time of description (whether directly or by bibliographic reference), and any evidence, published or unpublished, may be taken into account to determine what specimens are included. The type series of Nautilus pompilius includes specimens in the Linnean Society of London, the University Museum in Uppsala, and specimens figured by pre-Linnaean authors indicated by reference by Linnaeus (1758). One specimen in London and four specimens in Uppsala, which are still extant, are likely to have been known to Linnaeus at the time when he prepared the 10th Edition of Systema Naturae (Linnaeus 1758), although none of these specimens was specifically mentioned by him. Even though it is widely believed that Linnaeus (1767) designated as lectotype a specimen figured by Rumphius (1705) in his D'Amboinsche Rariteitkamer, referred to in the Systema Naturae, this presumed lectotypification is not valid because Linnaeus did not explicitly indicate that any particular specimen was considered to be the type of the species. Later lectotype designations of Rumphius' illustrations are invalid because they show three different specimens. It seems that the best approach, given the quality of the material and the lack of clarity as to its type status, would be to apply to the ICZN asking to set aside all previous type fixations and designate a neotype, preferably a DNA sequenced specimen of known provenance.

  15. Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs


    Maurício Franco Zanette; Valéria Marçal Felix de Lima; Márcia Dalastra Laurenti; Claudio Nazaretian Rossi; Juliana Peloi Vides; Rafael Felipe da Costa Vieira; Alexander Welker Biondo; Mary Marcondes


    Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA), indirect immunofluorescent antibody test (IFAT) and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tes...

  16. Homage to Linnaeus: How many parasites? How many hosts? (United States)

    Dobson, Andy; Lafferty, Kevin D.; Kuris, Armand M.; Hechinger, Ryan F.; Jetz, Walter


    Estimates of the total number of species that inhabit the Earth have increased significantly since Linnaeus's initial catalog of 20,000 species. The best recent estimates suggest that there are ≈6 million species. More emphasis has been placed on counts of free-living species than on parasitic species. We rectify this by quantifying the numbers and proportion of parasitic species. We estimate that there are between 75,000 and 300,000 helminth species parasitizing the vertebrates. We have no credible way of estimating how many parasitic protozoa, fungi, bacteria, and viruses exist. We estimate that between 3% and 5% of parasitic helminths are threatened with extinction in the next 50 to 100 years. Because patterns of parasite diversity do not clearly map onto patterns of host diversity, we can make very little prediction about geographical patterns of threat to parasites. If the threats reflect those experienced by avian hosts, then we expect climate change to be a major threat to the relatively small proportion of parasite diversity that lives in the polar and temperate regions, whereas habitat destruction will be the major threat to tropical parasite diversity. Recent studies of food webs suggest that ≈75% of the links in food webs involve a parasitic species; these links are vital for regulation of host abundance and potentially for reducing the impact of toxic pollutants. This implies that parasite extinctions may have unforeseen costs that impact the health and abundance of a large number of free-living species.

  17. Systematic status of wild Canis in North-central Texas (United States)

    Mech, L. David; Nowak, Ronald M.


    Skulls of wild Canis collected 2003–2004 in north-central Texas are morphometrically similar to a series taken there and in nearby areas in 1964–1971, which was considered to represent a population of Coyotes (C. latrans) modified through introgression from Red Wolves (C. rufus). A few of the new specimens closely resemble small examples of Red Wolves. Such affinity is supported by authoritative examination of living and videotaped animals. The persistence of influence of Red Wolves, long after presumed extirpation through hybridization and human persecution, may be relevant to wolf conservation.

  18. [On similarities and differences between morphological concepts of Linnaeus and Goethe]. (United States)

    Korona, V V


    Analysis of C. Linnaeus' and J.W. Goethe's morphological ideas shows that they both deal with structure of object under study however Linnaeus understood it perceptive structure while Goethe as its proper structure. Perceptive structure is an image (Gestalt) formed in observer's mind and recognized by the discriminating traits. The proper object structure is composed of its morphological elements, that can be distinguished only by a special study of their transformations. Notion of the plants modular construction originated within Goethe's ideas about plant morphology. We cannot expect any remarkable advances in modular theory as well in the descriptive and constructive morphology until conceptual differences between these two approaches will be understood.

  19. High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples. (United States)

    Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai


    Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines.

  20. Development and Evaluation of a Seminested PCR for Detection and Differentiation of Babesia gibsoni (Asian Genotype) and B. canis DNA in Canine Blood Samples


    Birkenheuer, Adam J.; Levy, Michael G.; Breitschwerdt, Edward B.


    Canine babesiosis has recently been recognized as an emerging infectious disease of dogs in North America. We sought to develop a seminested PCR to detect and differentiate Babesia gibsoni (Asian genotype), B. canis subsp. vogeli, B. canis subsp. canis, and B. canis subsp. rossi DNA in canine blood samples. An outer primer pair was designed to amplify an ∼340-bp fragment of the 18S rRNA genes from B. gibsoni (Asian genotype), B. canis subsp. vogeli, B. canis subsp. rossi, and B. canis subsp. ...

  1. Toxocara canis: una zoonosis frecuente a nivel mundial

    Directory of Open Access Journals (Sweden)

    Ana Carolina Rojas-Salamanca


    Full Text Available La toxocariasis, causada principalmente por Toxocara canis, es una de las zoonosis más comunes a nivel mundial; se presenta con mayor frecuencia en niños, asociada a condiciones desfavorables de higiene, hacinamiento, convivencia con perros parasitados, el nivel socioeconómico, la ubicación geográfica y los entornos en los cuales los animales depositan sus heces, lo que se convierte en un gran foco de contaminación para los humanos. El Toxocara canis ingresa al ser humano por contacto directo con heces de perro o por contaminación de alimentos. La carga parasitaria es de vital importancia, ya que está relacionada directamente con la gravedad de la enfermedad, con los diferentes síndromes que se producen y con la respuesta inmune desencadenada por el organismo, teniendo en cuenta el ciclo de vida que se lleva a cabo en el organismo humano. Para esta enfermedad no se puede realizar un diagnóstico por técnicas coproparasitológicas, por lo cual es necesario utilizar otros métodos, como el aumento de leucocitos con presencia de eosinofilia, la prueba de ELISA y, en algunos casos, por medio de biopsias.

  2. Demodicosis caused by Demodex canis and Demodex cornei in dogs. (United States)

    Sivajothi, S; Sudhakara Reddy, B; Rayulu, V C


    Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears examination large number of adult short-tail Demodex mites were found. D. cornei was identified by based on the morphological characters including short opisthosoma with blind and round terminal end. Mean length of total body, opisthosoma of both types of the mites were differed statistically significant (P  0.05). Dogs were treated with daily oral ivermectin @ 500 μg/kg/day, external application of amitraz along with supportive therapy. After completion of 45 days of therapy dogs were recovered completely without any side effects.

  3. SCM-positive Streptococcus canis are predominant among pet-associated group G streptococci. (United States)

    Verkühlen, Gerd-Josef; Pägelow, Dennis; Valentin-Weigand, Peter; Fulde, Marcus


    Streptococcus (S.) canis is a neglected zoonotic pathogen with increasing impor- tance. Since knowledge about its distribution in pets in Germany is scant, we designed a study and tested 335 dogs and 71 cats for colonization by S. canis. S. canis was isolated from swabs taken from the perianal region by culture and subsequent identification was performed biochemically as well as by PCR. In total, 15.8% (53) of the canine and 8.5% (six) of the feline strains grown on Staphlyo- coccus/Streptococcus Selective Agar were tested positive for the Lancefield group G antigen. The vast majority of strains expressing the Lancefield Group G carbohy- drate (56 out of 59) were further identified as S. canis underlining their outstanding role among animal-associated Group G streptococci (GGS). Furthermore, 90.0% of the canine and 83.3% of the feline S. canis strains harbour the species-specific anti- phagocytic M protein homologue SCM, which has been described as an important virulence factor. In contrast, emm-genes typically encoded by human-specific GGS could not be detected in any of the S. canis isolates. Taken together, this study provides insights into the distribution of the neglected zoonotic pathogen S. canis in a population of pets in Germany. The presence of SCM in the vast majority of strains indicates their pathogenic potential.

  4. Functional genomics of the horn fly, Haematobia irritans (Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Quiroz-Romero Héctor


    Full Text Available Abstract Background The horn fly, Haematobia irritans (Linnaeus, 1758 (Diptera: Muscidae is one of the most important ectoparasites of pastured cattle. Horn flies infestations reduce cattle weight gain and milk production. Additionally, horn flies are mechanical vectors of different pathogens that cause disease in cattle. The aim of this study was to conduct a functional genomics study in female horn flies using Expressed Sequence Tags (EST analysis and RNA interference (RNAi. Results A cDNA library was made from whole abdominal tissues collected from partially fed adult female horn flies. High quality horn fly ESTs (2,160 were sequenced and assembled into 992 unigenes (178 contigs and 814 singlets representing molecular functions such as serine proteases, cell metabolism, mitochondrial function, transcription and translation, transport, chromatin structure, vitellogenesis, cytoskeleton, DNA replication, cell response to stress and infection, cell proliferation and cell-cell interactions, intracellular trafficking and secretion, and development. Functional analyses were conducted using RNAi for the first time in horn flies. Gene knockdown by RNAi resulted in higher horn fly mortality (protease inhibitor functional group, reduced oviposition (vitellogenin, ferritin and vATPase groups or both (immune response and 5'-NUC groups when compared to controls. Silencing of ubiquitination ESTs did not affect horn fly mortality and ovisposition while gene knockdown in the ferritin and vATPse functional groups reduced mortality when compared to controls. Conclusions These results advanced the molecular characterization of this important ectoparasite and suggested candidate protective antigens for the development of vaccines for the control of horn fly infestations.

  5. Inhibitory effect of interferon gamma on frequency of Ehrlichia canis-infected cells in vitro. (United States)

    Tajima, Tomoko; Wada, Makoto


    Ehrlichia canis is an obligate intracellular bacterium that infects the macrophage-monocyte cells of dogs, causing canine monocytic ehrlichiosis. Interferon-γ (IFN-γ), along with other cytokines, mediates the immune response to such intracellular bacterial invasions. To determine the role of IFN-γ in the immunity of dogs to E. canis infection, peripheral blood mononuclear cells (PBMC) and white blood cells (WBC) were collected from E. canis-infected dogs and added to a culture of E. canis in DH82 cells. The number of E. canis inclusion-positive cells was significantly reduced in cultures containing PBMC and WBC from E. canis-infected dogs compared to uninfected dogs. However, this resistance was inhibited by the addition of an anti-dog IFN-γ antibody. Resistance was also observed when PBMC were added to the Cell Culture Inserts, which prohibited contact of PBMC to DH82 cells, while allowed the diffusion of soluble cell products. The results of this study indicate that resistance was not dependent on cell to cell contact, but was associated with soluble cell products, such as IFN-γ. The addition of recombinant canine IFN-γ to the E. canis culture also reduced the number of infected cells. A commercial recombinant canine IFN-γ, which is sold in Japan, was also effective at reducing E. canis-infected cell number. These results indicate that IFN-γ has an inhibitory effect on the frequency of E. canis-infected cells in vitro and that contact between effector and target cells is not necessary for the resistance.

  6. Use of an automated system for detection of canine serum antibodies against Ehrlichia canis glycoprotein 36. (United States)

    Moroff, Scott; Sokolchik, Irene; Woodring, Todd; Woodruff, Colby; Atkinson, Brett; Lappin, Michael R


    Ehrlichia canis is the most common cause of monocytotropic ehrlichiosis in dogs around the world. The purpose of the present study was to validate a new automated fluorescence system (Accuplex4™ BioCD system; Antech Diagnostics, Lake Success, New York) to detect antibodies against the E. canis immunodominant glycoprotein 36 (gp36). Sera and blood samples (ethylenediamine tetra-acetic acid) were collected from mixed sex beagles ( n = 8) on days 0, 3, 7, 10, 14, 17, 21, 28, 42, 49, 56, 63, 70, 77, 84, and 98 after intravenous inoculation with culture-derived E. canis. Sera were assayed using the Accuplex4 BioCD system (Accuplex4), an E. canis indirect fluorescent antibody test (IFAT), and a commercially available kit. A complete blood cell count and a proprietary E. canis polymerase chain reaction (PCR) were performed on each blood sample. On the day thrombocytopenia was first detected for each dog, E. canis DNA was amplified from blood of all dogs. At those times, E. canis antibodies were detected in 7 of 8 dogs by the Accuplex4, 1 of 8 dogs by the commercial kit, and 4 of 8 dogs by IFAT. Ehrlichia canis DNA was amplified from blood before seroconversion in any antibody assay for 6 dogs. Antibodies against gp36 were detected by Accuplex4 within 3 days of PCR-positive test results and were detected up to 25 days sooner than the commercial kit. After starting doxycycline treatment, E. canis DNA was no longer amplified by PCR assay, but serum antibodies remained detectable by all assays.

  7. Molecular identification and characterization of Anaplasma platys and Ehrlichia canis in dogs in Mexico. (United States)

    Almazán, Consuelo; González-Álvarez, Vicente H; Fernández de Mera, Isabel G; Cabezas-Cruz, Alejandro; Rodríguez-Martínez, Rafael; de la Fuente, José


    The tick-borne pathogens Ehrlichia canis and Anaplasma platys are the causative agents of canine monocytic ehrlichiosis (CME) and canine cyclic thrombocytopenia (CCT). Although molecular evidence of E. canis has been shown, phylogenetic analysis of this pathogen has not been performed and A. platys has not been identified in Mexico, where the tick vector Rhipicephalus sanguineus sensu lato (s.l.) is common. The aim of this research was to screen, identify and characterize E. canis and A. platys by PCR and phylogenetic analysis in dogs from La Comarca Lagunera, a region formed by three municipalities, Torreon, Gomez-Palacio and Lerdo, in the Northern states of Coahuila and Durango, Mexico. Blood samples and five engorged R. sanguineus s.l. ticks per animal were collected from 43 females and 57 male dogs presented to veterinary clinics or lived in the dog shelter from La Comarca Lagunera. All the sampled dogs were apparently healthy and PCR for Anaplasma 16S rRNA, Ehrlichia 16S rRNA, and E. canis trp36 were performed. PCR products were sequenced and used for phylogenetic analysis. PCR products were successfully amplified in 31% of the samples using primers for Anaplasma 16S rRNA, while 10% and 4% amplified products using primers for Ehrlichia 16S rRNA and E. canis trp36 respectively. Subsequent sequencing and phylogenetic analyses of these products showed that three samples corresponded to A. platys and four to E. canis. Based on the analysis of trp36 we confirmed that the E. canis strains isolated from Mexico belong to a conservative clade of E. canis and are closely related to strains from USA. In conclusion, this is the first molecular identification of A. platys and the first molecular characterization and phylogenetic study of both A. platys and E. canis in dogs in Mexico.

  8. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria. (United States)

    Burak Selek, Mehmet; Baylan, Orhan; Kutlu, Ali; Özyurt, Mustafa


    We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis), a parasite which subsists in dog's intestine, on serum samples obtained from patients with chronic urticaria (CU) to evaluate effective risk in CU etiopathogenesis. In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA) kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB) WB test. We found T. canis IgG positivity in 17.8% (n=13) of patients (n=73) with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109). Low molecular weight bands (24-35 kDa) were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity 12.9 times while insufficient daily hand washing habit (less than six times a day) increases seropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found 17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals. Moreover, various socio-demographic characteristics have been shown to affect T. canis seropositivity in patients with CU.

  9. Aislamiento de Brucella canis en un humano conviviente con caninos infectados. Informe de un caso.

    Directory of Open Access Journals (Sweden)

    Martha Olivera


    Full Text Available Objective: To report a case of bacteremia in a woman living in close contact with dogs infected with Brucella canis. Methods: Previous written consent of the woman a blood sample was taken to perform rapid agglutination test, immunofluorescence, and hemoculture. Results: Brucella canis was isolated and the isolation was confirmed by the Instituto Nacional ANLIS «Carlos G. Malbran» from Argentina. The woman did not present any symptoms associated with brucellosis. Conclusion: There is a risk of contamination by B. canis for people keeping tight contact with infected dogs.

  10. Classification of Babesia canis strains in Europe based on polymorphism of the Bc28.1-gene from the Babesia canis Bc28 multigene family. (United States)

    Carcy, B; Randazzo, S; Depoix, D; Adaszek, L; Cardoso, L; Baneth, G; Gorenflot, A; Schetters, T P


    The vast majority of clinical babesiosis cases in dogs in Europe is caused by Babesia canis. Although dogs can be vaccinated, the level of protection is highly variable, which might be due to genetic diversity of B. canis strains. One of the major merozoite surface antigens of B. canis is a protein with a Mr of 28 kDa that belongs to the Bc28 multigene family, that comprises at least two genes, Bc28.1 and a homologous Bc28.2 gene. The two genes are relatively conserved but they are very distinct in their 3' ends, enabling the design of specific primers. Sequencing of the Bc28.1 genes from 4 genetically distinct B. canis laboratory strains (A8, B, 34.01 and G) revealed 20 mutations at conserved positions of which three allowed the classification of B. canis strains into three main groups (A, B and 34.01/G) by RFLP. This assay was subsequently used to analyze blood samples of 394 dogs suspected of clinical babesiosis from nine countries in Europe. All blood samples were first analyzed with a previously described assay that allowed detection of the different Babesia species that infect dogs. Sixty one percent of the samples contained detectable levels of Babesia DNA. Of these, 98.3% were positive for B. canis, the remaining cases were positive for B. vogeli. Analysis of the Bc28.1 gene, performed on 178 of the B. canis samples, revealed an overall dominance of genotype B (62.4%), followed by genotypes A (37.1%) and 34 (11.8%). Interestingly, a great variation in the geographical distribution and prevalence of the three B. canis genotypes was observed; in the North-East genotype A predominated (72.1% A against 27.9% B), in contrast to the South-West where genotype B predominated (10.3% A against 89.7% B). In the central part of Europe intermediate levels were found (26.0-42.9% A against 74.0-57.1% B, from West to East). Genotype 34 was only identified in France (26.9% among 78 samples) and mostly as co-infection with genotypes A or B (61.9%). A comparative analysis of

  11. Probable Pulmonary Blastomycosis in a Wild Coyote (Canis latrans

    Directory of Open Access Journals (Sweden)

    Luis E. Rodríguez-Tovar


    Full Text Available A female coyote (Canis latrans was fatally injured by a vehicle on a road in San Luis Potosi, Mexico. Because of deteriorating clinical signs, the animal was euthanized. Postmortem examination of the lungs showed numerous small multifocal white nodules (0.5–1 cm diameter disseminated throughout. Histopathologic examination revealed multifocal coalescing granulomas with abundant macrophages, numerous neutrophils, fibroblasts, plasma cells, and lymphocytes. Abundant intracellular and extracellular thick-walled, refractile, spherical yeasts (10–15 μm were observed within the granulomas. The yeasts were intensely PAS-positive, with granular protoplasm. Broad-based single budding yeasts were occasionally present. Based on the microscopic findings of the pulmonary lesions and the morphological features of the organism, a diagnosis of chronic pyogranulomatous pneumonia caused by Blastomyces dermatitidis was made. To our knowledge, the case described herein is the first report of pulmonary blastomycosis in a wild coyote.

  12. Anthelmintic tests on Toxocara canis infection in mice. (United States)

    Holt, P E; Clarkson, M J; Kerslake, M


    One hundred and forty mice were infected orally with 1000 embryonated Toxocara canis eggs. Groups of 10 mice were then treated with high doses of piperazine, mebendazole, oxfendazole, albendazole, fenbendazole and diethylcarbamazine for four days, either immediately after infection or three weeks after infection. The mice were killed three to six weeks after treatment and the number of larvae in the brains and muscles estimated and compared with those in untreated mice. Few larvae were recovered from the muscles of any of the mice, including the untreated controls, despite the use of a variety of recognised techniques. Large numbers of live larvae were recovered from the brains of the mice and there was no significant difference between the treated and untreated mice.

  13. Searching for RR Lyrae stars in the Canis Major Overdensity

    CERN Document Server

    Mateu, Cecilia; Zinn, Robert; Miller, Lissa; .,; 10.1017/S1743921307008459


    The Canis Major overdensity (CMa) was initially proposed to be the remnant of a tidally disrupting dSph galaxy. Since its nature is still subject of debate, the goal of the present work was to conduct a large-scale RR Lyrae survey in CMa, in order to see if there is an overdensity of these stars. The survey spans a total area of ~34 sq. deg. with observations in V and R filters, made with the 1.0m Jurgen Stock Schmidt telescope at the National Astronomical Observatory of Venezuela. Current results in a subregion, including spectroscopic observations, show that the small number of RR Lyrae stars found can be accounted for by the halo and thick disk components of our Galaxy.

  14. Pulmonary neuroendocrine tumor in a female wolf (Canis lupus lupus) (United States)

    SHIRAKI, Ayako; YOSHIDA, Toshinori; KAWASHIMA, Masahi; MURAYAMA, Hirotada; NAGAHARA, Rei; ITO, Nanao; SHIBUTANI, Makoto


    A 17-year-old female wolf (Canis lupus lupus) had a right lung mass that was adhered to the thoracic cavity. Histopathological examination revealed that the mass consisted of sheets, cord or ribbon-like structures of monotonous, small, cuboidal cells with round, oval or short-spindle nuclei and scant clear cytoplasm, demarcated by a fine fibrovascular stroma. Focal necrosis, congestion and thrombi were observed. Immunohistochemically, the tumor cells diffusely expressed cytokeratin AE1/AE3, and some expressed chromogranin A, neural cell adhesion molecule (CD56) and thyroid transcription factor-1. The number of proliferating cell nuclear antigen-positive tumor cells was low. A diagnosis of pulmonary neuroendocrine tumor was based on the resemblance to carcinoids. PMID:28190820

  15. Prolonged intensive dominance behavior between gray wolves, Canis lupus (United States)

    Mech, L. David; Cluff, H. Dean


    Dominance is one of the most pervasive and important behaviors among wolves in a pack, yet its significance in free-ranging packs has been little studied. Insights into a behavior can often be gained by examining unusual examples of it. In the High Arctic near Eureka, Nunavut, Canada, we videotaped and described an unusually prolonged and intensive behavioral bout between an adult male Gray Wolf (Canis lupus) and a male member of his pack, thought to be a maturing son. With tail raised, the adult approached a male pack mate about 50 m from us and pinned and straddled this packmate repeatedly over 6.5 minutes, longer than we had ever seen in over 50 years of studying wolves. We interpreted this behavior as an extreme example of an adult wolf harassing a maturing offspring, perhaps in prelude to the offspring?s dispersal.

