
Sample records for canis familiaris linnaeus

  1. The help-seeking behaviour of dogs (Canis familiaris)


    Brodd, Louise


    During domestication, the dog( Canis familiaris), have become skilful in understanding human communication and also in communicating with humans. The wolf ( Canis lupus), is not as skilled with this interspecific communication. When dogs are faced with an unsolvable problem, they seek help from human by e.g. gazing at them. This behaviour has been studied and both age and breed group differences have been showed. In this study, we presented dogs with a task that consisted of a solvable and un...

  2. Genetic analysis of prostatic diseases in canis familiaris


    Magalhães, Joana Fernandes da Silva


    Dissertação de Mestrado em Genética Molecular Comparativa e Tecnológica A glândula prostática faz parte do sistema reprodutor masculino e pode ser afectada por várias condições incluindo a hiperplasia prostática benigna (HPB), o cancro da próstata (CaP), a prostatite e quistos. 0 cão (Canis familiaris) é considerado um bom modelo animal para o estudo destas doenças porque, para além das semelhanças morfológicas e funcionais entre as glândulas prostáticas do homem e do cão, estes animais de...

  3. Comprehension of human communicative signs in pet dogs (Canis familiaris). (United States)

    Soproni, K; Miklósi, A; Topál, J; Csányi, V


    On the basis of a study by D. J. Povinelli, D. T. Bierschwale, and C. G. Cech (1999), the performance of family dogs (Canis familiaris) was examined in a 2-way food choice task in which 4 types of directional cues were given by the experimenter: pointing and gazing, head-nodding ("at target"), head turning above the correct container ("above target"), and glancing only ("eyes only"). The results showed that the performance of the dogs resembled more closely that of the children in D. J. Povinelli et al.'s study, in contrast to the chimpanzees' performance in the same study. It seems that dogs, like children, interpret the test situation as being a form of communication. The hypothesis is that this similarity is attributable to the social experience and acquired social routines in dogs because they spend more time in close contact with humans than apes do, and as a result dogs are probably more experienced in the recognition of human gestures. PMID:11459158

  4. Mating System of Free-Ranging Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    S. K. Pal


    Full Text Available Fourteen females belonging to five groups were selected for the study of mating system in free-ranging domestic dogs (Canis familiaris All the matings occurred between August and December with a peak in late monsoon months (September