  16. Detection of Leishmania infantum in naturally infected Lutzomyia longipalpis (Diptera: Psychodidae: Phlebotominae) and Canis familiaris in Misiones, Argentina: the first report of a PCR-RFLP and sequencing-based confirmation assay. (United States)

    Acardi, Soraya Alejandra; Liotta, Domingo Javier; Santini, María Soledad; Romagosa, Carlo Mariano; Salomón, Oscar Daniel


    In this study, a genotypification of Leishmania was performed using polimerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and sequencing techniques to identify species of Leishmania parasites in phlebotomine sand flies and dogs naturally infected. Between January-February of 2009, CDC light traps were used to collect insect samples from 13 capture sites in the municipality of Posadas, which is located in the province of Misiones of Argentina. Sand flies identified as Lutzomyia longipalpis were grouped into 28 separate pools for molecular biological analysis. Canine samples were taken from lymph node aspirates of two symptomatic stray animals that had been positively diagnosed with canine visceral leishmaniasis. One vector pool of 10 sand flies (1 out of the 28 pools tested) and both of the canine samples tested positively for Leishmania infantum by PCR and RFLP analysis. PCR products were confirmed by sequencing and showed a maximum identity with L. infantum. Given that infection was detected in one out of the 28 pools and that at least one infected insect was infected, it was possible to infer an infection rate at least of 0.47% for Lu. longipalpis among the analyzed samples. These results contribute to incriminate Lu. longipalpis as the vector of L. infantum in the municipality of Posadas, where cases of the disease in humans and dogs have been reported since 2005.

  17. Hérnias toraco-lombares do tipo I e II na espécie canis lupus familiaris : prognóstico a curto prazo após tratamento cirúrgico


    Horta, Tânia Sofia Guerreiro


    Dissertação de Mestrado Integrado em Medicina Veterinária A hérnia de disco intervertebral (HDI) caracteriza-se pela extrusão (hérnia Hansen tipo I) ou pela protrusão (hérnia Hansen tipo II) de um ou mais discos intervertebrais, mais comummente na região toraco-lombar, que pelo efeito de massa no canal medular ou pela concussão da medula espinhal, ou por ambos, causam uma disfunção neurológica do segmento medular afectado. Os sinais neurológicos podem variar desde ataxia e dor (menor gravi...

  18. Canis familiaris (carnívora: Canidae) como sentinelas da saúde animal e humana no Parque Estadual do Ibitipoca e entorno, município de Lima Duarte MG, Brasil.


    Julio Cesar Rocha Costa


    A presença de cães domésticos em Unidades de Conservação é uma realidade bastante comum no Brasil. Problema sério e de difícil resolução ocasionado principalmente pelo abandono ou descuido de cães por seus proprietários. Hábito que pode ser a causa de sérios problemas ambientais, como a interferência destes animais domésticos em diversos aspectos da sobrevivência de populações silvestres e na estabilidade ecológica de ecossistemas. Além disso, cães errantes e ou ferais podem carrear vários pa...

  19. A placebo-controlled study to investigate the effect of Dog Appeasing Pheromone and other environmental and management factors on the reports of disturbance and house soiling during the night in recently adopted puppies (Canis familiaris


    Taylor, Katy; Mills, Daniel S


    Disturbance and house soiling during the night are common problems faced by the new puppy dog owner. They may result as consequence of a mismatch between the developmental status of the puppy and its new environment and/or separation distress in a typically social animal. The aim of this study was to examine the effect of Dog Appeasing Pheromone (DAP, Ceva Santé Animale) as well as a range of other management and environmental factors that might affect this process. It has been suggested tha...

  20. Iron metabolism and oxidative profile of dogs naturally infected by Ehrlichia canis: Acute and subclinical disease. (United States)

    Bottari, Nathieli B; Crivellenti, Leandro Z; Borin-Crivellenti, Sofia; Oliveira, Jéssica R; Coelho, Stefanie B; Contin, Catarina M; Tatsch, Etiane; Moresco, Rafael N; Santana, Aureo E; Tonin, Alexandre A; Tinucci-Costa, Mirela; Da Silva, Aleksandro S


    The aim of this study was to evaluate the oxidant profile and iron metabolism in serum of dogs infected by Ehrlichia canis. Banked sera samples of dogs were divided into two groups: negative control (n = 17) and infected by E. canis on acute (n = 24), and subclinical (n = 18) phases of the disease. The eritrogram, leucogram, and platelet counts were evaluate as well as iron, ferritin, and transferrin levels, latent iron binding capacity (LIBC), and transferrin saturation index (TSI) concentration. In addition, the advanced oxidation protein products (AOPP) and ferric reducing ability of plasma (FRAP) in sera were also analyzed. Blood samples were examined for the presence of E. canis by PCR techniques. History and clinical signals were recorded for each dog. During the acute phase of the disease, infected animals showed thrombocytopenia and anemia when compared to healthy animals (P canis showed changes in the iron metabolism and developed an oxidant status in consequence of disease pathophysiology.

  1. First isolation and molecular characterization of Ehrlichia canis in Costa Rica, Central America. (United States)

    Romero, L E; Meneses, A I; Salazar, L; Jiménez, M; Romero, J J; Aguiar, D M; Labruna, M B; Dolz, G


    The present study investigated Ehrlichia species in blood samples from dogs suspected of clinical ehrlichiosis, using molecular and isolation techniques in cell culture. From a total of 310 canine blood samples analyzed by 16S rRNA nested PCR, 148 (47.7%) were positive for Ehrlichia canis. DNA from Ehrlichia chaffeensis or Ehrlichia ewingii was not detected in any sample using species-specific primers in separated reactions. Leukocytes from five PCR-positive dogs were inoculated into DH82 cells; successful isolation of E. canis was obtained in four samples. Partial sequence of the dsb gene of eight canine blood samples (including the five samples for in vitro isolation) was obtained by PCR and their analyses through BLAST showed 100% of identity with the corresponding sequence of E. canis in GenBank. This study represents the first molecular diagnosis, isolation, and molecular characterization of E. canis in dogs from Costa Rica.

  2. First molecular detection of Ehrlichia canis and Anaplasma platys in ticks from dogs in Cebu, Philippines. (United States)

    Ybañez, Adrian P; Perez, Zandro O; Gabotero, Shirleny R; Yandug, Ryan T; Kotaro, Matsumoto; Inokuma, Hisashi


    Ehrlichia canis infection of dogs in the Philippines has been detected by serological and peripheral blood smear examination methods, but not by molecular means. Anaplasma platys infection in dogs has not yet been officially reported, although it is suspected to occur in the country. Thus, sensitive and specific molecular techniques were used in this study to demonstrate the presence of both E. canis and A. platys in the Philippines. A total of 164 Rhipicephalus sanguineus ticks was collected from 36 dogs. Seven tick samples were found positive with E. canis and one sample with A. platys. To further characterize these pathogens, molecular analyses based on citrate synthase and heat-shock operon genes were also performed. Philippine strains were found to be not divergent from strains from other countries. The present results are the first molecular detection and analyses of E. canis and A. platys in ticks from dogs in the Philippines.

  3. Genetic blueprint of the zoonotic pathogen Toxocara canis

    DEFF Research Database (Denmark)

    Zhu, Xing-Quan; Korhonen, Pasi K.; Cai, Huimin


    Toxocara canis is a zoonotic parasite of major socioeconomic importance worldwide. In humans, this nematode causes disease (toxocariasis) mainly in the under-privileged communities in developed and developing countries. Although relatively well studied from clinical and epidemiological perspectives...

  4. Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Maisa Leite de Queiroz


    Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.

  5. Evidence for unapparent Brucella canis infections among adults with occupational exposure to dogs. (United States)

    Krueger, W S; Lucero, N E; Brower, A; Heil, G L; Gray, G C


    Human serological assays designed to detect brucellosis will miss infections caused by Brucella canis, and low levels of periodic bacteremia limit diagnosis by blood culture. Recent B. canis outbreaks in dogs and concomitant illnesses in caretakers suggest that unapparent human infections may be occurring. With more than a quarter of a million persons in occupations involving dogs, and nearly 80 million dog owners in the United States, this pathogen is an under-recognized human health threat. To investigate occupational exposure to B. canis, we adapted a commercial canine serological assay and present the first controlled seroepidemiological study of human B. canis infections in recent years. 306 adults with occupational exposure to dogs and 101 non-matched, non-canine-exposed subjects were enrolled. Antibodies were detected using the canine D-Tec(®) CB rapid slide agglutination test (RSAT) kit with a secondary 2-mercaptoethanol (ME)-RSAT. Results were validated on a blinded subset of sera with an additional RSAT and indirect enzyme-linked immunoassay at the National Administration of Laboratories and Health Institutes (ANLIS) in Argentina. Seroprevalence ranged from 10.8% (RSAT) to 3.6% (ME-RSAT) among canine-exposed subjects. Kennel employees were more likely to test RSAT seropositive compared with other canine exposures (OR = 2.7; 95% CI, 1.3-5.8); however, low seroprevalence limited meaningful occupational risk factor analyses. Two seropositive participants reported experiencing symptoms consistent with brucellosis and having exposure to B. canis-infected dogs; however, temporality of symptom onset with reported exposure could not be determined. D-Tec(®) CB results had substantial agreement with ANLIS assays (Cohen's kappa = 0.60-0.68). These data add to a growing body of literature suggesting that people occupationally exposed to dogs may be at risk of unapparent B. canis infection. It seems prudent to consider B. canis as an occupational public health

  6. Brucella canis Is an Intracellular Pathogen That Induces a Lower Proinflammatory Response than Smooth Zoonotic Counterparts (United States)

    Chacón-Díaz, Carlos; Altamirano-Silva, Pamela; González-Espinoza, Gabriela; Medina, María-Concepción; Alfaro-Alarcón, Alejandro; Bouza-Mora, Laura; Jiménez-Rojas, César; Wong, Melissa; Barquero-Calvo, Elías; Rojas, Norman; Guzmán-Verri, Caterina


    Canine brucellosis caused by Brucella canis is a disease of dogs and a zoonotic risk. B. canis harbors most of the virulence determinants defined for the genus, but its pathogenic strategy remains unclear since it has not been demonstrated that this natural rough bacterium is an intracellular pathogen. Studies of B. canis outbreaks in kennel facilities indicated that infected dogs displaying clinical signs did not present hematological alterations. A virulent B. canis strain isolated from those outbreaks readily replicated in different organs of mice for a protracted period. However, the levels of tumor necrosis factor alpha, interleukin-6 (IL-6), and IL-12 in serum were close to background levels. Furthermore, B. canis induced lower levels of gamma interferon, less inflammation of the spleen, and a reduced number of granulomas in the liver in mice than did B. abortus. When the interaction of B. canis with cells was studied ex vivo, two patterns were observed, a predominant scattered cell-associated pattern of nonviable bacteria and an infrequent intracellular replicative pattern of viable bacteria in a perinuclear location. The second pattern, responsible for the increase in intracellular multiplication, was dependent on the type IV secretion system VirB and was seen only if the inoculum used for cell infections was in early exponential phase. Intracellular replicative B. canis followed an intracellular trafficking route undistinguishable from that of B. abortus. Although B. canis induces a lower proinflammatory response and has a stealthier replication cycle, it still displays the pathogenic properties of the genus and the ability to persist in infected organs based on the ability to multiply intracellularly. PMID:26438796



    MATA-SANTOS, Taís; PINTO, Nitza França; Hilton Antônio MATA-SANTOS; DE MOURA, Kelly Gallan; Carneiro, Paula Fernandes; CARVALHO, Tatiane dos Santos; DEL RIO, Karina Pena; PINTO, Maria do Carmo Freire Ribeiro; MARTINS, Lourdes Rodrigues; Juliana Montelli FENALTI; da Silva, Pedro Eduardo Almeida; Scaini, Carlos James


    Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis) is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate) of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubate...

  8. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria

    Directory of Open Access Journals (Sweden)

    Mehmet Burak-Selek


    Full Text Available We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis, a parasite which subsists in dog’s intestine, on serum samples obtained from patients with chronic urticaria (CU to evaluate effective risk in CU etiopathogenesis.In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB WB test.We found T. canis IgG positivity in 17.8% (n=13 of patients (n=73 with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109. Low molecular weight bands (24-35 kDa were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity12.9 times while insufficient daily hand washing habit (less than six times a day increasesseropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals.Moreover, various socio-demographic characteristics have been shown to affect T. canisseropositivity in patients with CU. 



    Paulino R., Analí; Laboratorio de Patología Clínica y Biología Molecular, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima-Perú.; Li E., Olga; Laboratorio de Patología Clínica y Biología Molecular, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima-Perú.; Hoyos S., Luis; Laboratorio de Patología Clínica y Biología Molecular, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima, Perú.; Suárez A., Francisco; Laboratorio de Medicina Veterinaria Preventiva, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima.; Díaz C., Diego; Clínica de Animales Menores, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima


    The aim of the present study was to detect seropositivity against Ehrlichia canis and Ehrlichia chaffeensis in staff of veterinary clinics and in persons that had contact with dogs affected by canine ehrlichosis using the indirect immunofluorescence test. Ninety serum samples were used, 55 men and 35 women. Results indicated 23.3% of seropositivity to E. canis and 20.0% to E. chaffeensis, without statistical differences due to gender. El objetivo del presente estudio fue determinar la pres...

  10. Experimental infection and co-infection of dogs with Anaplasma platys and Ehrlichia canis: hematologic, serologic and molecular findings

    Directory of Open Access Journals (Sweden)

    Diniz PPVP


    Full Text Available Abstract Background Rhipicephalus sanguineus is a ubiquitous tick responsible for transmitting Ehrlichia canis and most likely Anaplasma platys to dogs, as either single or co-infections. The objective of this study was to assess the effects of either simultaneous or sequential experimental infections with E. canis and A. platys on hematological and serological parameters, duration of infection, and efficacy of doxycycline therapy in dogs infected with one or both organisms. Six dogs per group were either uninfected, A. platys infected, E. canis infected, A. platys and E. canis co-infected, A. platys infected and E. canis challenged or E. canis infected and A. platys challenged at day 112 post-infection (PI. Doxycycline treatment was initiated at 211 days PI, followed by dexamethasone immunosuppression beginning 410 days PI. Results Initially, transient decreases in hematocrit occurred in all groups infected with E. canis, but the mean hematocrit was significantly lower in the A. platys and E. canis co-infected group. All dogs except the controls developed marked thrombocytopenia after initial infection followed by gradually increased platelet counts by 112 days PI in groups with the single infections, while platelet counts remained significantly lower in the A. platys and E. canis co-infected group. Both sequential and simultaneous infections of A. platys and E. canis produced an enhanced humoral immune response to A. platys when compared to infection with A. platys alone. Likewise, co-infection with E. canis and A. platys resulted in a more persistent A. platys infection compared to dogs infected with A. platys only, but nearly all A. platys infected dogs became A. platys PCR negative prior to doxycycline treatment. E. canis infected dogs, whether single or co-infected, remained thrombocytopenic and E. canis PCR positive in blood for 420 days. When treated with doxycycline, all E. canis infected dogs became E. canis PCR negative and the

  11. Molecular Diagnosis of Ehrlichia canis in Dogs and Ticks Rhipicephalus sanguineus (Acari: Ixodidae) in Yucatan, Mexico. (United States)

    Pat-Nah, Henry; Rodriguez-Vivas, Roger Ivan; Bolio-Gonzalez, Manuel Emilio; Villegas-Perez, Sandra Luz; Reyes-Novelo, Enrique


    Ehrlichia canis is the etiological agent behind canine monocytic ehrlichiosis, and the tick Rhipicephalus sanguineus (Latreille) is its main vector. Blood smear and nested polymerase chain reaction (PCR) techniques were used to identify E. canis infection in dogs and R. sanguineus, and explore factors possibly associated with infection in dogs in Yucatan, Mexico. Blood samples were taken and ticks R. sanguineus collected from 50 dogs (10 house dogs and 40 in an animal control center). Data were collected on dog age, sex, body condition, and signs associated with platelet deficiencies (epistaxis). Blood smears were analyzed to identify E. canis morulae and generate platelet counts. Nested PCR analysis was done on blood samples and 200 ticks. A χ(2) test was done to identify factors associated with the E. canis infection in the tested dogs. The overall prevalence for infection, as determined by PCR, was 36% (18 out of 50). All positive dogs were from samples collected from the animal shelter, representing prevalence, for this sampling site, of 45% (18 out of 40). Morulae in monocytes were identified in only 4% of samples. Dog origin (i.e. animal control center) was the only variable associated with E. canis infection (P canis infection is present in both dogs and the brown dog ticks R. sanguineus in Yucatan, Mexico.

  12. Ehrlichial infection in Cameroonian canines by Ehrlichia canis and Ehrlichia ewingii. (United States)

    Ndip, L M; Ndip, R N; Esemu, S N; Dickmu, V L; Fokam, E B; Walker, D H; McBride, J W


    Ehrlichia chaffeensis and Ehrlichia ewingii are agents of emerging human ehrlichioses in North America and are transmitted primarily by Amblyomma americanum ticks, while Ehrlichia canis is the globally distributed cause of canine monocytic ehrlichiosis (CME) and is transmitted by the brown dog tick, Rhipicephalus sanguineus. Although E. canis and Ehrlichia ruminantium are endemic in Africa, the presence of ehrlichial agents in dogs and ticks in Cameroon has not been investigated. The objective of this study was to determine the prevalence of ehrlichial infections in Cameronian dogs using a combination of serologic and molecular methods. Peripheral blood was collected, clinical signs and the presence or absence of ticks on dogs (n=104) presenting for various reasons at local veterinary clinics around the Mount Cameroon region were noted. IFA identified 33 dogs (32%) with antibodies reactive with E. canis, and reactivity of these sera with all major E. canis antigens (200, 140, 95, 75, 47, 36, 28, and 19-kDa) was confirmed by immunoblotting. Multicolor real-time PCR detected ehrlichial DNA (E. canis (15) and E. ewingii (2)) in 17 dogs (16.3%), all of which had attached ticks at time of presentation. The dsb amplicons (378 bp) from E. canis and E. ewingii were identical to gene sequences from North American isolates. This study identifies canine ehrlichiosis as a prevalent unrecognized cause of disease in Cameroonian canines.

  13. Molecular detection of Ehrlichia canis and Anaplasma platys in dogs in Southern Brazil. (United States)

    Lasta, Camila Serina; dos Santos, Andrea Pires; Messick, Joanne Belle; Oliveira, Simone Tostes; Biondo, Alexander Welker; Vieira, Rafael Felipe da Costa; Dalmolin, Magnus Larruscaim; González, Félix Hilario Diaz


    The aims of this study were to determine the occurrence of Anaplasma platys and Ehrlichia canis infection in dogs in Porto Alegre, Southern Brazil; and to investigate their association with hematological abnormalities. Serum samples from 196 dogs were first tested using dot-ELISA for antibodies against Anaplasma spp. and Ehrlichia canis. Peripheral blood samples from 199 dogs were subjected to 16S rRNA nested PCR (nPCR) for A. platys and E. canis, followed by DNA sequencing to ensure pathogen identity. A total of 19/196 samples (9.69%) were positive for Anaplasma spp. using ELISA and 28/199 (14.07%) samples were positive for A. platys by nested PCR. All the dog samples were negative for E. canis, both in anti-E. canis antibody tests and in nested PCR. There were no significant differences in hematological parameters between A. platys-PCR positive and negative dogs and Anaplasma spp. serologically positive dogs, except for basophil counts, which were higher in nPCR-positive dogs. This is the first report showing A. platys presence in dogs in Southern Brazil. In conclusion, hematological parameters may not be sufficient to diagnose A. platys infection in dogs in Southern Brazil, probably due either to low pathogenicity or to chronic infection. On the other hand, E. canis may either have very low occurrence or be absent in dogs in Porto Alegre.

  14. Novel genotype of Ehrlichia canis detected in samples of human blood bank donors in Costa Rica. (United States)

    Bouza-Mora, Laura; Dolz, Gaby; Solórzano-Morales, Antony; Romero-Zuñiga, Juan José; Salazar-Sánchez, Lizbeth; Labruna, Marcelo B; Aguiar, Daniel M


    This study focuses on the detection and identification of DNA and antibodies to Ehrlichia spp. in samples of blood bank donors in Costa Rica using molecular and serological techniques. Presence of Ehrlichia canis was determined in 10 (3.6%) out of 280 blood samples using polymerase chain reaction (PCR) targeting the ehrlichial dsb conserved gene. Analysis of the ehrlichial trp36 polymorphic gene in these 10 samples revealed substantial polymorphism among the E. canis genotypes, including divergent tandem repeat sequences. Nucleotide sequences of dsb and trp36 amplicons revealed a novel genotype of E. canis in blood bank donors from Costa Rica. Indirect immunofluorescence assay (IFA) detected antibodies in 35 (35%) of 100 serum samples evaluated. Thirty samples showed low endpoint titers (64-256) to E. canis, whereas five sera yielded high endpoint titers (1024-8192); these five samples were also E. canis-PCR positive. These findings represent the first report of the presence of E. canis in humans in Central America.

  15. The occurrence of Dirofilaria immitis, Borrelia burgdorferi, Ehrlichia canis and Anaplasma phagocytophium in dogs in China. (United States)

    Xia, Z; Yu, D; Mao, J; Zhang, Z; Yu, J


    A survey of the occurrence of Dirofilaria immitis, Borrelia burgdorferi, Ehrlichia canis and Anaplasma phagocytophium in dogs was undertaken in the People's Republic of China between October 2008 and October 2009. A total of 600 blood samples were taken from dogs in four cities in China: 300 in Beijing, 150 in Shenzhen, 30 in Shanghai and 120 in Zhengzhou. All samples were tested for the heartworm antigen and antibodies of canine B. burgdorferi, E. canis and A. phagocytophium by using the canine SNAP® 4Dx® test kit. The occurrence of D. immitis, B. burgdorferi, E. canis and A. phagocytophium was 1.17% (7/600), 0.17% (1/600), 2.17% (13/600) and 0.5% (3/600), respectively. In Shenzhen city 2% (3/150), 8.67% (13/150) and 2% (3/150) of samples were positive for D. immitis, E. canis and A. phagocytophium, respectively. The occurrence of heartworm antigen was 0.33% (1/300) in Beijing, 2.00% (3/150) in Shenzhen, 3.33% (1/30) in Shanghai and 1.67% (2/120) in Zhengzhou. We found E. canis and A. phagocytophium only at one site, Shenzhen, while the only occurrence of B. burgdorferi was at Beijing. In conclusion, the dog population in China is at potential risk for D. immitis, B. burgdorferi, E. canis and A. phagocytophium infection, the risk being especially high in southern China.

  16. Sequence and phylogenetic analysis of the gp200 protein of Ehrlichia canis from dogs in Taiwan. (United States)

    Huang, Chia-Chia; Hsieh, Yu-Chen; Tsang, Chau-Loong; Chung, Yang-Tsung


    Ehrlichia (E.) canis is a Gram-negative obligate intracellular bacterium responsible for canine monocytic ehrlichiosis. Currently, the genetic diversity of E. canis strains worldwide is poorly defined. In the present study, sequence analysis of the nearly full-length 16S rDNA (1,620 bp) and the complete coding region (4,269 bp) of the gp200 gene, which encodes the largest major immunoreactive protein in E. canis, from 17 Taiwanese samples was conducted. The resultant 16S rDNA sequences were found to be identical to each other and have very high homology (99.4~100%) with previously reported E. canis sequences. Additionally, phylogenetic analysis of gp200 demonstrated that the E. canis Taiwanese genotype was genetically distinct from other reported isolates obtained from the United States, Brazil, and Israel, and that it formed a separate clade. Remarkable variations unique to the Taiwanese genotype were found throughout the deduced amino acid sequence of gp200, including 15 substitutions occurring in two of five known species-specific epitopes. The gp200 amino acid sequences of the Taiwanese genotype bore 94.4~94.6 identities with those of the isolates from the United States and Brazil, and 93.7% homology with that of the Israeli isolate. Taken together, these results suggest that the Taiwanese genotype represents a novel strain of E. canis that has not yet been characterized.

  17. Occurrence of different strains of Babesia canis in dogs in eastern Poland

    Directory of Open Access Journals (Sweden)

    Łyp Paweł


    Full Text Available Introduction: The aim of this study was to carry out a genetic analysis of Babesia canis isolates detected in dogs in eastern Poland and to study the correlation of the protozoa variant with a specific geographical region. Material and Methods: PCR was used to identify strains of B. canis from naturally infected animals (240 dogs from four provinces: Mazowieckie, Lublin, Podlasie, and Podkarpacie by amplifying and sequencing a fragment of the 18S rRNA gene. Results: Sequencing the PCR products led to the identification of four variants of B. canis. Two previously described protozoa variants (18S rRNA-A and 18S rRNA-B were observed in all provinces. Additionally, in the Mazowieckie and Lublin provinces a B. canis variant which contributed to the development of acute or atypical babesiosis was observed. The fourth variant of B. canis was detected only in dogs from the Lublin province, and the course of the disease was subclinical in all dogs infected with this variant. Conclusion: These results indicate the appearance of a new fourth B. canis genotype in Poland and confirm that it is still necessary to study the relationships between the genetic structure of protozoa, geographical distribution of the parasites, and clinical course of the disease.

  18. Identification and characterization of the arginine deiminase system of Streptococcus canis. (United States)

    Hitzmann, A; Bergmann, S; Rohde, M; Chhatwal, G S; Fulde, M


    Although Streptococcus (S.) canis is known to cause severe infections in dogs and cats and harbors a clear zoonotic potential, knowledge about physiology and pathogenesis is mostly elusive. The arginine deiminase system (ADS) has been described in certain streptococcal species and its role in the establishment of infection has been suggested. In this study we focused on the identification and characterization of the ADS in S. canis. Using genome sequencing and subsequent in silico analysis we identified the ADS of S. canis as a gene cluster composed of seven genes. RT-PCR analysis revealed that the ADS of S. canis is transcribed in four transcriptional units, comprising three monocistronical mRNAs and one operon structure. As a secondary metabolic pathway, the ADS of S. canis is strictly regulated by carbon catabolite repression (CCR) and arginine as demonstrated on transcriptional, translational, and enzymatical level, respectively. Furthermore, growth kinetics with a chemically defined medium clearly showed that arginine, the substrate of the ADS, is essential for the biological fitness of S. canis. Using Immuno-electron microscopy analysis, we observed a surface-exposed localization of the ADS enzymes arginine deiminase (ArcA), ornithine carbamoyltransferase (ArcB), and carbamate kinase (ArcC), respectively, which might suggest the contribution of the ADS to the development of streptococcal infections.

  19. Predation on the black capuchin monkey Cebus nigritus (Primates: Cebidae by domestic dogs Canis lupus familiaris (Carnivora: Canidae, in the Parque Estadual Serra do Brigadeiro, Minas Gerais, Brazil Predação de macaco-prego Cebus nigritus (Primates: Cebidae por cães domésticos Canis lupus familiaris (Carnivora: Canidae, no Parque Estadual da Serra do Brigadeiro, Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Valeska B. de Oliveira


    Full Text Available Predation on an adult male black capuchin monkey, Cebus nigritus (Goldfuss, 1809 by two domestic dogs was observed in the Parque Estadual Serra do Brigadeiro, in the Atlantic Forest of southeastern Minas Gerais. Predation occurred in an area of well preserved native forest 800 m from the nearest forest edge. This is the first confirmed record of predation by domestic dogs in this reserve, yet data from a study in the same area indicates that the domestic dog is the most frequently recorded mammal species, which suggests that it is common in the area. The few published reports indicate that this problem occurs in other conservation units in Brazil and should, therefore, be treated with more rigor by the environmental agencies.A predação de um macho adulto de macaco-prego, Cebus nigritus (Goldfuss, 1809 por dois cães-domésticos é relatada no interior do Parque Estadual da Serra do Brigadeiro, localizado na Mata Atlântica do sudeste de Minas Gerais. A observação foi registrada em local de mata nativa bem preservada, a cerca de 800 m da borda mais próxima da reserva. Embora este seja o primeiro registro confirmado de predação por cão doméstico nesta unidade de conservação, dados de um estudo sobre a mastofauna local, usando parcelas de pegadas, indicam que o cão-doméstico é a espécie de mamífero mais freqüentemente registrada, sugerindo que sua presença é constante e amplamente distribuída na área. Os poucos relatos existentes na literatura indicam que este problema está presente em outras unidades de conservação e deveria, portanto, ser tratado com maior rigor pelas agências ambientais.

  20. Analysis on Nutrient Compositions and Nutritional Quality of Lota lota( Linnaeus) Muscle

    Institute of Scientific and Technical Information of China (English)

    Xu; Gefeng; Wang; Yuyu; Bai; Qingli; Li; Xiaolong; Jia; Zhonghe


    In order to evaluate the nutritional quality of Lota lota(Linnaeus) muscle,the common nutrient components,amino acid composition and fatty acid composition in muscle of wild Lota lota(captured in Hailang reaches of Mudan River) were determined by routine methods. The results showed that the contents of moisture,crude protein,crude fat and ash were 81. 82%,15. 93%,0. 44% and 1. 06% in fresh muscle of Lota lota,respectively. Totally 17 amino acids,including seven kinds of essential amino acids(EAA),were detected in dry muscle of Lota lota(Linnaeus),accounting for 72. 43% of total dry muscle. The content of EAA was 29. 82%,accounting for 41. 17% of TAA,meeting the amino acid composition of high-quality protein standard required by Food and Agriculture Organization /Word Health Organization(FAO /WHO). There were four delicious amino acids(DAA) in dry muscle,accounting for 28. 34% of total dry weight.The percentage of DAA to TAA was 39. 13% in dry muscle. The contents of C20:5n- 3(EPA) and C22:6n- 3(DHA) in dry muscle were 8. 65% and 20. 32%respectively,which were significantly higher than that of the artificially cultured fish species,such as Oxyeleotris marmorata(EPA:2. 24%,DHA:4. 74%),Spinibarbus sinensis(EPA:0. 87%,DHA:3. 08%) and Glossogobius giuris(EPA: 3. 94%,DHA: 8. 10%). Based on the amino acids score(AAS) and chemical score(CS),the first limited amino acid in Lota lota(Linnaeus) was sulfur-containing amino acid(methionine + cysteine). The essential amino acids index(EAAI) of Lota lota(Linnaeus) was 62.58. It is concluded that Lota lota(Linnaeus) is abundant in amino acids and high-unsaturated fatty acids,and rational in composition of amino acids. Thus,Lota lota(Linnaeus) is a high quality freshwater fish with high nutritional value and health value,possessing good exploitation and utilization prospects.

  1. Development of a loop-mediated isothermal amplification (LAMP) assay for rapid diagnosis of Babesia canis infections. (United States)

    Müller, H; Aysul, N; Liu, Z; Salih, D A; Karagenc, T; Beyer, D; Kullmann, B; Ahmed, J S; Seitzer, U


    Vector-borne diseases are rising in interest due to global warming, which is believed to impact on the distribution of vectors into new areas thus influencing the occurrence and epidemiology of vector-borne pathogens. Babesia canis belongs to the Piroplasmidae and there are three described subspecies, namely B. canis canis, B. canis rossi and B. canis vogeli. They are each transmitted by a different tick-species, Dermacentor reticulatus, Haemaphysalis leachi and Rhipicephalus sanguineus, respectively. There are also differences in the geographical distribution and pathogenicity to dogs of each subspecies. In this study, we aimed to establish a rapid and easy to perform DNA-based test using loop-mediated isothermal amplification to detect all three Babesia canis subspecies in one assay.

  2. Brucella canis: inquéritos sorológico e bacteriológico em população felina Brucella canis: serological and bacteriological surveys in the feline population

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson


    Full Text Available De 134 soros de felinos domésticos examinados pela prova de soroaglutinação lenta em tubos, 4 (3% foram positivos para Brucella canis, todos com título igual a 100. Não se obteve êxito na tentativa de isolamento de Brucella canis através de hemocultura desses animais.Of the 134 feline sera tested by tube agglutination test, 4 (3% were positive for Brucella canis antibodies, all with titer 100. It was not possible to isolate Brucella canis by blood culture in the case of these animals.

  3. Factors associated with Ehrlichia canis infection in dogs infested with ticks from Huánuco, Peru


    Huerto-Medina, Edward; Facultad de Medicina Veterinaria. Universidad Nacional Hermilio Valdizán. Huánuco, Perú.; Dámaso-Mata, Bernardo; Facultad de Medicina. Universidad Nacional Hermilio Valdizán. Huánuco, Perú.


    The aim of the study was to determine the frequency and associated factors of Ehrlichia canis infection in dogs. Bloodsamples from 150 dogs infested with ticks in 10 veterinary clinics in the city of Huanuco in Peru were collected. The dogswere randomly selected without regard to breed, age or sex. Ehrlichia canis antibodies were detected by chromatographicimmunoassay.51.3% of dogs were infected with Ehrlichia canis. In the multivariate analysis, factors associated with thepresence of Ehrlich...

  4. IgG antibody responses in mice coinfected with Toxocara canis and other helminths or protozoan parasites. (United States)

    Lescano, Susana A Zevallos; Nakhle, Maria Cristina; Ribeiro, Manoel Carlos S A; Chieffi, Pedro Paulo


    The immune response expressed by IgG antibodies in BALB/c mice experimentally infected with Toxocara canis, was studied with the aim of verifying the possible in vivo cross-reactivity between antigens of T. canis and other parasites (Ascaris suum, Taenia crassiceps, Schistosoma mansoni, Strongyloides venezuelensis and Toxoplasma gondii). Experiments included three groups of mice: one infected only by T. canis, another with one of the other species of parasites and a third concomitantly infected with T. canis and the other species in question. Animals were bled by orbital plexus at 23, 38 and 70 days post infection (p.i.). Sera were analyzed for anti-Toxocara antibodies by ELISA and Immunoblotting, using excretion-secretion antigens (ES), obtained from culture of third-stage larvae of T. canis. For all experiments a control group comprised by ten non-infected mice was used. Only in the case of A. suum infection, in these experimental conditions, the occurrence of cross-reactivity with T. canis was observed. However, in the case of co-infection of T. canis - S. mansoni, T. canis - S. venezuelensis and T. canis - T. crassiceps the production of anti-Toxocara antibodies was found at levels significantly lower than those found in mice infected with T. canis only. Co-infection with S. mansoni or S. venezuelensis showed lower mortality rates compared to what occurred in the animals with single infections. Results obtained in mice infected with T. canis and T. gondii showed significant differences between the mean levels of the optical densities of animals infected with T. canis and concomitantly infected with the protozoan only in the 23rd day p.i.

  5. IgG Antibody responses in mice coinfected with Toxocara canis and other helminths or protozoan parasites

    Directory of Open Access Journals (Sweden)

    Susana A. Zevallos Lescano


    Full Text Available The immune response expressed by IgG antibodies in BALB/c mice experimentally infected with Toxocara canis, was studied with the aim of verifying the possible in vivo cross-reactivity between antigens of T. canis and other parasites (Ascaris suum, Taenia crassiceps, Schistosoma mansoni, Strongyloides venezuelensis and Toxoplasma gondii. Experiments included three groups of mice: one infected only by T. canis, another with one of the other species of parasites and a third concomitantly infected with T. canis and the other species in question. Animals were bled by orbital plexus at 23, 38 and 70 days post infection (p.i.. Sera were analyzed for anti-Toxocara antibodies by ELISA and Immunoblotting, using excretion-secretion antigens (ES, obtained from culture of third-stage larvae of T. canis. For all experiments a control group comprised by ten non-infected mice was used. Only in the case of A. suum infection, in these experimental conditions, the occurrence of cross-reactivity with T. canis was observed. However, in the case of co-infection of T. canis - S. mansoni, T. canis - S. venezuelensis and T. canis - T. crassiceps the production of anti-Toxocara antibodies was found at levels significantly lower than those found in mice infected with T. canis only. Co-infection with S. mansoni or S. venezuelensis showed lower mortality rates compared to what occurred in the animals with single infections. Results obtained in mice infected with T. canis and T. gondii showed significant differences between the mean levels of the optical densities of animals infected with T. canis and concomitantly infected with the protozoan only in the 23rd day p.i.

  6. Transmission of Ehrlichia canis by Rhipicephalus sanguineus ticks feeding on dogs and on artificial membranes. (United States)

    Fourie, Josephus J; Stanneck, Dorothee; Luus, Herman G; Beugnet, Frederic; Wijnveld, Michiel; Jongejan, Frans


    A South African strain of Ehrlichia canis was isolated and used to infect a laboratory-bred Beagle dog. Rhipicephalus sanguineus nymphs, which fed on this dog, moulted to adult ticks which carried infection rates of E. canis between 12% and 19% and were used in a series of in vivo and in vitro experiments. Five groups of 6 dogs were challenged with the infected R. sanguineus ticks, which were removed 24h, 12h, 6h or 3h after the ticks had been released onto the dogs. The animals were monitored for fever and thrombocytopenia and were considered infected if they became serologically positive for E. canis antibodies as well as PCR positive for E. canis DNA. Seven dogs became infected with E. canis in the following groups: Group 1 (24h tick challenge) 1 out of 6; Group 2 (12h) 1 of 6; Group 3 (6h) 2 of 6; Group 4 (6h) 2 of 6 and Group 5 (3h) 1 out of 6. Six of those 7 infected dogs developed fever and a significant thrombocytopenia. One dog did not show any symptoms, but seroconverted and was found PCR positive on several occasions. Five additional dogs were PCR positive on one test sample only but were not considered infected because they did not develop any specific E. canis antibodies. In vitro, R. sanguineus ticks attached and fed on bovine blood through silicone membranes with attachment rates up to 72.5% after 24h increasing to 84.2% at 72 h. The ticks transmitted E. canis as soon as 8h post application as demonstrated by E. canis DNA found in the nutritive blood medium. In conclusion, transmission of E. canis by R. sanguineus ticks starts within a few hours after attachment, which is earlier than previously thought. These findings underpin the need for acaricides to provide either a repellent, an anti-attachment and/or a rapid killing effect against ticks in order to decrease the risk of transmission of E. canis.

  7. The mortality of Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae induced by powdered plants

    Directory of Open Access Journals (Sweden)

    Kłyś Małgorzata


    Full Text Available The aim of this study was to investigate whether powdered plants of different species namely: peppermint Mentha piperita (L. (Lamiaceae, wormwood Artemisia absinthium (L. (Asteraceae, common sage Salvia officinalis (L. (Lamiaceae, allspice Pimenta dioica (Linnaeus et Merrill (Myrtaceae and common garlic Allium sativum (L. (Amaryllidaceae, added to semolina using concentrations of 1.23, 3.61, and 5.88%, influence the mortality rate in the saw-toothed grain beetle Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae. Experiments were conducted in a laboratory at 28°C and relative humidity 60±5%. At the concentration of 1.23%, allspice seeds caused the highest mortality amongst the saw-toothed grain beetle. When concentrations of 3.61 and 5.88% were used, sage, peppermint and wormwood caused the highest statistically significant mortality of O. surinamensis

  8. An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico

    Directory of Open Access Journals (Sweden)

    Alejandro Salinas-Castro


    Full Text Available An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico. Larvae of Cydia pomonella (Linnaeus, 1758 were discovered on floral cones of Magnolia schiedeana (Schltdl, 1864 near the natural reserve of La Martinica, Veracruz, México. Magnolia represents an unusual host for this moth species, which is known throughout the world as the "codling moth", a serious pest of fruits of Rosaceae, especially apples. The larvae were identified using taxonomic keys, and identification was corroborated using molecular markers. Further sampling resulted in no additional larvae, hence, the observation was probably that of an ovipositional error by the female, and M. schiedeana is not at risk of attack by this important moth pest.

  9. Phylogeography of the Golden Jackal (Canis aureus) in India. (United States)

    Yumnam, Bibek; Negi, Tripti; Maldonado, Jesús E; Fleischer, Robert C; Jhala, Yadvendradev V


    The golden jackal (Canis aureus) is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt) DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster) mtDNA lineages. In the present study, we sequenced 440 basepairs (bp) of control region (CR) and 412 bp of cytochrome b (cyt b) gene of mtDNA from 62 golden jackals sampled from India (n = 55), Israel (n = 2) and Bulgaria (n = 5), to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian) golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history in India

  10. Extraction, characterization and application of gelatina obtained from nile tilapia scale, Oreochromis niloticus (Linnaeus, 1758)


    Maria Emanuella de Oliveira Martins


    Nile tilapia, Oreochromis niloticus (Linnaeus, 1758), is one of the most cultivated species in our country. The fish processing industries generate large amounts of waste. In the tilapia processing waste materials represent more than 60%. Collagen is the main protein of connective tissue and is the most abundant protein in mammals, birds and fish. A commercial use of the collagen is gelatin, obtained by partial hydrolysis of collagen. Edible coatings and films are types of protection that can...

  11. Scale insect species names combined with the genus name Chermes Linnaeus (Hemiptera: Sternorrhyncha: Coccomorpha). (United States)

    Williams, D J


    Species names in the scale insects that have been combined with the genus name Chermes Linnaeus, 1758, are listed. This list supplements a list published already for the Sternorrhyncha but that was restricted to names of species that had been described originally in the genus. The present list includes, in addition, all species names in the scale insects that have been combined with the name Chermes. 

  12. Progress of Chemical Composition and Pharmacological Effects of Meretrix meretrix Linnaeus

    Institute of Scientific and Technical Information of China (English)

    Du; Zhengcai; Hou; Xiaotao; Huang; Qing; Deng; Jiagang; Fanshi; Fangcao


    Meretrix meretrix Linnaeus is a traditional marine drug. There are more than two thousand years of history using clamshell as a component of medicine.After a review of relevant literature at home and abroad for nearly 20 years,the author summarized chemical composition and pharmacological effects of M. meretrix,in order to provide a scientific basis for further development and utilization of M. meretrix.

  13. Four cases of pediculosis caused by Pthirus pubis Linnaeus, 1758 (Diptera: Anoplura) from peninsular Malaysia. (United States)

    Pakeer, O; Jeffery, J; Mohamed, A M; Ahmad, F; Baharudin, O


    Four cases of pediculosis, two in adults and two in children, caused by the crab-louse, Pthirus pubis Linnaeus, 1758 (Diptera: Anoplura) is reported from peninsular Malaysia. This is the second report of the problem to be documented from the country. Although P. pubis is closely associated with genital hairs, it is, however, also found to occur on the eyelashes, eyebrows, hairs of the body, head and axilla. The few reported cases of pthiriasis probably do not reflect the true situation.

  14. Grammoplites vittatus (Valenciennes), (Scorpaeniformes, Platycephalidae), removed from synonymy with Grammoplites scaber (Linnaeus). (United States)

    Knapp, Leslie W; Imamura, Hisashi


    Grammoplites vittatus (Valenciennes), often previously overlooked by authors or regarded as a junior synonym of G. scaber (Linnaeus), is shown here to be a valid species.  It has more gill rakers (7-8) then G. scaber and G. knappi (usually 6) and a narrower interorbital width than G. scaber.  A key to the species of Grammoplites Fowler is  given. 

  15. First detection and molecular characterization of Ehrlichia canis from dogs in Nigeria. (United States)

    Kamani, Joshua; Lee, Chung-Chan; Haruna, Ayuba M; Chung, Ping-Jun; Weka, Paul R; Chung, Yang-Tsung


    The present study aimed to detect the presence of Ehrlichia canis in naturally infected dogs in Nigeria, using a combination of PCR and sequence analysis of the 16S rRNA gene and two genes encoding the tandem repeat-containing proteins (TRPs), TRP19 and TRP36. Out of a total of 100 blood samples collected from domestic dogs presented to veterinary hospitals in Jos, the capital city of Plateau State of Nigeria, 11 were positive in nested PCR for E. canis. Sequencing results for these amplicons showed that all of the 16S rDNA sequences (1623 bp) or the TRP19 coding sequences (414 bp) were identical to each other and had very high similarities (99.3-100%) with those from other E. canis strains accessible in GenBank. The TRP36 gene sequences derived from the 11 Nigerian isolates were identical to each other except for the number of the 27-bp repeat unit in a tandem repeat region, which was found to be 8, 12 or 18. Without considering the number of tandem repeats, these sequences had 100% identity to that of the reported Cameroon 71 isolate, but distinctly differed from those obtained from other geographically distant E. canis strains previously published. A phylogenetic tree of E. canis based on the TRP36 amino acid sequences showed that the Nigerian isolates and the Cameroon 71 isolate fell into a separate clade, indicating that they may share a common ancestor. Overall, this study not only provides the first molecular evidence of E. canis infections in dogs from Nigeria but also highlights the value of the TRP36 gene as a tool to classify E. canis isolates and to elucidate their phylogeographic relationships.

  16. Digital gene expression analysis of Microsporum canis exposed to berberine chloride.

    Directory of Open Access Journals (Sweden)

    Chen-Wen Xiao

    Full Text Available Berberine, a natural isoquinoline alkaloid of many medicinal herbs, has an active function against a variety of microbial infections including Microsporum canis (M. canis. However, the underlying mechanisms are poorly understood. To study the effect of berberine chloride on M. canis infection, a Digital Gene Expression (DGE tag profiling was constructed and a transcriptome analysis of the M. canis cellular responses upon berberine treatment was performed. Illumina/Hisseq sequencing technique was used to generate the data of gene expression profile, and the following enrichment analysis of Gene Ontology (GO and Pathway function were conducted based on the data of transcriptome. The results of DGE showed that there were 8476945, 14256722, 7708575, 5669955, 6565513 and 9303468 tags respectively, which was obtained from M. canis incubated with berberine or control DMSO. 8,783 genes were totally mapped, and 1,890 genes have shown significant changes between the two groups. 1,030 genes were up-regulated and 860 genes were down-regulated (P<0.05 in berberine treated group compared to the control group. Besides, twenty-three GO terms were identified by Gene Ontology functional enrichment analysis, such as calcium-transporting ATPase activity, 2-oxoglutarate metabolic process, valine catabolic process, peroxisome and unfolded protein binding. Pathway significant enrichment analysis indicated 6 signaling pathways that are significant, including steroid biosynthesis, steroid hormone biosynthesis, Parkinson's disease, 2,4-Dichlorobenzoate degradation, and tropane, piperidine and Isoquinoline alkaloid biosynthesis. Among these, eleven selected genes were further verified by qRT-PCR. Our findings provide a comprehensive view on the gene expression profile of M. canis upon berberine treatment, and shed light on its complicated effects on M. canis.

  17. Babesia canis and other tick-borne infections in dogs in Central Poland. (United States)

    Welc-Faleciak, Renata; Rodo, Anna; Siński, Edward; Bajer, Anna


    Vector-borne infections constitute increasing health problem in dogs worldwide, including sled dogs, dramatically decreasing the fitness of working dogs and even leading to death. In the period 2006-2008 eighty-two blood samples were collected from eight sled dog kennels in Central Poland. The prevalence of four vector-borne infections (Babesia canis, Bartonella sp., Anaplasma/Ehrlichia and Borrelia burgdorferi) was estimated in 82 sled dogs using PCR and nested PCR for diagnosis and the same methods were used to identify the vector-borne pathogens in 26 dogs presenting at veterinary clinics with symptoms of vector-borne diseases. None of four studied vector-borne pathogens was detected in samples originating from veterinary clinics. Among the remaining 82 dogs B. canis infections were confirmed in three dogs undergoing treatment for babesiosis. The DNA of tick-borne pathogens was also found among 22 (27.8%) of the 79 apparently healthy dogs, including 20 cases of B. canis infection (25.3%), one case of B. burgdorferi s.l. infection and one case of Anaplasma phagocytophilum infection. No evidence of Bartonella spp. and Ehrlichia canis infections were found in this set of samples. Sequencing of a Babesia fragment of 18S rDNA amplified from acute (n=5) and asymptomatic (n=5) cases revealed that all isolates were identical to the Babesia canis canis sequence, originally isolated from Dermacentor reticulatus ticks in Poland. A range of factors was shown to affect the distribution of babesiosis in sled dogs. The data are also discussed in respect to the health risk factors generated by asymptomatic B. canis infections and the efficiency of chemoprophylaxis measures taken by sled dog owners.

  18. Validation of an ELISA method for the serological diagnosis of canine brucellosis due to Brucella canis. (United States)

    de Oliveira, Maria Zoraida Daltro; Vale, Vera; Keid, Lara; Freire, Songeli Menezes; Meyer, Roberto; Portela, Ricardo Wagner; Barrouin-Melo, Stella Maria


    In the present study, the validation of an enzyme-linked immunosorbent assay (ELISA) for serodiagnosis of canine brucellosis is described. Two different antigenic extracts, obtained by heat or ultrasonic homogenization of microbial antigens from a wild isolate of Brucella canis bacteria, were compared by ELISA and Western blot (WB). A total of 145 canine sera were used to define sensitivity, specificity and accuracy of the ELISA as follows: (1) sera from 34 animals with natural B. canis infection, confirmed by blood culture and PCR, as well as 51 sera samples from healthy dogs with negative results by the agar-gel immunodiffusion (AGID) test for canine brucellosis, were used as the control panel for B. canis infection; and (2) to scrutinize the possibility of cross reactions with other common dog infections in the same geographical area in Brazil, 60 sera samples from dogs harboring known infections by Leptospira sp., Ehrlichia canis, canine distemper virus (CDV), Neospora caninum, Babesia canis and Leishmania chagasi (10 in each group) were included in the study. The ELISA using heat soluble bacterial extract (HE-antigen) as antigen showed the best values of sensitivity (91.18%), specificity (100%) and accuracy (96.47%). In the WB analyses, the HE-antigen showed no cross-reactivity with sera from dogs with different infections, while the B. canis sonicate had various protein bands identified by those sera. The performance of the ELISA standardized with the heat soluble B. canis antigen indicates that this assay can be used as a reliable and practical method to confirm infection by this microorganism, as well as a tool for seroepidemiological studies.

  19. Critical analysis of vector-borne infections in dogs: Babesia vogeli, Babesia gibsoni, Ehrlichia canis and Hepatozoon canis in Punjab, India. (United States)

    Singla, Lachhman Das; Sumbria, Deepak; Mandhotra, Ajay; Bal, M S; Kaur, Paramjit


    There are few published studies on various vector borne diseases of dogs in India and most depict clinical infection in dogs, diagnosed by observation of the haemopathogens in stained blood smears. This study provides the first report regarding molecular confirmation and ancestral relationship analysis of blood smears positive cases of assorted haemopathogens in Punjab province of India. On blood smear examination, haemopathogens were observed in 124 out of 778 (15.95%, 95% CI: 13.53- 18.68) blood smears. Further polymerase chain reactions (PCR) was used on bloods smear positive cases to validate the results. Out of 778 blood samples, Babesia gibsoni was most common parasite infecting dogs (15.04%, 95% CI: 12.7-17.72), followed by Ehrlichia canis (0.39%, 95% CI: 0.0-1.13), infection of Babesia vogeli and Hepatozoon canis was same (0.26%, 95% CI: 0.0-0.9). Among various risk factors studied (age, sex, season), prevalence of infection was non-significantly higher in 1-2 year of age group (19.88%, 95% CI: 14.45-26.71), regarding sex same prevalence was recorded (15.94%), and chances of infection was highest in pre-monsoon i.e. summer (18.26%, 95% CI: 14.49-22.76). Phylogenetic analysis revealed ancestral background of Ludhiana isolates of B. vogeli, B. gibsoni, H. canis, and E. canis with the isolates of Philippines, Mongolia and Tunisia.

  20. Large dust grains in the wind of VY Canis Majoris

    CERN Document Server

    Scicluna, P; Wesson, R; Blommaert, J A D L; Kasper, M; Voshchinnikov, N V; Wolf, S


    Massive stars live short lives, losing large amounts of mass through their stellar wind. Their mass is a key factor determining how and when they explode as supernovae, enriching the interstellar medium with heavy elements and dust. During the red supergiant phase, mass-loss rates increase prodigiously, but the driving mechanism has proven elusive. Here we present high-contrast optical polarimetric-imaging observations of the extreme red supergiant VY Canis Majoris and its clumpy, dusty, mass-loss envelope, using the new extreme-adaptive-optics instrument SPHERE at the VLT. These observations allow us to make the first direct and unambiguous detection of submicron dust grains in the ejecta; we derive an average grain radius $\\sim$ 0.5 $\\mu$m, 50 times larger than in the diffuse ISM, large enough to receive significant radiation pressure by photon scattering. We find evidence for varying grain sizes throughout the ejecta, highlighting the dynamical nature of the envelope. Grains with 0.5 $\\mu$m sizes are likel...

  1. Diet of wolves Canis lupus returning to Hungary. (United States)

    Lanszki, József; Márkus, Márta; Ujváry, Dóra; Szabó, Adám; Szemethy, László


    At the end of the nineteenth century, the wolf Canis lupus was extinct in Hungary and in recent decades has returned to the northern highland area of the country. The diet of wolves living in groups in Aggteleki National Park was investigated using scat analysis (n = 81 scats) and prey remains (n = 31 carcasses). Throughout the year wolves (average, minimum two wolves per year) consumed mostly wild-living ungulates (mean percent of biomass consumed, B% 97.2%; relative frequency of occurrence, %O 74.0%). The wild boar Sus scrofa was the most common prey item found in wolf scat (%B 35.6%) and is also the most commonly occurring ungulate in the study areas. The second most commonly occurring prey item in wolf scat was red deer Cervus elaphus (B% 32.8%). Conversely, prey remain analyses revealed wild boar as the second most commonly utilised prey species (%O 16.1%) after red deer (%O 67.7%). The roe deer Capreolus capreolus that occurs at lower population densities was the third most commonly utilised prey species. The importance of low population density mouflon Ovis aries, livestock and other food types was low. The results are similar to those found in the northern part of the Carpathian Mountains.

  2. Inbreeding and inbreeding depression in endangered red wolves (Canis rufus). (United States)

    Brzeski, Kristin E; Rabon, David R; Chamberlain, Michael J; Waits, Lisette P; Taylor, Sabrina S


    In natural populations, the expression and severity of inbreeding depression can vary widely across taxa. Describing processes that influence the extent of inbreeding and inbreeding depression aid in our understanding of the evolutionary history of mating systems such as cooperative breeding and nonrandom mate selection. Such findings also help shape wildlife conservation theory because inbreeding depression reduces the viability of small populations. We evaluated the extent of inbreeding and inbreeding depression in a small, re-introduced population of red wolves (Canis rufus) in North Carolina. Since red wolves were first re-introduced in 1987, pedigree inbreeding coefficients (f) increased considerably and almost every wild born wolf was inbred (average f = 0.154 and max f = 0.383). The large inbreeding coefficients were due to both background relatedness associated with few founders and numerous close relative matings. Inbreeding depression was most evident for adult body size and generally absent for direct fitness measures such as reproductive success and survival; no lethal equivalents (LE = 0.00) were detected in juvenile survival. The lack of strong inbreeding depression in direct measures of fitness could be due to a founder effect or because there were no outbred individuals for comparison. Our results highlight the variable expression of inbreeding depression across traits and the need to measure a number of different traits when evaluating inbreeding depression in a wild population.

  3. Medical management of pyometra in three red wolves (Canis rufus). (United States)

    Anderson, Kadie; Wolf, Karen N


    Pyometra is a serious, life-threatening disease of both domestic and non-domestic species often requiring ovariohysterectomy to preserve the life of the animal. Medical management of pyometra has been successful in domestic and non-domestic species, and the consideration of such treatment is of marked importance in a critically endangered species. Of the canids, the red wolf (Canis rufus) is second only to African hunting dogs (Lycaon pictus) in terms of the prevalence of both cystic endometrial hyperplasia and pyometra. In this report, three red wolves were medically managed for pyometra. Aside from vaginal discharge, none of the wolves exhibited clinical signs, nor were there reflective inflammatory changes in the laboratory findings. All wolves received standard treatment for pyometra, including prostaglandin F2alpha and antibiotic therapy, while one wolf was more aggressively managed with uterine lavage. Pyometra recurred in two of the treated wolves, while the most aggressively managed wolf continues to show ultrasonographic resolution 2 yr posttreatment. Aggressive medical management of pyometra should be considered a treatment option in certain red wolf females, as it may preserve the animal's reproductive potential.

  4. Helminth parasites of the wolf Canis lupus from Latvia. (United States)

    Bagrade, G; Kirjusina, M; Vismanis, K; Ozoliņs, J


    Thirty-four wolves were collected between 2003 and 2008 from throughout Latvia and examined for helminths. A total of 17 helminth species were recorded: the trematode Alaria alata (85.3%); the cestodes Diphyllobothrium latum (2.9%), Echinococcus granulosus (2.9%), Echinococcus multilocularis (5.9%), Mesocestoides lineatus (5.9%), Taenia crassiceps (8.8%), Taenia hydatigena (41.2%), Taenia (ovis) krabbei (8.8%), Taenia multiceps (47.1%), Taenia pisiformis (20.6%), Taenia polyacantha (11.8%), Taenia spp. (8.8%); and the nematodes Ancylostoma caninum (2.9%), Crenosoma vulpis (9.1%), Eucoleus aerophilus (36.4%), Pearsonema plica (41.4%), Trichinella spp. (69.7%), Toxocara canis (5.8%), and Uncinaria stenocephala (41.2%). Alaria alata presented the highest mean intensity (403.8). All animals were infected with at least one species of parasite, while the maximum recorded in one specimen was eight. No differences in the intensity or prevalence of any helminth species were found among the host based on age and gender, except for T. multiceps which was more prevalent in adults than in juveniles.

  5. Retrospective analysis of clinical and laboratory findings in hunting dogs with serologic reactions to tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Ricketsia conorii

    Directory of Open Access Journals (Sweden)

    Spasojević-Kosić Ljubica


    Full Text Available Seroprevalence of tick-borne infections in endemic areas could be high. In this study, we investigated the seroprevalence of tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Rickettsia conorii in hunting dogs, naturally infected with one or more pathogens. Serological test results of the investigated animals were compared to those from clinical examination, as well as from haematological and biochemical analyses. A total of 74.14% dogs were seropositive (R.conorii 44.83%, B. canis 32.76%, B. burgdorferi 25.86%, E. canis 13.79%, A. phagocytophilum 8.47%, with 25.86% of dogs seropositive to two pathogens, 15.52% seropositive to three pathogens, and 1.72% of dogs seropositive to four pathogens. Among all registered clinical signs, only pyrexia (p<0.05 and arrhythmia (p<0.05 were significant in seropositive dogs. There was no significant difference between seropositive and seronegative dogs regarding the majority of haematological and biochemical parameters. Statistically significant difference was registered for particular haematological (number of red blood cells and seroreactivity to B. burgdorferi and biochemical parameters (albumin concentration and seroreactivity to E. canis, and AST and seroreactivity to R. conorii but these values were not clinically significant. The high exposure to tick-borne pathogens suggests that ectoparasitic profilactic treatment is not adequate in examined population of hunting dogs. Clinical finding of pyrexia need to be further investigated and explained etiologically, which means that molecular diagnosis should be used in order to identify larger number of pathogens because of the possibility of coinfection. [Projekat Ministarstva nauke Republike Srbije, br. TR 31084

  6. Gene : CBRC-FCAT-01-0270 [SEVENS

    Lifescience Database Archive (English)


  7. Gene : CBRC-PHAM-01-1587 [SEVENS

    Lifescience Database Archive (English)


  8. Gene : CBRC-EEUR-01-1482 [SEVENS

    Lifescience Database Archive (English)


  9. Synovial fluid cytology in experimental acute canine monocytic ehrlichiosis (Ehrlichia canis). (United States)

    Theodorou, Konstantina; Leontides, Leonidas; Siarkou, Victoria I; Petanides, Theodoros; Tsafas, Konstantinos; Harrus, Shimon; Mylonakis, Mathios E


    Evidence-based information of a cause-and-effect relationship between Ehrlichia canis infection and polyarthritis in naturally- or experimentally-infected dogs is currently lacking. The aim of this prospective study was to investigate whether synovial fluid cytological evidence of arthritis could be documented in dogs with acute monocytic ehrlichiosis. Direct synovial fluid cytology smears from eight Beagle dogs experimentally infected with E. canis were examined prior to, and on 21, 35 and 63 days post-inoculation. The cytological variables assessed included cellularity, percentages of mononuclear cells and neutrophils, macrophage reactivity and evidence of E. canis morulae. The median cellularity and percentages of mononuclear cells and neutrophils prior to inoculation did not differ when compared to post-inoculation cytological evaluation. Increased cellularity, E. canis morulae or cytological evidence of arthritis or macrophage reactivity were not observed throughout the course of the study. In the present study, no cytological evidence of arthritis was found in dogs with experimental acute canine monocytic ehrlichiosis, suggesting that E. canis infection should be considered a rather uncommon cause of arthritis in dogs.

  10. Occurrence of Ehrlichia canis and Anaplasma platys in household dogs from northern Parana. (United States)

    da Silva, Gislaine Cristina Ferreira; Benitez, Aline do Nascimento; Girotto, Aline; Taroda, Alessandra; Vidotto, Marilda Carlos; Garcia, João Luis; de Freitas, Julio Cesar; Arlington, Selwyn Headley; Vidotto, Odilon


    Canine monocytic ehrlichiosis caused primarily by Ehrlichia canis and canine thrombocytic anaplasmosis induced by Anaplasma platys are important emerging zoonotic tick-borne diseases of dogs. There is evidence that these pathogens can also affect humans. This study evaluated the presence of E. canis and A. platys in blood samples collected from 256 domiciled dogs in the municipality of Jataizinho, located in north region of the State of Parana, Brazil, by PCR assay. The occurrence of E. canis and A. platys was 16.4% (42/256) and 19.4% (49/256), respectively; while 5.47% (14/256) of the dogs evaluated were co-infected by these two organisms. The presence of E. canis and A. platys was not significantly associated with the variables evaluated (sex, age, outdoor access, and presence of ticks during blood collection). Infection of dogs by E. canis was associated with anemia and thrombocytopenia, while infection induced by A. platys was related only to thrombocytopenia. Canine monocytic ehrlichiosis and canine thrombocytic anaplasmosis should be included in the differential diagnoses when these hematological alterations are observed during routine laboratory evaluation of dogs.

  11. First record of autochthonous canine ehrlichiosis caused by Ehrlichia canis in Romania. (United States)

    Morar, Doru; Dărăbuş, Gheorghe; Imre, Mirela; Ilie, Marius Stelian; Imre, Kálmán


    This case study describes the first genetically confirmed and clinically manifested autochthonous Ehrlichia canis infection in a 9-year-old female mixed-breed dog from Romania. Health screening of the dog included clinical examination, evaluation of stained peripheral blood smear and hematologic variables, as well as serologic testing and molecular analysis. Clinical signs included fever, apathy, dehydration, pale mucous membranes, and weakness. The microscopic examination of the blood smear and immunologic assays for Borrelia burgdorferi, Anaplasma phagocytophilum, and E canis antibodies, and for Dirofilaria immitis antigen yielded negative results. Hematologic abnormalities included moderate nonregenerative anemia, leucopenia with neutropenia, and moderate thrombocytopenia. The biochemical abnormalities identified were hypoalbuminemia, and mildly increased serum enzyme activities of AST and ALT. In addition, increased urea and creatinine levels associated with low urine specific gravity and proteinuria were also present. Nested PCR amplification of the partial E canis 16S rRNA gene demonstrated the presence of this rickettsial pathogen in the dog's blood, which subsequently was confirmed through sequencing based on the 100% homology with GenBank deposited E canis isolates. After specific treatment with doxycycline (10 mg/kg, orally, SID) for one month, the proteinuria, and hematologic and serum biochemical abnormalities with the exception of mild azotemia resolved. This report supports the geographical expansion of canine ehrlichiosis caused by E canis in nonendemic regions of Europe.

  12. Urinary creatinine to serum creatinine ratio and renal failure index in dogs infected with Babesia canis. (United States)

    Zygner, Wojciech; Gójska-Zygner, Olga; Wesołowska, Agnieszka; Wędrychowicz, Halina


    Urinary creatinine to serum creatinine (UCr/SCr) ratio and renal failure index (RFI) are useful indices of renal damage. Both UCr/SCr ratio and RFI are used in differentiation between prerenal azotaemia and acute tubular necrosis. In this work the authors calculated the UCr/SCr ratio and RFI in dogs infected with Babesia canis and the values of these indices in azotaemic dogs infected with the parasite. The results of this study showed significantly lower UCr/SCr ratio in dogs infected with B. canis than in healthy dogs. Moreover, in azotaemic dogs infected with B. canis the UCr/SCr ratio was significantly lower and the RFI was significantly higher than in non-azotaemic dogs infected with B. canis. The calculated correlation between RFI and duration of the disease before diagnosis and treatment was high, positive and statistically significant (r = 0.89, p < 0.001). The results of this study showed that during the course of canine babesiosis caused by B. canis in Poland acute tubular necrosis may develop.

  13. Babesia canis vogeli infection in dogs and ticks in the semiarid region of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Andreina C. Araujo


    Full Text Available Abstract:This study aimed to report the prevalence of Babesia canis vogeli in dogs and ticks in the urban and rural areas of Petrolina, Pernambuco. Serum and peripheral blood samples of 404 dogs were tested by indirect immunofluorescence assay (IFA and by blood smears, respectively. The presence of tick infestation was evaluated, and some specimens were submitted to DNA amplification by polymerase chain reaction (PCR. The presence of antibodies anti-B. canis vogeli was determinate in 57.9% (234/404 of dogs. The direct detection of Babesia spp was obtained in 0.5% (2/404 dogs by visualization of intraerythrocytic forms. Infestation by Rhipicephalus sanguineus sensu lato was observed in 54.5% (220/404 of dogs in both urban and rural areas. DNA of Babesia canis vogeli were obtained by PCR in 6% individual (3/50 and 8.7% of pool of ticks (7/80. The risk factors for the presence of anti-B. canis vogeli antibodies, as determined through the application of logistic regression models (P<0.05, were the following: medium breed size variables (P<0.001; contact with areas of forest (P=0.021; and access on the street (P=0.046. This study describes, for the first time, the confirmation of infection of B. canis vogeli in dogs and ticks in the semiarid region of Pernambuco, Brazil.

  14. Short communication: Streptococcus canis is able to establish a persistent udder infection in a dairy herd. (United States)

    Król, Jarosław; Twardoń, Jan; Mrowiec, Jacek; Podkowik, Magdalena; Dejneka, Grzegorz; Dębski, Bogdan; Nowicki, Tadeusz; Zalewski, Wojciech


    Bovine mastitis caused by Streptococcus canis is relatively rare. Consequently, many epidemiologic aspects of the infection, including factors that mediate crossing of host species barriers by the pathogen, infectiousness of the microorganism to the mammary gland, and the course of the disease within a herd, are still not elucidated. Therefore, the aim of the present study was to describe results of a 15-mo observation of subclinical Strep. canis mastitis on a dairy farm housing 76 lactating Holstein-Friesian cows. Upon 3 visits to the farm during a period between April 2013 and June 2014, Strep. canis was cultured from milk samples of 17 (22.4% of the herd), 7 (9.6%), and 8 (11.3%) cows, respectively. The isolates obtained were characterized phenotypically by means of the API Strep identification kit (bioMérieux, Marcy l'Etoile, France), as well as genetically by using random amplified polymorphic DNA and macrorestriction analysis of the chromosomal DNA by pulsed-field gel electrophoresis. All strains displayed the same biochemical features, and the molecular methods revealed that the isolates belonged to a single clone or were very closely related. Results of the study indicate that Strep. canis is capable of causing intramammary infections of long duration, behaving in a contagious manner. Because a persistently infected cow may serve as the source of Strep. canis infection for other animals, effective control of this type of udder infection within a herd may require similar measures to those adopted in Streptococcus agalactiae eradication programs.

  15. The efficacy of Advantix® to prevent transmission of Ehrlichia canis to dogs by Rhipicephalus sanguineus ticks. (United States)

    Fourie, Josephus Johannes; Luus, Herman Gerhardus; Stanneck, Dorothee; Jongejan, Frans


    The capacity of a topical combination of imidacloprid and permethrin (Advantix(®)) to prevent transmission of Ehrlichia canis was studied in two groups of six dogs. One group served as controls, whereas the other group was treated. All dogs were exposed to E. canis-infected Rhipicephalus sanguineus ticks on Days 7, 14, 21 and Day 28 post acaricidal treatment. The adult R. sanguineus ticks were released into the individual kennels of the dogs to simulate natural tick exposure. In situ tick counts were conducted on Day 9, 16 and 23 and any remaining ticks were counted and removed on Day 30. The efficacy of the acaricidal treatment against R. sanguineus ranged between 96.1% and 98.9% at 48 h post-application and lasted up to 4 weeks. Four out of six control dogs became infected with E. canis, as demonstrated by the presence of specific E. canis antibodies and the detection by PCR of E. canis DNA in blood samples. These dogs became thrombocytopenic and displayed fever and were consecutively rescue-treated by doxycycline. None of the six treated dogs became infected with E. canis, as confirmed by the lack of specific antibodies and absence of E. canis DNA in blood samples. Advantix(®) prevented transmission of E. canis and provided protection against monocytic ehrlichiosis for 4 weeks post acaricidal treatment.

  16. 78 FR 54614 - Endangered and Threatened Wildlife and Plants; Removing the Gray Wolf (Canis lupus) From the List... (United States)


    ... Fish and Wildlife Service 50 CFR Part 17 RIN 1018-AY00 Endangered and Threatened Wildlife and Plants... Protections for the Mexican Wolf (Canis lupus baileyi) by Listing It as Endangered AGENCY: Fish and Wildlife... endangered status for the Mexican wolf by listing it as a subspecies (Canis lupus baileyi), and we...

  17. 78 FR 35663 - Endangered and Threatened Wildlife and Plants; Removing the Gray Wolf (Canis lupus) From the List... (United States)


    ... and Threatened Wildlife and Plants; Removing the Gray Wolf (Canis lupus) From the List of Endangered and Threatened Wildlife and Maintaining Protections for the Mexican Wolf (Canis lupus baileyi ) by Listing It as Endangered; Proposed Revision to the Nonessential Experimental Population of the...

  18. Chromosome analysis in the Kruger National Park - the chromosomes of the saddle-backed jackal Canis Mesomelas

    Directory of Open Access Journals (Sweden)

    C. Wallace


    Full Text Available Among the present-day members of the Canidae family are included the dogs and foxes (Wurster and Benirschke 1968. The genus Canis is represented in Africa by four species of jackal (Bigaike 1972. This paper presents the chromosome Findings in a male saddle-backed jackal Canis mesomelas studied in the Kruger National Park, Republic of South Africa.

  19. Babesia canis and Babesia rossi co-infection in an untraveled Nigerian dog. (United States)

    Kamani, Joshua; Sannusi, Abdulrahim; Dogo, A Goni; Tanko, James T; Egwu, Kinsley O; Tafarki, Agbadu E; Ogo, Isaac N; Kemza, Sarah; Onovoh, Emmanuel; Shamaki, David; Lombin, Lami H; Catto, Victoria; Birkenheuer, Adam J


    A sexually intact 6-month-old female Alsatian dog was presented to the Veterinary Clinic of the National Veterinary Research Institute, Vom, Plateau State, Nigeria, for the following complaints: anorexia, hemoglobinuria, fever, tick infestation and general malaise. Microscopy revealed piroplasms with a wide range of sizes (1-5 μm in length) in red blood cells, raising a suspicion of a co-infection with two or more Babesia species. Specific PCR assays for canine Babesia spp. and DNA sequencing revealed the presence of Babesia canis and Babesia rossi co-infection. This study constitutes the first report of co-infection with B. canis and B. rossi in the West African sub-region and the first report of autochthonous B. canis on the African continent. Practitioners should be aware of potential changes in the species/sub-species of Babesia causing canine babesiosis in this region.

  20. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie


    Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples......; 25 routine specimens from patients suspected of having dermatophytosis; 10 hair specimens from guinea pigs experimentally infected with M. canis; and two samples from un-infected control animals. DNA was prepared by a 10-min procedure from pure cultures as previously described. The 302 bp PCR product...... was obtained for 35/35 Trichophyton isolates (10 species included) and the 279 bp for 3/3 M. canis and 4/4 M. audouinii samples. None of the 2 E. floccosum, 11 M. gypseum, 3 M M. persicolor or 12 control samples (yeast, mould, human DNA) were positive with either of the two PCR tests. Among the patient...

  1. Isozyme variation of Microsporum canis and M. cookei from New Zealand. (United States)

    Simpanya, M F; Jarvis, B D; Baxter, M


    Fifty-four isolates of Microsporum canis (Arthroderma otae) from humans, cats and dogs obtained from Auckland, Palmerston North and Wellington, New Zealand and 18 M. cookei and two Diheterospori spp. from soils were examined for variation using eight isozyme loci. M. canis isolates were from infected and non-infected cases. Isozyme analysis separated the three species which were further subdivided into electrophoretic types (ETs). Clustering analysis using normalized percentage disagreement (PTC) average linkage method revealed two clusters for M. cookei with two subclusters in cluster 2. M. canis had three main divisions (clusters 3, 4 and 5) and Diheterospora formed a separate division. The presence of isolates from different sources in the same clusters and lack of statistical significance as measured by confidence intervals suggests the existence of isolates with common lineage.

  2. Effect of fenbendazole on Toxocara canis larvae in tissues of infected dogs. (United States)

    Dubey, J P


    The effect of fenbendazole therapy was studied in six dogs fed 10,000 embryonated Toxocara canis eggs. At 47 days after they were fed T canis, four dogs were given fenbendazole in two divided doses totaling 50 mg/kg of body weight each day for 14 days. Two infected dogs were not given fenbendazole. All dogs were necropsied at the end of treatment and the foci were counted in the lungs; their skeletal muscles were digested in 1% trypsin for the recovery of larvae. The T canis larvae were not recovered from the skeletal muscle of the four infected dogs treated with fenbendazole; 15 and 42 larvae/100 g of skeletal muscle were recovered from the two nonmedicated infeected dogs. The number of grossly visible foci on surfaces of lungs in treated dogs was markedly less than in the nonmedicated infected dogs. The results indicate that fenbendazole might be effective in preventing prenatal infection in dogs.

  3. Data on the parasitological status of golden jackal (Canis aureus L., 1758) in Hungary. (United States)

    Takács, András; Szabó, László; Juhász, Lajos; Takács, András Attila; Lanszki, József; Takács, Péter Tamás; Heltai, Miklós


    In Hungary, twenty Canis aureus individuals were submitted to parasitological examinations in 2010-2012. Two Coccidia: Cystoisospora canis (15%) and Toxoplasma-type oocysts (5%), one Trematoda: Alaria alata (10%), six Cestoda: Mesocestoides lineatus (20%), Echinococcus granulosus (10%), Dipylidium caninums (5%), Taenia hydatigena (15%), Taenia pisiformis (20%), Taenia crassiceps (40%), and nine Nematoda: Angiostrongylus vasorum (10%), Crenosoma vulpis (30%), Capillaria aerophila (5%), Toxocara canis (20%), Toxascaris leonina (15%), Trichuris vulpis (10%), Ancylostoma caninum (45%), Uncinaria stenocephala (40%), Capillaria plica (45%) have been identified. Angiostronglyus vasorum has been reported from carnivores in Europe, Africa, South America and North America. The helminth A. vasorum or French heartworm is a metastrongylid nematode, widely distributed in Western Europe, that infects the pulmonary arterial tree of dogs, various species of foxes, wolves, Eurasian badgers, coyotes and stoats. To our knowledge, this is the first report of natural A. vasorum infection in golden jackal.

  4. Endoparasites of the coyote (Canis latrans), a recent migrant to insular newfoundland. (United States)

    Bridger, Kimberly E; Baggs, Eric M; Finney-Crawley, Jean


    This study provides the first data on the helminth fauna of the coyote (Canis latrans) in insular Newfoundland. Sixty-nine coyotes were collected between 2001 and 2003 and examined for helminths. A total of 10 helminth species were recorded: the cestodes Taenia ovis krabbei (9%), Taenia hydatigena (4%), Taenia pisiformis (1%), and Mesocestoides spp. (5%); and the nematodes Toxocara canis (19%), Toxascaris leonina (1%), Crenosoma vulpis (19%), Physaloptera rara (6%), Uncinaria stenocephala (3%), and Angiostrongylus vasorum (1%). No significant differences (P< or =0.05) were detected between sexes. Mesocestoides spp., T. canis, and C. vulpis were more prevalent in juveniles than adults. Angiostrongylus vasorum is reported in coyotes for the second time in Newfoundland, Canada.

  5. The High Amplitude delta Scuti Star AD Canis Minoris (United States)

    Axelsen, R. A.; Napier-Munn, T.


    The high amplitude delta Scuti star AD Canis Minoris was studied by photoelectric photometry (PEP) during one night in in February 2011 and by digital single lens reflex (DSLR) photometry during seven nights in January and February 2016. Nine light curve peaks were captured, eight of them by DSLR photometry. A review of the literature enabled us to tabulate 109 times of maximum since 1959, to which we added 9 times of maximum from our data, thus creating the largest dataset to date for this star. Assuming a linear ephemeris, the period of AD CMi was calculated to be 0.122974511 (+/- 0.000000004) d, almost identical to that quoted in earlier literature. We constructed an observed minus computed (O-C) diagram which exhibited a quasi-sinusoidal shape, and fitted a weighted model characterised by combined quadratic and trigonometric functions. The fit indicates that the shape of the O-C diagram is attributable to the effects of a slow increase in the pulsation period of AD CMi at a constant rate, and the light time effect of a binary pair, confirming the results from previous authors, and updating most of the coefficients of the equation for the fitted model. The values of all of the coefficients in the function are statistically significant. The rate of increase in the pulsation period of AD CMi was calculated from the entire dataset to be dP/dt = 6.17 (+/- 0.75) x 10-9 d yr-1 or dP/Pdt = 5.01 (+/- 0.61) x 10-8 yr-1.

  6. Comparative Experimental Infection Study in Dogs with Ehrlichia canis, E. chaffeensis, Anaplasma platys and A. phagocytophilum. (United States)

    Nair, Arathy D S; Cheng, Chuanmin; Ganta, Chanran K; Sanderson, Michael W; Alleman, Arthur R; Munderloh, Ulrike G; Ganta, Roman R


    Dogs acquire infections with the Anaplasmataceae family pathogens, E. canis, E. chaffeensis, E. ewingii, A. platys and A. phagocytophilum mostly during summer months when ticks are actively feeding on animals. These pathogens are also identified as causing diseases in people. Despite the long history of tick-borne diseases in dogs, much remains to be defined pertaining to the clinical and pathological outcomes of infections with these pathogens. In the current study, we performed experimental infections in dogs with E. canis, E. chaffeensis, A. platys and A. phagocytophilum. Animals were monitored for 42 days to evaluate infection-specific clinical, hematological and pathological differences. All four pathogens caused systemic persistent infections detectible throughout the 6 weeks of infection assessment. Fever was frequently detected in animals infected with E. canis, E. chaffeensis, and A. platys, but not in dogs infected with A. phagocytophilum. Hematological differences were evident in all four infected groups, although significant overlap existed between the groups. A marked reduction in packed cell volume that correlated with reduced erythrocytes and hemoglobin was observed only in E. canis infected animals. A decline in platelet numbers was common with E. canis, A. platys and A. phagocytophilum infections. Histopathological lesions in lung, liver and spleen were observed in all four groups of infected dogs; infection with E. canis had the highest pathological scores, followed by E. chaffeensis, then A. platys and A. phagocytophilum. All four pathogens induced IgG responses starting on day 7 post infection, which was predominantly comprised of IgG2 subclass antibodies. This is the first detailed investigation comparing the infection progression and host responses in dogs after inoculation with four pathogens belonging to the Anaplasmataceae family. The study revealed a significant overlap in clinical, hematological and pathological changes resulting from the

  7. Comparative Experimental Infection Study in Dogs with Ehrlichia canis, E. chaffeensis, Anaplasma platys and A. phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Arathy D S Nair

    Full Text Available Dogs acquire infections with the Anaplasmataceae family pathogens, E. canis, E. chaffeensis, E. ewingii, A. platys and A. phagocytophilum mostly during summer months when ticks are actively feeding on animals. These pathogens are also identified as causing diseases in people. Despite the long history of tick-borne diseases in dogs, much remains to be defined pertaining to the clinical and pathological outcomes of infections with these pathogens. In the current study, we performed experimental infections in dogs with E. canis, E. chaffeensis, A. platys and A. phagocytophilum. Animals were monitored for 42 days to evaluate infection-specific clinical, hematological and pathological differences. All four pathogens caused systemic persistent infections detectible throughout the 6 weeks of infection assessment. Fever was frequently detected in animals infected with E. canis, E. chaffeensis, and A. platys, but not in dogs infected with A. phagocytophilum. Hematological differences were evident in all four infected groups, although significant overlap existed between the groups. A marked reduction in packed cell volume that correlated with reduced erythrocytes and hemoglobin was observed only in E. canis infected animals. A decline in platelet numbers was common with E. canis, A. platys and A. phagocytophilum infections. Histopathological lesions in lung, liver and spleen were observed in all four groups of infected dogs; infection with E. canis had the highest pathological scores, followed by E. chaffeensis, then A. platys and A. phagocytophilum. All four pathogens induced IgG responses starting on day 7 post infection, which was predominantly comprised of IgG2 subclass antibodies. This is the first detailed investigation comparing the infection progression and host responses in dogs after inoculation with four pathogens belonging to the Anaplasmataceae family. The study revealed a significant overlap in clinical, hematological and pathological

  8. Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India. (United States)

    Singh, B B; Sharma, R; Gill, J P S


    Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts.

  9. Serological evidence of exposure to Ehrlichia canis and Anaplasma phagocytophilum in Central Italian healthy domestic cats. (United States)

    Ebani, Valentina V; Bertelloni, Fabrizio


    The aim of the present survey was to estimate the seroprevalences of Ehrlichia canis and Anaplasma phagocytophilum in the Central Italian feline population. Serum samples of 560 healthy domestic cats were examined by indirect immunofluorescence assay (IFAT), considering an antibody titre of 1:40 as cut-off. Seroprevalences of 6.4% and 4.5% were found for E. canis and A. phagocytophilum, respectively. Adult, mixed breed cats showed seroprevalences higher than younger and purebred subjects, whereas no differences were observed in relation to gender and living conditions.

  10. Serology, molecular detection and risk factors of Ehrlichia canis infection in dogs in Costa Rica. (United States)

    Barrantes-González, Alexander V; Jiménez-Rocha, Ana E; Romero-Zuñiga, Juan José; Dolz, Gaby


    A cross-sectional study combining different serological and molecular techniques for the detection of Ehrlichia species in dogs and their ticks was carried out with data from all regions of Costa Rica. A seroprevalence of 32.1% (131/408), and infection with E. canis of 3.2% (13/407) was found, whereas 6.9% (9/130) of ticks attached to the dogs were PCR positive to E. canis. Higher prevalences were found outside the Greater Metropolitan Area (GMA). Risk factors associated with E. canis seropositivity were age, between 2 and 7 years (RR: 1.6, 95% CI: 1.2-2.2) and 8-15 years (RR: 1.8, 95% CI: 1.2-3.0), number of dogs/total of households [Dogs per Household Ratio (DHR) ≥3.1 (RR: 2.0; 95% CI: 1.4-3.0)], number of dogs infested with at least one tick/total of dogs sampled [Tick Infestation Prevalence (TIP)≥31% (RR: 2.1; 95% CI:1.3-3.3)] and living outside the GMA (RR: 1.7; 95% CI: 1.2-2.4) and being a mixed-breed dog (RR: 1.5; 95% CI: 1.1-2.1). Risk factors for E. canis PCR positive dogs were a depressive attitude (OR: 11.2; 95% CI: 1.1-115.9), fever (OR:4.8; 95% CI:1.2-19.3), DHR≥3.1 (OR: 5.7; 95% CI:1.7-19.2)], number of ticks/total of dogs sampled [Tick Distribution Ratio (TDR) ≥2.1 (OR: 6.5; 95% CI: 1.3-31.8)], and TIP≥40% (OR: 5.7; 95% CI: 1.7-19.2). This paper describes E. canis seroprevalence, PCR prevalence and tick analysis in dogs from Costa Rica, with associated clinical signs and owner perceptions. In summary, most of the E. canis infections in dogs in our country seemed to pass unnoticed by owners. Since most of the seropositive dogs (97.7%, 131/134) were negative for E. canis DNA in their blood, it is important to determine in future studies if these dogs recovered from the E. canis infection without any medication, or are persistently infected, and will develop chronic disease.

  11. Ehrlichia canis infection in a dog with no history of travel outside the United Kingdom. (United States)

    Wilson, H E; Mugford, A R; Humm, K R; Kellett-Gregory, L M


    A two-year-old female neutered Tibetan terrier was referred following a one-month history of lethargy, inappetence and pancytopenia, which had been poorly responsive to immunosuppressive and fluoroquinolone treatment. The dog was diagnosed with pure red cell aplasia and was found to be positive for Ehrlichia canis by both antibody titre measurement and polymerase chain reaction. The dog lived in London and had not travelled outside the UK. The dog was treated with doxycycline, prednisolone and ciclosporin, but died as a result of gastrointestinal tract haemorrhage. To the authors' knowledge, this represents the first reported case of Ehrlichia canis in a dog in the UK with no previous travel history.

  12. Detection of Ehrlichia canis in Dogs by IFA Test and Dot-ELISA


    ERDEĞER, Jale


    Ehrlichia canis is the causative agent of canine monocytic ehrlichiosis (CME). The aim of this study was to detect E. canis antibodies in dogs by the IFA and dot-ELISA techniques. Blood sera from 239 dogs were collected as material. IFA test and dot-ELISA were performed with commercially available test kits. The IFA test was applied according to the procedure in the IFA kit. The Immunocomb test system was used in dot-ELISA. Agreement between these techniques was analysed by the kappa (K) tes...

  13. [Helminths of wolves (Canis lupus) from south Mazurian Lakeland, a coprological study]. (United States)

    Kloch, Agnieszka; Bajer, Anna


    52 wolf scats collected during winter 2001/2002 in Puszcza Piska and Napiwodzko-Ramuckic forests were examined using Fulleborn's method. The overall helminth prevalence was 28.8%. Six helminth species were recorded, the most frequent species were Uncinaria stenocepmhala/Ancylostoma caninmu (treated together; found in 6 samples), Toxocara canis and Trichuris vulpis (both identified in 4 samples). The mean intensity of egg expulsion was 2.0 eggs/g feces, the most intense infection was this with Toxocara canis (average 23.0 eggs/g feces). There were observed differences in prevalence of parasite' species between packs. Present paper is first such an investigation in northeastern Poland.

  14. Prevalence of rare Eimeria canis from the non descript dogs of Mathura, Uttar Pradesh, India

    Directory of Open Access Journals (Sweden)

    Vikrant Sudan


    Full Text Available A wide range of parasites particularly helminths, arthropods and protozoans affect dogs but when it comes to intestinal coccidians, their number is scanty.  Eimeria canis is perhaps the most under reported parasite of dogs. The present paper deals with the prevalence of E.canis in dogs with no possible history of deworming from Mathura region, India.  Finally, the morphology of the parasite, present scenario, reasons for under reporting vis-à-vis future projections are being described.


    Directory of Open Access Journals (Sweden)

    Paula de Lima Telmo


    Full Text Available Toxocariasis is a widespread zoonosis and is considered an important worldwide public health problem. The aim of this study was to investigate the frequency of trans-mammary Toxocara canis infection in newborn BALB/c mice nursed by females experimentally infected with 1,200 eggs after delivery. After 50 days of age, the presence of larvae in different organs of the offspring was investigated. Trans-mammary infection was confirmed in 73.9% of the mice that had been nursed by infected females. These data show a high trans-mammary transmission of T. canis and confirm the significance of this transmission route in paratenic hosts.

  16. Aspectos bionômicos da vespa social Neotropical Polistes canadensis canadensis (Linnaeus (Hymenoptera, Vespidae Bionomics aspects of the Neotropical social wasp Polistes canadensis canadensis (Linnaeus (Hymenoptera, Vespidae

    Directory of Open Access Journals (Sweden)

    Viviana de Oliveira Torres


    Full Text Available Aspectos bionômicos da vespa social Neotropical Polistes canadensis canadensis (Linnaeus (Hymenoptera, Vespidae. O objetivo deste trabalho foi estudar alguns aspectos bionômicos da vespa social neotropical Polistes canadensis canadensis (Linnaeus, 1758. Vinte e seis colônias foram acompanhadas entre abril de 2004 e julho de 2006, no município de Mundo Novo, estado de Mato Grosso do Sul, região Centro-Oeste do Brasil. Os resultados encontrados nesse estudo sugerem que o padrão fenológico de Polistes canadensis canadensis é assincrônico nessa região, com fundações e abandonos podendo ocorrer o ano todo. A duração média dos estágios imaturos foi diferente entre as estações climáticas fria-seca e úmida-quente. Diferentes substratos foram escolhidos para nidificação, contudo em ambientes que forneceram condições físicas mais homogêneas durante o dia foram encontradas as maiores freqüências de sucesso. Colônias nessa espécie são fundadas por haplometrose ou pleometrose, no entanto, o sucesso tem sido maior para colônias pleometróticas.Certain aspects of the bionomics of the Neotropical social wasp Polistes canadensis canadensis (Linnaeus, 1758 were studied. Twenty-six colonies were observed from April 2004 through July 2006, in the municipal district of Mundo Novo, state of Mato Grosso do Sul, central-Brazil. The results suggest that the colony phenological pattern of this species is asynchronous, and colonies may be founded or abandoned at any time of the year. The mean duration of the immature stages differed between the cold-dry and warm-rainy seasons. Colonies were founded on several different kinds of substrates, but were more successful in environments that provided more-homogeneous physical conditions during the day. Colonies in this species are founded by haplometrosis or pleometrosis, and pleometrotic colonies were more successful.

  17. Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs

    Directory of Open Access Journals (Sweden)

    Maurício Franco Zanette


    Full Text Available Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA, indirect immunofluorescent antibody test (IFAT and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tested, 24 (42.1% tested positive using one of the three serological methods: 10/57 (17.5% for ELISA, 11/57 (19.3% for IFAT and 3/57 (5.3% for Kalazar Detect™. Conclusions: Our results demonstrated that the presence of other infectious agents may lead to cross-reactivity on leishmaniasis serological tests.

  18. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago. (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto


    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island.

  19. Biologia reprodutiva da cobra-coral Erythrolamprus aesculapii Linnaeus (Colubridae, no Sudeste do Brasil Reproductive biology of the coral snake Erythrolamprus aesculapii Linnaeus (Colubridae in the Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Otávio A.V. Marques


    Full Text Available Dissection of 286 specimens of the "false" coral snake Erythrolamprus aesculapii Linnaeus, 1766, combined with data on captive individuais, provided information on the reproductive biology of this colubrid snake. Adult females (x snout-vent length = 74.5cm attain larger body size than males (x SVL = 62.6. Clutch size ranged from one to eight eggs and was correlated with maternal body size. Neonates measured 20.2-22.5cm SVL and weighed 5.1-5.8g. Males attain sexual maturity earlier than females. Reproduction seems to be aseasonal, with vitellogenesis occurring throughout the year. Apparently the growth rate of folheies decreases in the dry season, possibly due to lower tempeiatures during this period. Multiple clutches were recorded in captive snakes. Foraging strategies and availability of prey may explain continuous reproduction in E. aesculapii. However, data for other related snakes suggest that continuous reproduction is conservative in the Xenodontini.

  20. Body mass-related modifications involved in starvation at pumpkinseed Lepomis gibbosus (Linnaeus, 1758 (Teleostei, Centrarchidae

    Directory of Open Access Journals (Sweden)

    Cătălina F. Radu


    Full Text Available The authors analyze the modifications observed on a population of pumpkinseed (Lepomis gibbosus (Linnaeus, 1758 after a 60 days period of exposure to starvation and attempt to correlate the obtained results to other body-related characteristics, either linearly-measured (such as length, volume and density or weight-related, in order to achieve an estimation of a weight-loss allowance for the species of interest, that may be interpreted, if of a low daily value, as an advantage in the invasion process.

  1. Epsilon Canis Majoris and the ionization of the local cloud (United States)

    Vallerga, J. V.; Welsh, B. Y.


    The Lyman continuum radiation from the brightest extreme ultraviolet (EUV) source, the B2 II star epsilon Canis Majoris (Adara), is so intense that it dominates the local stellar EUV radiation field at wavelengths longer than 450 A and therefore sets a lower limit to the ionization of hydrogen in the Local Cloud. Using the EUV (70-730 A) spectrum of epsilon CMa taken with the Extreme Ultraviolet Explorer Satellite (EUVE) and simple models that extrapolate this spectrum to the Lyman edge at 912 A, we have determined the local interstellar hydrogen photionizatin parameter Gamma solely from epsilon CMa to be 1.1 x 10(exp -15)/s. This fiugre is a factor of 7 greater than previous estimates of Gamma calculated for all nearby stars combined (Bruhweiler & Cheng 1988). Using measured values of the density and temperature of neutral interstellar hydrogen gas in the Local Cloud, we derive a particle density of ionized hydrogen n(H(+)) and electrons n(sub e) of 0.015-0.019/cu cm assuming ionization equilibrium and a helium ionization fraction of less than 20%. These values correspond to a hydrogen ionizatin fraction, chi(sub H) from 19% to 15%, respectively. The range of these derived quantities is due to the uncertainties in the local values of the neutral hydrogen and helium interstellar densities derived from both (1) solar backscatter measurements of Ly alpha lines of hydrogen and helium (1216 and 584 A), and (2) the average neutral densities along the line of sight to nearby stars. The local proton density produced by epsilon CMa is enough to allow the ionization mechanism of Ripken & Fahr (1983) to work at the heliopause and explain the discrepancy between the neutral hydrogen density derived from solar backscatter measurements and line-of-sight averages to nearby stars. A large value of electron density in the Local Cloud of n(sub e) is approximately 0.3-0.7/cu cm (T = 7000 K) has recently been reported by Lallement et al. (1994) using observations of Mg II and Mg I

  2. Molecular detection of Anaplasma platys and Ehrlichia canis in dogs from Kabylie, Algeria. (United States)

    Dahmani, Mustapha; Loudahi, Abdelghani; Mediannikov, Oleg; Fenollar, Florence; Raoult, Didier; Davoust, Bernard


    Ehrlichia canis and Anaplasma platys are bacteria belonging to the Anaplasmataceae family that cause acute, self-limiting and sometimes fatal vector-borne infections in dogs. These bacteria have been reported worldwide and are transmitted mainly by Rhipicephalus sanguineus. Aside from a report on E. canis once in 1935, no other Anaplasmataceae bacteria have been reported in Algeria to date. The aim of this study was to identify the microbial species implicated in ehrlichiosis and anaplasmosis by a molecular epidemiological survey in dogs. The study was carried out in Kabylie, in northeast Algeria. Sampling was performed in 11 municipalities in the province of Tizi Ouzou and 2 municipalities in the province of Béjaïa. Peripheral blood samples from 110 dogs were screened by qPCR, which is capable of identifying most Anaplasmataceae bacteria. Out of 110, a total of 13 samples screened positive (7/110 E. canis and 6/110 A. platys), and two genetic variants of A. platys and one of E. canis were identified. This is the first study to report the presence of A. platys in dogs from Algeria using a molecular investigative method. This survey was conducted in early spring. As tick activity can affect the prevalence of these pathogens in dogs, further investigations are needed to establish the year-round prevalence of these infections.

  3. First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study

    Directory of Open Access Journals (Sweden)

    Carolina G. Sosa-Gutiérrez


    Full Text Available Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed using the Maximum likelihood method, and Maximum parsimony. Results. They were positive to E. canis 25/139 (18.0% dogs and 29/139 (20.9% ticks. The clinical manifestations presented were fever, fatigue, depression and vomiting. Rhipicephalus sanguineus Dermacentor variabilis and Haemaphysalis leporis-palustris ticks were positive for E. canis. Phylogenetic analysis showed that the sequences of dogs and ticks in Mexico form a third group diverging of sequences from South America and USA. Conclusions. This is the first phylogenetic analysis of E. canis in Mexico. There are differences in the sequences of Mexico with those reported in South America and USA. This research lays the foundation for further study of genetic variability.

  4. Detection of Ehrlichia canis and Anaplasma platys DNA using multiplex PCR. (United States)

    Rufino, Claudia Pinheiro; Moraes, Pablo Henrique Gonçalves; Reis, Thais; Campos, Ruan; Aguiar, Délia Cristina Figueira; McCulloch, John Anthony; Meneses, Andre Marcelo Conceição; Gonçalves, Evonnildo Costa


    We hereby propose a novel sensitive, specific, and cost-efficient method to detect Ehrlichia canis and Anaplasma platys DNA from canine whole blood samples by multiplex PCR. Blood samples from hemoparasited dogs attending the Veterinary Hospital at the Universidade Federal Rural da Amazônia-UFRA, Belém, Brazil, were collected in tubes containing EDTA. Amplification of E. canis and A. platys 16S rDNA by nested (n) PCR was successfully achieved by using primers specific to the Anaplasmataceae in the first round of PCR, followed by a second round of PCR using E. canis-specific primers in conjunction with A. platys-specific primers. The amplicons obtained were cloned and sequenced, yielding sequences of 478 and 473 bp (including primers) pertaining to regions of the 16S rDNA of E. canis and A. platys, respectively. The protocol we here propose may help to measure the prevalence of canine monocytic ehrlichiosis (CME) and canine cyclic thrompocytopenia, not only in northern Brazil, where there is no data available, but also elsewhere.

  5. First description of natural Ehrlichia canis and Anaplasma platys infections in dogs from Argentina. (United States)

    Eiras, Diego Fernando; Craviotto, María Belén; Vezzani, Darío; Eyal, Osnat; Baneth, Gad


    Bacteria belonging to the Anaplasmataceae family are vector transmitted agents that affect a variety of vertebrate hosts including the tick-borne pathogens Ehrlichia canis and Anaplasma platys, which cause canine monocytic ehrlichiosis and cyclic thrombocytopenia, respectively. These two infections, typically reported from tropical and sub-tropical regions, have not been previously reported in dogs from Argentina. A total of 86 blood samples from dogs with suspected rickettsial disease and 28 non-suspected dogs were studied. Analysis included evaluation of hematological findings, PCR for Ehrlichia and Anaplasma species and sequencing of the positive PCR products. E. canis was detected in the blood of six dogs and A. platys in eighteen. All the dogs categorized as non-suspected were negative by PCR. Co-infection with Hepatozoon canis and Babesia vogeli was documented. This first report of E. canis and A. platys infections in dogs from Argentina indicates that these tick-borne infections have a considerably broader range than previously recognized in South America.

  6. Characterization of excretory-secretory antigens of adult Toxocara canis by western blotting. (United States)

    Sudhakar, N R; Samanta, S; Sahu, Shivani; Raina, O K; Gupta, S C; Goswami, T K; Lokesh, K M; Kumar, Ashok


    Toxocara canis is one of the most common helminth worm of dogs which continues to stimulate both public health concern alongside the higher scientific interest. It may cause visceral and ocular damage in humans especially in children. The identification of specific antigens of T. canis is important so as to develop better diagnostic techniques. Excretory-secretory (ES) antigens were prepared by culturing the adult T. canis worms in RPMI 1640 medium without serum supplementation followed by ammonium sulphate precipitation. These antigens were separated using sodium dodecyl sulphate-electrophoresis (SDS-PAGE). Recovered proteins ranged from 30 to 384 kDa. The specific reactivity of the T. canis excretory-secretory (TC-ES) proteins was checked by western blotting. The immuno-reactivity of the naturally infected dog sera with the TC-ES antigens showed five bands at 43, 57,105, 139 and 175 kDa. The immuno-reactivity of the hyper immune serum raised in rabbits against TC-ES antigens was observed with ten polypeptides of 21, 25, 30, 37, 45, 50, 57, 69, 77 and 105 kDa. Common antigens band were observed at 57 and 105 KDa. These antigens merit further evaluation as candidate for use in diagnosis of toxocariasis in humans and adult dogs.

  7. BEHAVIORAL AND MEMORY CHANGES IN Mus musculus COINFECTED BY Toxocara canis AND Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Flávia Motta Corrêa


    Full Text Available Several researchers have stated that parasites can alter the behavior of their hosts, in order to increase the transmission rate, principally when prey-predator relationships are a reliable way of infection transmission. The aim of this study was to verify the occurrence of changes in anxiety and short-term memory patterns in experimentally infected Mus musculus by Toxocara canis and/or Toxoplasma gondii. Forty male Mus musculus (Balb/c eight-week-old were divided into four groups of 10 mice each. One group was infected with 300 eggs of Toxocara canis; a second group was submitted to infection with 10 cysts of Toxoplasma gondii; a third group was concomitantly infected with both parasites with the same inoculums and the last group was maintained without infection. The anxiety levels were evaluated using an elevated plus maze and an actometer; the short-term memory was determined by a two-way active avoidance equipment. The determination of anxiety levels were conducted 40 and 70 days after infection and the short-term memory was evaluated 140 days after infection. Mice chronically infected by Toxoplasma gondii showed impaired learning and short-term memory, but no significant differences were found in mice infected by Toxocara canis or concomitantly infected by Toxocara canis and Toxoplasma gondii when compared to non infected mice.

  8. Serological survey of diseases of free-ranging gray wolves (Canis lupus) in Minnesota (United States)

    We tested serologic samples from 387 free-ranging wolves (Canis lupus) from 2007–2013 for exposure to 8 canid pathogens to establish baseline data on disease prevalence and spatial distribution in Minnesota’s wolf population. We found high exposure to canine adenovirus 1 and 2 (88% adults, 45% pups...

  9. A gray wolf (Canis lupus) delivers live prey to a pup (United States)

    Mech, L. David


    A two-year-old sibling Gray Wolf (Canis lupus) carefully captured an Arctic Hare (Lepus arcticus) leveret alive on Ellesmere Island, Nunavut, Canada, and delivered it alive to a pup 28–33 days old. This appears to be the first observation of a Gray Wolf delivering live prey to a pup.

  10. Killing of a muskox, Ovibus moschatus, by two wolves, Canis lupis, and subsequent caching (United States)

    Mech, L.D.; Adams, L.G.


    The killing of a cow Muskox (Ovibos moschatus) by two Wolves (Canis lupus) in 5 minutes during summer on Ellesmere Island is described. After two of the four feedings observed, one Wolf cached a leg and regurgitated food as far as 2.3 km away and probably farther. The implications of this behavior for deriving food-consumption estimates are discussed

  11. Antibodies reactive with Bartonella henselae and Ehrlichia canis in dogs from the communal lands of Zimbabwe

    Directory of Open Access Journals (Sweden)

    P.J. Kelly


    Full Text Available The prevalences of antibodies against Bartonella henselae and Ehrlichia canis were determined in sera from 228 dogs in 5 communal lands of Zimbabwe, areas where traditional subsistence agro-pastoralism is practised. The sera were collected from apparently healthy dogs during routine rabies vaccination programmes and tested with indirect fluorescent antibody assays using B. henselae (Houston-I and E. canis (Oklahoma as antigens. We found reactive antibodies (>1:80 against B. henselae in 14 % of the dogs tested. Seropositive animals were found in Bikita (41 %; 17/42, Omay (13 %; 6/48, Chinamora (5 %; 2/38 and Matusadona (15 %; 7/48. No seropositive dogs were found in Chiredzi (0 %; 0/52. Antibodies reactive with E. canis (>1:80 were found in 34%of the dogs tested, from Bikita (88 %; 37/42, Chiredzi (31 %; 16/52, Omay (17 %; 8/48, Chinamora (26 %; 10/38 and Matusadona (15 %; 7/48. Our survey shows dogs in the communal lands of Zimbabwe are frequently exposed to E. canis and B. henselae or closely related species. Further studies are indicated to determine the pathogenicity of the organisms infecting these dogs and their clinical significance.

  12. Gray wolf (Canis lupus) is a natural definitive host for Neospora caninum (United States)

    The gray wolf (Canis lupus) was found to be a new natural definitive host for Neospora caninum. This finding is based on the recovery of Neospora-like oocysts from the feces of 3 of 73 wolves from Minnesota examined at necropsy, and on successful amplification of N. caninum-specific sequences from ...

  13. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  14. Toxocara canis: impact of preweaning nutritional deprivation on the pathogenesis of pneumonia in the mouse. (United States)

    Moreira, Daniela S; Rocha, Gutemberg M


    The present study was conducted to better understand the immure response to Toxocara canis pneumonia in mice with preweaning nutritional deprivation. Breast-fed Swiss mice, undernourished due to large litter size (up to 15 pups) and paired controls with only 5-8 pups were used. At 21 days old, both groups were infected with T. canis larvae. Liver retinol, retinyl palmitate, and inflammatory infiltrate in lungs were compared in both groups. Significantly lower levels of retinol and retinyl palmitate in liver tissue confirmed the hypovitaminosis A (P nutritionally deprived animals. Histological analysis showed similar eosinophilic infiltration in both groups at day 3 but was significantly more severe in undernourished mice at day 20 post-infection (P = 0.01). The present findings indicate that preweaning undernourishment is associated with a more severe inflammation in response to T. canis pneumonia. It suggests that vitamin A deficiency that persists after nutritional rehabilitation, may contribute to the severity of T. canis infection. The authors suggest that nutritional status should be carefully investigated in patients with more severe clinical findings.

  15. The use of ozonized oil in the treatment of dermatophitosis caused by Microsporum canis in rabbits

    Directory of Open Access Journals (Sweden)

    Fernanda Vasquez Daud


    Full Text Available The ozone is effective against most microorganisms due to its high oxidant power. Low concentrations and short-term contact are sufficient to inactivate bacteria, mold, yeast, parasites, seaweeds, protozoa and fungi. Microsporum canis is an important agent of dermatophitosis in human and animal. The aim of the current study was to assess the efficacy of ozonized oil over Microsporum canis in rabbits. Eighteen male New Zealand white rabbits, weight ranging from 2 to 3.2 kg were depilated in the cranial dorso-lateral and right caudal, and cranial and left caudal regions. The regions were inoculated with Microsporum canis, excepting the right caudal region, and were denominated TM, O, OM and M, respectively. After seven days, the treatment of lesions in TM began with 0.12g of terbinaphine 1% cream; in OM and O with 0.12g of ozonized oil; all animals were treated once a day for 28 days. Region M was not treated. Material was collected from those regions for cultivation in Sabouraud agar at day 28 of treatment. In the evolution of the treatment with terbinaphine, of 14 contaminated regions with Microsporum canis ten evolved to cure. With the ozonized oil, of 15 contaminations, four were cured. Clinically, that is, the macroscopic evaluation of lesions showed improvement in the TM and OM treated regions. We can conclude that there was statistical evidence of the protection action of the oil against the dermatophyte.

  16. Prevalence and Risk Factors Associated with Toxocara canis Infection in Children

    Directory of Open Access Journals (Sweden)

    Camilo Romero Núñez


    Full Text Available The objective of this study was to determine seroprevalence and identify risk factors associated with Toxocara canis infection. A clinical and epidemiological questionnaire and body mass index were used to assess the risk factors associated with human toxocariasis in 108 children with an age range of 2–16 years. Antibodies against Toxocara canis were detected using an ELISA test kit. Chi-square analysis and odds ratio (OR were used to identify risk factors associated with Toxocara canis seropositivity. The prevalence of antibodies against Toxocara canis was greater (P=0.02 in males than females (28.84% and 16.07%, resp.. Chi-square analysis and odds ratio revealed just one variable with P1.0 was associated with seropositivity: the possession of dogs under one year old (OR=1.78. Although not significant, the OR values suggest that other factors may be epidemiologically important for Toxocara presence such as not washing hands before meals, malnutrition, obesity, and use of public parks. Children in the age group >12 and 2 and <11 years old age group (4.62%. Toxocariosis infection needs to be prevented by pet deworming and hygienic measures after contact with dogs.

  17. Hair Contamination of Sheepdog and Pet Dogs with Toxocara Canis Eggs

    Directory of Open Access Journals (Sweden)

    AR Khezri


    Full Text Available Background: We tried to investigate the hair contamination of pet dogs and farm sheepdog with Toxocara eggs in terms of the different sex and age groups in north-west of Iran (Urmia and its sub­urbs.Methods: Hair samples were collected from a total of 138 pet and farm sheepdogs from November 2008 to June 2009 in Urmia City and the suburb (West Azerbaijan-Iran and examined for the pres­ence of T. canis eggs.Results: T. canis eggs found in 60 samples altogether (pet and shepherd dogs showed a contamina­tion rate of 36.2%. The number of observed T. canis eggs in each microscope field was va­ried from 1 to > 400. The age of the dog was found a significant factor to influence the prevalence and intensity of contamination, with 82% of all the eggs recovered from puppies (six months and younger. Additionally, the numbers of eggs in farm sheepdogs were significantly higher than pet dogs (P<0.05.Conclusions: This report shows that direct contact with T. canis infected dogs, particularly puppies from shepherd dogs, may pose a serious hazard to human. Besides, as they may harbor a considera­ble number of eggs on their hair, they can contaminate the soil and the environment.

  18. Prevalence and risk factors associated with Toxocara canis infection in children. (United States)

    Romero Núñez, Camilo; Mendoza Martínez, Germán David; Yañez Arteaga, Selene; Ponce Macotela, Martha; Bustamante Montes, Patricia; Ramírez Durán, Ninfa


    The objective of this study was to determine seroprevalence and identify risk factors associated with Toxocara canis infection. A clinical and epidemiological questionnaire and body mass index were used to assess the risk factors associated with human toxocariasis in 108 children with an age range of 2-16 years. Antibodies against Toxocara canis were detected using an ELISA test kit. Chi-square analysis and odds ratio (OR) were used to identify risk factors associated with Toxocara canis seropositivity. The prevalence of antibodies against Toxocara canis was greater (P = 0.02) in males than females (28.84% and 16.07%, resp.). Chi-square analysis and odds ratio revealed just one variable with P 1.0 was associated with seropositivity: the possession of dogs under one year old (OR = 1.78). Although not significant, the OR values suggest that other factors may be epidemiologically important for Toxocara presence such as not washing hands before meals, malnutrition, obesity, and use of public parks. Children in the age group >12 and 2 and pet deworming and hygienic measures after contact with dogs.

  19. Serological survey of Brucella canis in dogs in urban Harare and selected rural communities in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Simbarashe Chinyoka


    Full Text Available A cross-sectional study was conducted in order to detect antibodies for Brucella canis (B. canis in dogs from urban Harare and five selected rural communities in Zimbabwe. Sera from randomly selected dogs were tested for antibodies to B. canis using an enzyme-linked immunosorbent assay. Overall, 17.6% of sera samples tested (57/324, 95% CI: 13.5–21.7 were positive for B. canis antibodies. For rural dogs, seroprevalence varied from 11.7% – 37.9%. Rural dogs recorded a higher seroprevalence (20.7%, 95% CI: 15.0–26.4 compared with Harare urban dogs (12.7%, 95% CI: 6.9–18.5 but the difference was not significant (p = 0.07. Female dogs from both sectors had a higher seroprevalence compared with males, but the differences were not significant (p > 0.05. Five and two of the positive rural dogs had titres of 1:800 and 1:1600, respectively, whilst none of the positive urban dogs had a titre above 1:400. This study showed that brucellosis was present and could be considered a risk to dogs from the studied areas. Further studies are recommended in order to give insight into the epidemiology of brucellosis in dogs and its possible zoonotic consequences in Zimbabwe. Screening for other Brucella spp. (Brucella abortus, Brucella melitensis and Brucella suis other than B. canis is also recommended.

  20. Clinical Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum infections in dogs. (United States)

    Dubey, J P; Chapman, Jennifer L; Rosenthal, Benjamin M; Mense, M; Schueler, Ronald L


    Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum are related apicomplexans that can cause systemic illness in many species of animals, including dogs. We investigated one breeder's 25 Basset Hounds for these infections. In addition, tissues from dogs and other non-canine hosts previously reported as S. canis infections were studied retrospectively. Schizonts resembling those of S. neurona, and recognized by polyclonal rabbit anti-S. neurona antibodies, were found in six of eight retrospective cases, as well as in two additional dogs (one Basset Hound, one Springer Spaniel) not previously reported. S. neurona schizonts were found in several tissues including the central nervous system, lungs, and kidneys. Fatal toxoplasmosis was diagnosed in an adult dog, and neosporosis was diagnosed in an adult and a pup related to the one diagnosed with S. neurona. No serological reactivity to S. neurona antibodies occurred when S. canis-like liver schizonts were retrospectively assayed from two dogs, a dolphin, a sea lion, a horse, a chinchilla, a black or either of two polar bears. Sequencing conserved (18S) and variable (ITS-1) portions of nuclear ribosomal DNA isolated from the schizont-laden liver of a polar bear distinguished it from all previously characterized species of Sarcocystis. We take this genetic signature as provisionally representative of S. canis, an assumption that should be tested with future sequencing of similar liver infections in other mammalian hosts. These findings further extend the uncharacteristically broad intermediate host range for S. neurona, which also causes a neurologic disease in cats, mink, raccoons, skunks, Pacific harbor seals, ponies, zebras, lynxes, and sea otters. Further work is necessary to delineate the causative agent(s) of other cases of canine sarcocystosis, and in particular to specify the attributes of S. canis, which corresponds morphologically to infections reported from wide range of terrestrial

  1. Prevalence and diversity of Hepatozoon canis in naturally infected dogs in Japanese islands and peninsulas. (United States)

    El-Dakhly, Khaled Mohamed; Goto, Minami; Noishiki, Kaori; El-Nahass, El-Shaymaa; Hirata, Akihiro; Sakai, Hiroki; Takashima, Yasuhiro; El-Morsey, Ahmed; Yanai, Tokuma


    Canine hepatozoonosis is a worldwide protozoal disease caused by Hepatozoon canis and Hepatozoon americanum and is transmitted by ixodid ticks, Rhipicephalus and Amblyomma spp., respectively. H. canis infection is widespread in Africa, Europe, South America, and Asia, including Japan. The objective of this study was to study the distribution pattern and diversity of H. canis in naturally infected dogs in nine Japanese islands and peninsulas. Therefore, 196 hunting dogs were randomly sampled during the period from March to September 2011 and the ages and sexes were identified. Direct microscopy using Giemsa-stained blood smears revealed H. canis gametocytes in the peripheral blood of 45 (23.6%) dogs. Polymerase chain reaction (PCR) was performed on EDTA-anticoagulated blood, initially with the common primer set (B18S-F and B18S-R) amplifying the 1,665-bp portion of the 18S rRNA gene, and then with the specific primer set (HepF and HepR) amplifying about 660 bp fragments of the same gene. Based on PCR, 84 (42.9%) dogs were positive using the common primer and 81 (41.3%) were positive using the specific primer. The current investigation indicated that all screened areas, except for Sado Island and Atsumi Peninsula, were infected. Yaku Island had the highest infection rate (84.6% in males and 100.0% in females), while Ishigaki Island showed the lowest infection rates (8.3% in males and 17.7% in females). Both sexes were infected with no significant difference. However, diversity of infection among the surveyed islands and peninsulas was significantly different (P < 0.05). Although H. canis has previously been reported in dogs in Japan, the higher infection rate described in the current study and the diversity of infection in a wide range of islands strongly encourage prospective studies dealing with the prevention and treatment of the infection in dogs, as well as control of ticks.

  2. Metabolic costs of avian flight in relation to flight velocity : a study in Rose Coloured Starlings (Sturnus roseus, Linnaeus)

    NARCIS (Netherlands)

    Engel, S; Biebach, H; Visser, GH


    The metabolic costs of flight at a natural range of speeds were investigated in Rose Coloured Starlings (Sturnus roseus, Linnaeus) using doubly labelled water. Eight birds flew repeatedly and unrestrained for bouts of 6 h at speeds from 9 to 14 m s(-1) in a low-turbulence wind tunnel, corresponding

  3. The first detection of species of Babesia Starcovici, 1893 in moose, Alces alces (Linnaeus), in Norway. (United States)

    Puraite, Irma; Rosef, Olav; Radzijevskaja, Jana; Lipatova, Indre; Paulauskas, Algimantas


    Babesiosis is an emerging zoonotic disease and various wildlife species are reservoir hosts for zoonotic species of Babesia Starcovici, 1893. The objective of the present study was to investigate the presence and prevalence of Babesia spp. in moose Alces alces (Linnaeus) in two regions of Norway. A total of 99 spleen samples were collected from animals of various ages from an area with the occurrence of the tick Ixodes ricinus (Linnaeus, 1758), and from an area where the ticks are known to be absent. Infection was detected by the amplification of different regions of the 18S rRNA gene by using two different PCR primer sets specific of Babesia. Babesia spp. were found in the spleen samples of four moose. All Babesia-infected animals were from an area where ticks occur, with an infection rate of 6% (4 of 70). Babesia-positive samples were obtained from a five-month old moose calf and three adults. Two Babesia species, Babesia capreoli (Enigk et Friedhoff, 1962) and a B. odocoilei-like, were identified. Co-infection with Anaplasma phagocytophilum was obtained in two animals. This is the first report of the occurrence of B. capreoli and B. odocoilei-like species in moose.

  4. Ehrlichia canis in dogs in a semiarid region of Northeastern Brazil: serology, molecular detection and associated factors. (United States)

    Tanikawa, A; Labruna, M B; Costa, A; Aguiar, D M; Justiniano, S V; Mendes, R S; Melo, A L T; Alves, C J; Azevedo, S S


    This study investigated infection by Ehrlichia spp. agents by PCR, immunofluorescence assay test (IFAT), and by Giemsa-stained blood smears in 108 dogs from a semiarid region of the state of Paraíba, Northeastern Brazil. Seventy-five (69.4%) of the 108 dogs were found to be seropositive to Ehrlichia canis, while only four dogs (3.7%) were positive in real-time PCR for E. canis. In six dogs (5.6%) E. canis-like morulae were observed in monocytes. Animals that stayed in environment whose floor was dried dirt, and dogs whose owners reported low frequency of cleaning the dog environment had higher (Pcanis. Increasing seropositivity was found in older dogs (P=0.012). This study provides the first molecular detection of E. canis in the semiarid region of Northeastern Brazil.

  5. Identification of new 18S rRNA strains of Babesia canis isolated from dogs with subclinical babesiosis. (United States)

    Łyp, P; Adaszek, Ł; Furmaga, B; Winiarczyk, S


    In this study, we used PCR to detect and characterize B. canis from naturally infected dogs in Poland with subclinical babesiosis by amplifying and sequencing a portion of the 18S ribosomal RNA (rRNA) gene. Venous blood samples were collected from ten dogs with subclinical babesiosis. A 559-bp fragment of the B. canis 18S rRNA gene was amplified by PCR. Sequencing of the PCR products led to the identification of a new variant of Babesia canis, differing from the previously detected protozoa genotypes (18S rRNA-A and 18S rRNA-B) with nucleotide substitutions in positions 150 and 151 of the tested gene fragment. The results indicate the emergence within the Polish territory of a new, previously unencountered Babesia canis genotype responsible for the development of subclinical babesiosis.

  6. Detection of Babesia canis vogeli and Hepatozoon canis in canine blood by a single-tube real-time fluorescence resonance energy transfer polymerase chain reaction assay and melting curve analysis. (United States)

    Kongklieng, Amornmas; Intapan, Pewpan M; Boonmars, Thidarut; Thanchomnang, Tongjit; Janwan, Penchom; Sanpool, Oranuch; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai


    A real-time fluorescence resonance energy transfer polymerase chain reaction (qFRET PCR) coupled with melting curve analysis was developed for detection of Babesia canis vogeli and Hepatozoon canis infections in canine blood samples in a single tube assay. The target of the assay was a region within the 18S ribosomal RNA gene amplified in either species by a single pair of primers. Following amplification from the DNA of infected dog blood, a fluorescence melting curve analysis was done. The 2 species, B. canis vogeli and H. canis, could be detected and differentiated in infected dog blood samples (n = 37) with high sensitivity (100%). The detection limit for B. canis vogeli was 15 copies of a positive control plasmid, and for H. canis, it was 150 copies of a positive control plasmid. The assay could simultaneously distinguish the DNA of both parasites from the DNA of controls. Blood samples from 5 noninfected dogs were negative, indicating high specificity. Several samples can be run at the same time. The assay can reduce misdiagnosis and the time associated with microscopic examination, and is not prone to the carryover contamination associated with the agarose gel electrophoresis step of conventional PCR. In addition, this qFRET PCR method would be useful to accurately determine the range of endemic areas or to discover those areas where the 2 parasites co-circulate.

  7. In vitro culture and structural differences in the major immunoreactive protein gp36 of geographically distant Ehrlichia canis isolates. (United States)

    Zweygarth, Erich; Cabezas-Cruz, Alejandro; Josemans, Antoinette I; Oosthuizen, Marinda C; Matjila, Paul T; Lis, Katarzyna; Broniszewska, Marzena; Schöl, Heidrun; Ferrolho, Joana; Grubhoffer, Libor; Passos, Lygia M F


    Ehrlichia canis, the etiologic agent of canine ehrlichiosis, is an obligate intracytoplasmic Gram-negative tick-borne bacterium belonging to the Anaplasmataceae family. E. canis is distributed worldwide and can cause serious and fatal infections in dogs. Among strains of E. canis, the 16S rRNA gene DNA sequences are highly conserved. Using this gene to genetically differentiate isolates is therefore difficult. As an alternative, the gene gp36, which encodes for a major immunoreactive protein in E. canis, has been successfully used to characterize the genetic diversity of this pathogen. The present study describes the isolation and continuous propagation of a Spanish and 2 South African isolates of E. canis in IDE8 tick cells. Subsequently, canine DH82 cell cultures were infected using initial bodies obtained from infected IDE8 cultures. It was possible to mimic the life cycle of E. canis in vitro by transferring infection from tick cells to canine cells and back again. To characterize these E. canis strains at the molecular level, the 16S rRNA and gp36 genes were amplified by PCR, sequenced, and aligned with corresponding sequences available in GenBank. All 16S rRNA sequences amplified in this study were identical to previously reported E. canis strains. Maximum likelihood analysis based on the gp36 amino acid sequences showed that the South African and Spanish strains fall into 2 well-defined phylogenetic clusters amongst other E. canis strains. The members of these 2 phylogenetic clusters shared 2 unique molecular properties in the gp36 amino acid sequences: (i) deletion of glycine 117 and (ii) the presence of an additional putative N-linked glycosylation site. We further show correlation between the putative secondary structure and the theoretical isoelectric point (pI) of the gp36 amino acid sequences. A putative role of gp36 as an adhesin in E. canis is discussed. Overall, we report the successful in vitro culture of 3 new E. canis strains which present

  8. Early detection of Brucella canis via quantitative polymerase chain reaction analysis. (United States)

    Kauffman, L K; Bjork, J K; Gallup, J M; Boggiatto, P M; Bellaire, B H; Petersen, C A


    Canine brucellosis is a reportable zoonotic disease that can lead to canine reproductive losses and human infection through contact with infected urine or other genitourinary secretions. Although many locations require testing and euthanasia of positive dogs, current diagnosis is limited by the time required for seroconversion, for example, presence of B. canis-specific antibodies. The goal of this study was to determine the diagnostic ability of Brucella canis-specific quantitative polymerase chain reaction (qPCR) assay to detect B. canis in field samples prior to serological positivity for faster diagnosis and prevention of transmission within kennels or in households. Two kennels, one of which was located in the owner's home, were sampled following observation of suggestive clinical signs and positive serology of at least one dog. Specimens obtained were comparatively analysed via serology and qPCR analysis. 107 dogs were analysed for B. canis infection via qPCR: 105 via whole-blood samples, 65 via vaginal swab, six via urine and seven via genitourinary tract tissue taken at necropsy. Forty-five dogs were found to be infected with canine brucellosis via qPCR, of which 22 (48.89%) were seropositive. A statistically significant number (P = 0.0228) of qPCR-positive dogs, 5/25 (20.00%), seroconverted within a 30-day interval after initial serologic testing. As compared to serology, qPCR analysis of DNA from vaginal swabs had a sensitivity of 92.31% and specificity of 51.92%, and qPCR analysis of DNA from whole-blood samples had a sensitivity of 16.67% and specificity of 100%. B. canis outer membrane protein 25 DNA qPCR from non-invasive vaginal swab and urine samples provided early detection of B. canis infection in dogs prior to detection of antibodies. This assay provides a critical tool to decrease zoonotic spread of canine brucellosis, its associated clinical presentation(s), and emotional and economic repercussions.

  9. Sequential Evaluation of Dogs Naturally Infected with Ehrlichia canis, Ehrlichia chaffeensis, Ehrlichia equi, Ehrlichia ewingii, or Bartonella vinsonii


    Breitschwerdt, Edward B.; Hegarty, Barbara C.; Hancock, Susan I.


    Historically, disease manifestations in dogs seroreactive to Ehrlichia canis antigens by indirect immunofluorescent antibody testing have been attributed to infection with either E. canis or Ehrlichia ewingii. A 1996 study by Dawson and colleagues provided PCR evidence that healthy dogs from southeastern Virginia could be naturally infected with Ehrlichia chaffeensis. This observation stimulated us to determine which Ehrlichia spp. infected sick dogs that were referred to our hospital from th...

  10. Association of Ehrlichia canis, Hemotropic Mycoplasma spp. and Anaplasma platys and severe anemia in dogs in Thailand. (United States)

    Kaewmongkol, Gunn; Lukkana, Nicha; Yangtara, Sarawut; Kaewmongkol, Sarawan; Thengchaisri, Naris; Sirinarumitr, Theerapol; Jittapalapong, Sathaporn; Fenwick, Stanley G


    Canine tick-borne bacteria; Ehrlichia canis, hemotropic Mycoplasma spp. and Anaplasma spp., are organisms transmitted by Rhipicephalus sanguineus ticks. However, only a few clinical studies evaluating dogs infected with these organisms and anemia condition have been published. In this study, the potential tick-borne bacteria linked to anemia were investigated in eighty-one blood samples selected from anemic dogs using a broad range nested-PCR of the 16S rRNA gene. Positive results were shown in 12/81 blood specimens (14.81%). Nucleotide sequences from the PCR products were analyzed using BLAST and resulted in identification of Ehrlichia canis (8), Candidatus Mycoplasma haematoparvum (1) and Anaplasma platys (3). Two other PCR assays were used to detect and identify the positive results of these pathogens including a specific PCR for Ehrlichia canis (gp36) and a specific nested-PCR for hemoplasma species (16S rRNA) and the phylogenetic analyses of E. canis and canine hemoplasmas were performed using these two loci. These specific PCRs revealed co-infection of E. canis and Mycoplasma haemocanis in two cases. These two male dogs had presented with jaundice, severe hemolytic anemia, severe thrombocytopenia, leukocytosis, mild azotemia and hepatitis. Ehrlichia canis was detected in a significantly greater number of severe anemia cases (PCVcanis infections (odds ratio: 7.11, p=0.020). However, no statistical differences were detected between E. canis detection and degrees of thrombocytopenia or leukopenia. From the results of this study, we conclude that the severity of anemia is associated with E. canis infections rather than the severity of thrombocytopenia.

  11. The transmission of canine ehrlichiosis to the Wild Dog Lycaon pictus (Temminck) and Black-backed Jackal Canis mesomelas Schreber. (United States)

    van Heerden, J


    Canine ehrlichiosis was successfully transmitted from the domestic dog to three Wild Dogs Lycaon pictus and three Black-backed Jackals Canis mesomelas. Wild Dogs showed symptoms of anorexia and depression as well as anaemia, leucopaenia and mild thrombocytopaenia. Black-backed Jackals were asymptomatic. Morulae of Ehrlichicia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from Black-backed Jackal to the domestic dog.

  12. Dicty_cDB: Contig-U04369-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV347056 ) S230P6400RH7.T0 Rottweiler Canis familiaris STS g... 34 4.1 2 ( FB5... hubrichti mitochondrion, complete ge... 44 6.3 1 ( BV348868 ) S230P6384RC8.T0 Rottweiler Canis familiaris S

  13. Dicty_cDB: Contig-U15636-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one: CAS01_020_O16, 3'end. 44 0.11 2 ( BV286792 ) S232P6569RB8.T0 Beagle Canis familiaris STS genom... 40 0....D-2021A8 from 7, complet... 50 0.11 4 ( BV291216 ) S232P6154FH6.T0 Beagle Canis familiaris STS genom... 44 0

  14. Dicty_cDB: Contig-U06288-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Canis familiaris prostatic steroid... 60 5e-08 (Q8AVI9) RecName: Full=3-oxo-5-alpha-steroid 4-dehydr...7_1( EF537017 |pid:none) Oryzias latipes steroid 5-alpha-re... 58 1e-07 AF136720_1( AF136720 |pid:none) Canis familiaris prostatic

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-0683 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ycystic kidney disease 1 [Canis familiaris] NP_001006651.1 0.0 81% ... ...CBRC-BTAU-01-0683 ref|NP_001006651.1| polycystin 1 [Canis lupus familiaris] gb|AAM45378.1| polycystin 1; pol

  16. NCBI nr-aa BLAST: CBRC-PCAP-01-1446 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1446 ref|NP_001033695.1| chemokine (C-C motif) receptor 1 [Canis lupus... familiaris] dbj|BAE66670.1| chemokine (C-C motif) receptor 1 [Canis lupus familiaris] NP_001033695.1 1e-155 77% ...

  17. NCBI nr-aa BLAST: CBRC-PVAM-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1085 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-130 71% ...

  18. NCBI nr-aa BLAST: CBRC-STRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1304 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 3e-77 78% ...

  19. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  20. NCBI nr-aa BLAST: CBRC-DRER-16-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-16-0068 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-119 65% ...

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  2. NCBI nr-aa BLAST: CBRC-PABE-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0060 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  3. NCBI nr-aa BLAST: CBRC-LAFR-01-3535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3535 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-109 74% ...

  4. NCBI nr-aa BLAST: CBRC-PTRO-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0072 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  5. NCBI nr-aa BLAST: CBRC-HSAP-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0078 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  6. NCBI nr-aa BLAST: CBRC-MMUR-01-1296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1296 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  7. NCBI nr-aa BLAST: CBRC-CFAM-12-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0019 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 0.0 99% ...

  8. NCBI nr-aa BLAST: CBRC-OGAR-01-0872 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0872 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-171 89% ...

  9. NCBI nr-aa BLAST: CBRC-RMAC-04-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0054 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  10. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  11. NCBI nr-aa BLAST: CBRC-CJAC-01-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0081 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-172 90% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1272 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-119 88% ...

  13. NCBI nr-aa BLAST: CBRC-TSYR-01-1188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1188 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-145 89% ...

  14. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-2271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2271 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-144 78% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  17. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  18. NCBI nr-aa BLAST: CBRC-TBEL-01-2041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2041 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-123 91% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-1433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1433 ref|NP_001041572.1| G protein-coupled receptor 44 [Canis lupus fa...miliaris] emb|CAJ77887.1| G-protein coupled receptor [Canis lupus familiaris] NP_001041572.1 1e-133 66% ...

  20. NCBI nr-aa BLAST: CBRC-VPAC-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1411 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-31 37% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-08-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0127 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 5e-77 45% ...

  2. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  3. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-0471 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0471 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-136 75% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0118 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-64 52% ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  7. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-1851 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1851 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-147 73% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1445 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-164 87% ...

  11. NCBI nr-aa BLAST: CBRC-TSYR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0145 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 4e-82 61% ...

  12. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  14. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-1134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1134 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-137 77% ...

  17. NCBI nr-aa BLAST: CBRC-DNOV-01-3181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3181 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-153 94% ...

  18. NCBI nr-aa BLAST: CBRC-GGOR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0009 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 77% ...

  19. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1133 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 2e-61 92% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  3. NCBI nr-aa BLAST: CBRC-RMAC-14-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0161 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 9e-90 72% ...

  4. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  5. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  6. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-101 64% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  8. NCBI nr-aa BLAST: CBRC-LAFR-01-3197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-149 81% ...

  9. NCBI nr-aa BLAST: CBRC-PCAP-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0105 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-97 62% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-0599 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0599 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 65% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-71 48% ...

  12. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1165 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-76 41% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  15. NCBI nr-aa BLAST: CBRC-MEUG-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1930 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-69 59% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-0701 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0701 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-157 74% ...

  17. NCBI nr-aa BLAST: CBRC-CPOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1448 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-141 93% ...

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  1. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0028 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-149 89% ...

  3. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  4. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  5. NCBI nr-aa BLAST: CBRC-TSYR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1175 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 73% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  7. NCBI nr-aa BLAST: CBRC-PHAM-01-0220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0220 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-153 89% ...

  8. NCBI nr-aa BLAST: CBRC-MDOM-08-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0128 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 8e-62 45% ...

  9. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  10. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-1021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1021 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-62 43% ...

  12. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-64 44% ...

  13. NCBI nr-aa BLAST: CBRC-VPAC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0140 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 4e-68 57% ...

  14. NCBI nr-aa BLAST: CBRC-LAFR-01-2049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2049 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-113 78% ...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-0899 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0899 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  16. NCBI nr-aa BLAST: CBRC-MMUR-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0421 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 7e-75 50% ...

  17. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  18. NCBI nr-aa BLAST: CBRC-FCAT-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1055 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 4e-61 46% ...

  19. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1732 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-178 83% ...

  1. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  2. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  3. NCBI nr-aa BLAST: CBRC-MMUR-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0910 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 90% ...

  4. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  5. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-1061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1061 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-61 44% ...

  7. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 2e-30 37% ...

  8. NCBI nr-aa BLAST: CBRC-FCAT-01-0865 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ycystic kidney disease 1 [Canis familiaris] NP_001006651.1 0.0 85% ... ...CBRC-FCAT-01-0865 ref|NP_001006651.1| polycystin 1 [Canis lupus familiaris] gb|AAM45378.1| polycystin 1; pol

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-0331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0331 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 1e-136 65% ...

  10. NCBI nr-aa BLAST: CBRC-LAFR-01-3974 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3974 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-150 78% ...

  11. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-102 62% ...

  12. NCBI nr-aa BLAST: CBRC-LAFR-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1273 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 76% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-78 59% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-1017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1017 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-80 48% ...

  15. NCBI nr-aa BLAST: CBRC-OLAT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0032 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-61 41% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-0664 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0664 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-66 48% ...

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-0370 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0370 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-118 70% ...

  18. NCBI nr-aa BLAST: CBRC-MEUG-01-1232 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1232 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 2e-72 45% ...

  19. NCBI nr-aa BLAST: CBRC-PVAM-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0987 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 9e-83 59% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-0858 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0858 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 1e-101 64% ...

  1. NCBI nr-aa BLAST: CBRC-EEUR-01-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0070 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-152 91% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1975 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 0.0 78% ...

  3. NCBI nr-aa BLAST: CBRC-MMUS-03-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0082 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 87% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-1222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1222 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 92% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0624 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0624 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 7e-76 51% ...

  6. NCBI nr-aa BLAST: CBRC-DRER-11-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-11-0014 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-93 52% ...

  7. NCBI nr-aa BLAST: CBRC-RNOR-23-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-23-0122 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  8. NCBI nr-aa BLAST: CBRC-DNOV-01-3056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3056 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-38 86% ...

  9. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-72 48% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-0700 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0700 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 8e-84 79% ...

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-3130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3130 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 91% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-51 44% ...

  13. NCBI nr-aa BLAST: CBRC-MDOM-03-0298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0298 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-154 76% ...

  14. NCBI nr-aa BLAST: CBRC-PVAM-01-0863 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0863 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-124 73% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0017 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-37 39% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-1592 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1592 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 3e-62 43% ...

  17. NCBI nr-aa BLAST: CBRC-XTRO-01-3354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3354 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 9e-94 49% ...

  18. Molecular and serological detection of Ehrlichia canis in naturally exposed dogs in Iran: an analysis on associated risk factors. (United States)

    Maazi, Nadi; Malmasi, Abdolali; Shayan, Parviz; Nassiri, Seyed Mahdi; Salehi, Taghi Zahraei; Fard, Mojdeh Sharifian


    The general aim of this study, which was conducted for the first time in Iran, was to evaluate the seroprevalence and geographical distribution of Ehrlichia canis in a dog population in Iran, followed by molecular confirmation using PCR and sequencing. Blood samples were collected from 240 dogs in different areas of Alborz and Tehran Provinces and initially analyzed using the immunofluorescent antibody (IFA) test to detect anti-Ehrlichia canis IgG antibodies. Subsequently, nested PCR was performed based on a fragment of the 16S rRNA gene of E. canis on serologically positive samples. The results showed that 40/240 dogs (16.6%) presented anti-Ehrlichia canis IgG antibodies and that nine of the blood samples from the 40 seropositive dogs (22.5%) contained E. canis DNA, which was confirmed by sequencing. The seroprevalence of E. canis tended to be higher in purebred, one to three-year-old male dogs living in the Plain zone, in rural areas; however, this difference was not statistically significant.

  19. Seroprevalence and Risk Factors of Ehrlichia canis Infection among Companion Dogs of Mashhad, North East of Iran, 2009–2010

    Directory of Open Access Journals (Sweden)

    Maneli Ansari-Mood


    Full Text Available Background: The aims of this study were to determine the seroprevalence of canine ehrlichiosis and risk factors of this disease in companion dogs’ population of Mashhad, North East of Iran. Canine Monocytic Ehrlichiosis (CME is a zoonotic disease transmitted by ticks, Rhipicephalus sanguineus, and caused by an obligate intracellular bacterium, Ehrlichia canis.Methods: During September 2009 until November 2010, 250 companion dogs from Mashhad, North-East of Iran, were examined for serum antibody detection against E. canis by means of immunofluorescence assay test (IFAT and factors associated with a positive antibody response.Results: There was a very low prevalence of anti-E. canis antibodies (0.8%, 2/250 among studied dogs. The antibody titers for two seropositive dogs were 1:80 and 1:160, respectively. One (0.4% of seropositive dogs was infested with, R. sanguineus. In blood smears from one of infested dogs (0.4%, typical morulae of E. canis was observed in lymphocytes. The results confirm that the lowest occurrence of reactive dogs indoors probably related to low tick infestion.Conclusion: This is the first report that describes serological evidences of canine monocytic ehrlichiosis in North- East of Iran. Results suggested that E. canis infection in owned pet dogs from North of Khorasan was not endemic from 2009 to 2010. Additional molecular studies are necessary to confirm E. canis infection and to identify the local strains of the organism.

  20. Serological survey for antibodies reactive with Ehrlichia canis and E. chaffeensis in dogs from the Bloemfontein area, South Africa

    Directory of Open Access Journals (Sweden)

    A-M Pretorius


    Full Text Available Sera from 161 dogs in the Bloemfontein area in South Africa were tested for the presence of antibodies reactive with Ehrlichia canis and E. chaffeensis by indirect fluorescent antibody testing. Overall, 68 (42 % of the dogs had significant antibody titres (>1/64 against E. canis and 61 (38 % had significant titres (>1/64 against E. chaffeensis. Seven (11 % dogs had higher titres to E. chaffeensis than E. canis (1/2048 and 1/1024 (2 dogs; 1/1024 and 1/512 (2 dogs; 1/2048 and 1/512; 1/512 and 1/256 and 1/512 and <1/64, respectively. The remaining seropositive dogs had equal (n=26; 42 % or 2- (n=17; 25 %, 3- (n=13; 2% or 4-fold (n= 5; 7 % higher titres against E. canis. Dogs from economically depressed, high-density suburbs (60/112; 48 % had significantly higher prevalences of antibodies against E. canis than those from more affluent, low-density suburbs (8/49; 14 % (c2 19.38, p < 0.001. Higher titres to E. chaffeensis than E. canis were found in dogs from affluent, low-density suburbs (3/49 and in dogs from economically depressed, high-density suburbs (4/112.

  1. A preliminary study to evaluate the immune responses induced by immunization of dogs with inactivated Ehrlichia canis organisms

    Directory of Open Access Journals (Sweden)

    Sunita Mahan


    Full Text Available Ehrlichia canis is an intracellular pathogen that causes canine monocytic ehrlichiosis. Although the role of antibody responses cannot be discounted, control of this intracellular pathogen is expected to be by cell mediated immune responses. The immune responses in dogs immunized with inactivated E. canis organisms in combination with Quil A were evaluated. Immunization provoked strong humoral and cellular immune responses, which were demonstrable by Western blotting and lymphocyte proliferation assays. By Western blotting antibodies to several immunodominant E. canis proteins were detected in serum from immunized dogs and antibody titres increased after each immunization. The complement of immunogenic proteins recognized by the antisera were similar to those recognized in serum from infected dogs. Upon challenge with live E. canis, rapid anamnestic humoral responses were detected in the serum of immunized dogs and primary antibody responses were detected in the serum from control dogs. Following immunization, a lymphocyte proliferative response (cellular immunity was detected in peripheral blood mononuclear cells (PBMNs of immunized dogs upon stimulation with E. canis antigens. These responses were absent from non-immunized control dogs until after infection with live E. canis, when antigen specific-lymphocyte proliferation responses were also detected in the PBMNs of the control dogs. It can be thus concluded that immunization against canine monocytic ehrlichiosis may be feasible. However, the immunization regimen needs to be optimized and a detailed investigation needs to be done to determine if this regimen can prevent development of acute and chronic disease.

  2. Serum DHEA-S increases in dogs naturally infected with Ehrlichia canis. (United States)

    Rondelli, M C H; Munhoz, T D; Catandi, P B; Freschi, C R; Palacios Junior, R J G; Machado, R Z; Tinucci-Costa, M


    Adrenocortical disturbances are expected in canine ehrlichiosis due to the immunological challenges caused by infection and consequent inflammation. Thus, this study aimed to evaluate the occurrence of adrenocortical hormonal alterations in dogs naturally infected with Ehrlichia canis (n = 21) as positively confirmed by the presence of anti-E. canis antibodies (Dot-ELISA) and nested PCR (nPCR). Serum dehydroepiandrosterone sulfate (DHEA-S) concentrations were assessed via ELISA before and one hour after ACTH stimulation. Another 10 healthy dogs were subjected to the same stimulation protocol and used as controls. The results revealed that baseline and post-ACTH DHEA-S concentrations were significantly greater in sick dogs, regardless of gender, and this finding illustrates the stress induced by naturally acquired ehrlichiosis in dogs.

  3. First detection of Ehrlichia canis in Rhipicephalus bursa ticks in Sardinia, Italy. (United States)

    Masala, Giovanna; Chisu, Valentina; Foxi, Cipriano; Socolovschi, Christina; Raoult, Didier; Parola, Philippe


    Canine monocytic ehrlichiosis is a common and widespread disease. This disease is present in Sardinia year-round because the temperate weather on the island permits the survival of many types of tick vectors. A total of 35 ticks was collected from goats in south-eastern Sardinia, Italy, and tested for Ehrlichia DNA using polymerase chain reaction and DNA sequencing. This study provides the first evidence of the presence of Ehrlichia canis in Rhipicephalus bursa ticks. The data presented here increase our knowledge of tick-borne diseases in Sardinia and provide a useful contribution toward understanding their epidemiology. The role of R. bursa in the life cycle and transmission of E. canis needs however further investigation.


    Directory of Open Access Journals (Sweden)

    Isis Regina Grenier CAPOCI


    Full Text Available Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus on 31 Microsporum canis isolates from animals and home environments. Susceptibility tests were performed based on document M38-A2 (2008 of the Clinical and Laboratory Standards Institute with modifications for natural products. Although susceptibility variation was observed between the fungus tested, the concentrations that inhibited the growth of 50 and 90% of the microorganisms were low (19.5 and 78 µg/mL, respectively. Thus, this citronella extract showed potent fungistatic and fungicide activities against M. canis isolated from animals and home environments. Therefore, it could be an alternative for dermatophytosis prophylaxis in the home environment.

  5. ANTIFUNGAL ACTIVITY OF Cymbopogon nardus (L.) Rendle (CITRONELLA) AGAINST Microsporum canis FROM ANIMALS AND HOME ENVIRONMENT. (United States)

    Capoci, Isis Regina Grenier; Cunha, Michele Milano da; Bonfim-Mendonça, Patricia de Souza; Ghiraldi-Lopes, Luciana Dias; Baeza, Lilian Cristiane; Kioshima, Erika Seki; Svidzinski, Terezinha Inez Estivalet


    Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus) on 31 Microsporum canis isolates from animals and home environments. Susceptibility tests were performed based on document M38-A2 (2008) of the Clinical and Laboratory Standards Institute with modifications for natural products. Although susceptibility variation was observed between the fungus tested, the concentrations that inhibited the growth of 50 and 90% of the microorganisms were low (19.5 and 78 µg/mL, respectively). Thus, this citronella extract showed potent fungistatic and fungicide activities against M. canis isolated from animals and home environments. Therefore, it could be an alternative for dermatophytosis prophylaxis in the home environment.

  6. Isolation of Aureimonas altamirensis, a Brucella canis-like bacterium, from an edematous canine testicle. (United States)

    Reilly, Thomas J; Calcutt, Michael J; Wennerdahl, Laura A; Williams, Fred; Evans, Tim J; Ganjam, Irene K; Bowman, Jesse W; Fales, William H


    Microbiological and histological analysis of a sample from a swollen testicle of a 2-year-old Border Collie dog revealed a mixed infection of the fungus Blastomyces dermatitidis and the Gram-negative bacterium Aureimonas altamirensis. When subjected to an automated microbial identification system, the latter isolate was provisionally identified as Psychrobacter phenylpyruvicus, but the organism shared several biochemical features with Brucella canis and exhibited agglutination, albeit weakly, with anti-B. canis antiserum. Unequivocal identification of the organism was only achieved by 16S ribosomal RNA gene sequencing, ultimately establishing the identity as A. altamirensis. Since its first description in 2006, this organism has been isolated infrequently from human clinical samples, but, to the authors' knowledge, has not been reported from a veterinary clinical sample. While of unknown clinical significance with respect to the pathology observed for the polymicrobial infection described herein, it highlights the critical importance to unambiguously identify the microbe for diagnostic, epidemiological, infection control, and public health purposes.

  7. Diagnosis of canine brucellosis by ELISA using an antigen obtained from wild Brucella canis. (United States)

    Barrouin-Melo, Stella Maria; Poester, Fernando Padilla; Ribeiro, Marcos Borges; de Alcântara, Adriano Costa; Aguiar, Paulo Henrique Palis; Nascimento, Ivana Lúcia; Schaer, Robert Eduard; Nascimento, Roberto Meyer; Freire, Songelí Menezes


    An indirect ELISA test was developed for the diagnosis of Brucella canis infection in dogs. A bacterial whole cell extract was used as a solid phase antigen, using B. canis isolated from an infected animal. Sera from culture-positive and healthy negative animals were used as internal reference controls. The cut-off point was determined by a mathematical formula for a statistically valid value, which defined the upper prediction limit, based on the upper tail of the t-distribution of 21 negative control sera readings, for the confidence level of 99.5%. The sensitivity and specificity of the ELISA test were 95% and 91%, respectively. The ELISA test showed a significant concordance index (K=0.84) with the agar gel immunodiffusion test. The reliability of the ELISA for the detection of infected animals was established by a double blind study testing 280 sera provided by serum banks from different diagnostic and research institutions and analyzed by ROC Curve.

  8. Molecular detection of Ehrlichia canis in dogs from the Pantanal of Mato Grosso State, Brazil. (United States)

    Santos, Luana Gabriela Ferreira Dos; Melo, Andréia Lima Tomé; Moraes-Filho, Jonas; Witter, Rute; Labruna, Marcelo Bahia; Aguiar, Daniel Moura de


    The present study evaluated the presence of Ehrlichia DNA in the blood samples of 320 dogs from the urban and rural areas of the municipality of Poconé, Pantanal region, Mato Grosso state, by Polymerase Chain Reaction (PCR), targeting the ehrlichial dsb gene. Risk factors for infection in dogs were also evaluated. Forty-eight (15%, 95% CI: 11.4-19.5%) dogs were positive: 25 (15.6%, 95% CI: 10.4-22.2%) from the urban area and 23 (14.4%, 95% CI: 9.3-20.8%) from the rural area (P > 0.05). Partial DNA sequence obtained from PCR products of 18 samples from the urban area and 16 samples from the rural area were 100% identical to E. canis from Brazil and the USA. This study reports the first E. canis molecular detection in dogs from the northern Pantanal region.

  9. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie


    Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples...... was obtained for 35/35 Trichophyton isolates (10 species included) and the 279 bp for 3/3 M. canis and 4/4 M. audouinii samples. None of the 2 E. floccosum, 11 M. gypseum, 3 M M. persicolor or 12 control samples (yeast, mould, human DNA) were positive with either of the two PCR tests. Among the patient...... specimens, seven were T. rubrum positive, two for T. mentagrophytes, one was positive for T. tonsurans and 15 were dermatophyte negative by routine investigation (culture and/or pan-dermatophyte + T. rubrum multiplex PCR). The PCR results with our procedures were in 100% agreement with these results...

  10. Skin impression with acetate tape in Demodex canis and Scarcoptes scabiei var. vulpes diagnosis

    Directory of Open Access Journals (Sweden)

    D.T. Pereira


    Full Text Available This study compares the efficacy of skin impression with acetate tape and the deep skin scraping test to find D. canis and S. scabiei in dogs. During six months, 134 samples were collected by both techniques from 115 dogs treated at the dermatology service of the Veterinary Hospital of the Federal University of Santa Maria (HVU-UFSM. Of these patients, 27 had demodicosis and 12 had scabies. The impression with acetate tape test (ITT was shown to be significantly superior to the deep skin scraping test (DSST in finding D. canis and S. scabiei mites (p = 0.007. Based on our results we could conclude that acetate tape impression is a reliable method for diagnosing and monitoring therapy of dermatopathies caused by mites and can be used to replace the traditional deep skin scraping method. In addition, since it is less traumatic for the dog, this method shows more acceptance by the owner.

  11. Occurrence of Ehrlichia canis in free-living primates of the genus Callithrix

    Directory of Open Access Journals (Sweden)

    Claudio Mafra

    Full Text Available Bacteria of the genus Ehrlichia are Gram-negative and coccoid-shaped microorganisms that cause ehrlichiosis – a serious infectious disease that often leads to death. These bacteria present a strong zoonotic potential and primates may act as reservoir hosts. This study involved a molecular analysis to detect these microorganisms in blood samples collected from nineteen primates of the genus Callithrix living free in an Atlantic Forest fragment in the municipality of Viçosa, state of Minas Gerais, Brazil. One of the 19 primates was found to be infected with Ehrlichia canis. This finding points to a new wild host of E. canis with a strong potential for transmission to humans because of its increasing contact with people. This is the first report of Ehrlichia spp. in primate of the genus Callithrix.

  12. Presence of Leishmania and Brucella Species in the Golden Jackal Canis aureus in Serbia

    Directory of Open Access Journals (Sweden)

    Duško Ćirović


    Full Text Available The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010–02/2013 from 12 sites all over Serbia. Of the tissue samples collected, spleen was chosen as the tissue to proceed; all samples were tested for Leishmania species and Brucella species by real-time PCR. Of the 216 samples collected, 15 (6.9% were positive for Leishmania species, while four (1.9% were positive for B. canis. The potential epidemiologic role of the golden jackal in carrying and dispersing zoonotic diseases in Serbia should be taken under consideration when applying surveillance monitoring schemes.


    Directory of Open Access Journals (Sweden)



    Full Text Available Here we described the remains of Canis lupus from the bed 8 of Avetrana karst filling (Late Pleistocene; Taranto, Southern Italy. The studied specimens are larger than those collected from the early Late Pleistocene Apulian localities and those referred to the recent Italian wolf. Moreover, the remains from Avetrana are morphometrically close to Canis lupus maximus from France and to C. lupus collected from Central and Northern Italian localities, chronologically related to MIS 2 and MIS 3. Morphologically, the studied specimens slightly differ from both C. l. maximus and other Pleistocene Apulian wolves. The dimensional differences between the Avetrana wolves and those collected from the other early Late Pleistocene Apulian localities could be explained through a spread of a large-sized morphotype from the Northern Italy.

  14. Development and evaluation of a seminested PCR for detection and differentiation of Babesia gibsoni (Asian genotype) and B. canis DNA in canine blood samples. (United States)

    Birkenheuer, Adam J; Levy, Michael G; Breitschwerdt, Edward B


    Canine babesiosis has recently been recognized as an emerging infectious disease of dogs in North America. We sought to develop a seminested PCR to detect and differentiate Babesia gibsoni (Asian genotype), B. canis subsp. vogeli, B. canis subsp. canis, and B. canis subsp. rossi DNA in canine blood samples. An outer primer pair was designed to amplify an approximately 340-bp fragment of the 18S rRNA genes from B. gibsoni (Asian genotype), B. canis subsp. vogeli, B. canis subsp. rossi, and B. canis subsp. canis but not mammalian DNA. Forward primers were designed that would specifically amplify a smaller fragment from each organism in a seminested PCR. The practical limit of detection was 50 organisms/ml of mock-infected EDTA anticoagulated whole blood. The primer pair also amplified an approximately 370-bp fragment of the B. gibsoni (USA/California genotype) 18S rRNA gene from the blood of an experimentally infected dog with a high percentage of parasitemia. Amplicons were not detected when DNA extracted from the blood of a dog that was naturally infected with Theileria annae at a low percentage of parasitemia was amplified. Due to limited sensitivity, this test is not recommended for the routine diagnosis of B. gibsoni (USA/California genotype) or T. annae. The PCR test did not amplify Toxoplasma gondii, Neospora caninum, Leishmania infantum, Cryptosporidium parvum, or canine DNA under any of the conditions tested. The seminested PCR test was able to detect and discriminate B. gibsoni (Asian genotype), B. canis subsp. vogeli, B. canis subsp. canis, and B. canis subsp. rossi DNA in blood samples from infected dogs.

  15. Evaluation of an attenuated strain of Ehrlichia canis as a vaccine for canine monocytic ehrlichiosis. (United States)

    Rudoler, Nir; Baneth, Gad; Eyal, Osnat; van Straten, Michael; Harrus, Shimon


    Canine monocytic ehrlichiosis is an important tick-borne disease worldwide. No commercial vaccine for the disease is currently available and tick control is the main preventive measure against the disease. The aim of this study was to evaluate the potential of a multi-passaged attenuated strain of Ehrlichia canis to serve as a vaccine for canine monocytic ehrlichiosis, and to assess the use of azithromycin in the treatment of acute ehrlichiosis. Twelve beagle dogs were divided into 3 groups of 4 dogs. Groups 1 and 2 were inoculated (vaccinated) with an attenuated strain of E. canis (#611A) twice or once, respectively. The third group consisted of naïve dogs which served as controls. All 3 groups were challenged with a wild virulent strain of E. canis by administering infected dog-blood intravenously. Transient thrombocytopenia was the only hematological abnormality observed following inoculation of dogs with the attenuated strain. Challenge with the virulent strain resulted in severe disease in all 4 control dogs while only 3 of 8 vaccinated dogs presented mild transient fever. Furthermore, the mean blood rickettsial load was significantly higher in the control group (27-92-folds higher during days 14-19 post challenge with the wild the strain) as compared to the vaccinated dogs. The use of azithromycin was assessed as a therapeutic agent for the acute disease. Four days treatment resulted in further deterioration of the clinical condition of the dogs. Molecular comparison of 4 genes known to express immunoreactive proteins and virulence factors (p30, gp19, VirB4 and VirB9) between the attenuated strain and the challenge wild strain revealed no genetic differences between the strains. The results of this study indicate that the attenuated E. canis strain may serve as an effective and secure future vaccine for canine ehrlichiosis.

  16. Serosurvey for the Prevalence of Brucella Canis Antibodies in Dogs in Central Ohio (United States)


    summarized in Table 2. Case #315 involved a 20-year-old, female laboratory technician who, on January 12, 1968, had accidental oral contact with...23-year-old female worker in the same laboratory as Case #3, who experienced an identical episode of accidental contact with Brucella canis on June 3...residuals of an old cerebrovascular accident, and a positive tuberculin skin test. Physical examination revealed his known medical problems and a temperature

  17. Spatial ecology and demography of eastern coyotes (Canis latrans) in western Virginia


    Morin, Dana Janine


    Coyote (Canis latrans) range expansion in the Central Appalachian Mountains has stimulated interest in ecology of this predator and potential impacts to prey populations. This is particularly true in the Ridge and Valley Region in western Virginia where white-tailed deer (Odocoileus virginianus) populations are restricted by low nutritional carrying capacity and are subject to two other predators, bobcats (Lynx rufus) and American black bears (Ursus americanus), in addition to an active hunte...

  18. Immunolocalization of arginine kinase (AK) in Toxocara canis, Toxocara vitulorum, and Ascaris lumbricoides. (United States)

    Kulathunga, D G R S; Wickramasinghe, Susiji; Rajapakse, R P V J; Yatawara, Lalani; Jayaweera, W R; Agatsuma, Takeshi


    Arginine kinase (AK) is a member of the phosphagen kinase family. AK plays a major role in cellular energy metabolism in invertebrates including nematodes. In the present study, we performed the direct immunofluorescence test to determine the immunolocalization of AK in different stages of the life cycle (eggs, larvae, and adult worms) of Toxocara canis, Toxocara vitulorum, and Ascaris lumbricoides. Our results indicated variable levels of expression of AK in different stages. Moreover, strong fluorescence was observed in cleaving eggs than in dormant eggs. The highest activity of the enzyme was observed in the fully developed eggs. This may be due to high expression of AK in embryonic development, which is associated with increased energy demand due to cleavage and cellular differentiation. Surprisingly, expression of AK is significantly higher in the middle part and posterior end compared to anterior end of the larvae. In addition, AK is highly concentrated in cellular and metabolically active parts of the body such as hypodermis, muscle, intestine, ovaries, oviducts, and uterus, while it is absent in noncellular areas like cuticle. The present study revealed the presence of AK in T. canis, A. lumbricoides, and T. vitulorum and that it plays a major role in energy metabolism of these nematodes. Interestingly, antiserum was prepared against the recombinant T. canis AK and reacts with the native AKs of T. canis, A. lumbricoides, and T. vitulorum. AK levels could vary in relation to maximum potential rates of ATP turnover, oxidative capacity, and energy output. Further studies on subcellular localization of AK in these important helminths provide new information for researchers to develop effective anthelmintics against the parasites of veterinary and of public health importance.

  19. First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study


    Carolina G. Sosa-Gutiérrez; Teresa Quintero-Martinez; Margarita Vargas-Sandoval; Guadalupe Gordillo-Pérez


    Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed...

  20. Ecologia del Lupo (Canis lupus) in Provincia di Genova: distribuzione, consistenza, alimentazione e impatto sulla zootecnia


    Laura Schenone; Claudio Aristarchi; Alberto Meriggi


    Abstract Wolf Canis lupus ecology in Genoa province (northern Italy): species range, population, diet, and impact on livestock breeding
    From 1998 to 2003 we monitored the wolf population of Genoa province (Northern Italy) to define its range and number, and to know the feeding habits of the species and the predation impact upon animal husbandry. By recording and mapping all the presence signs (sighti...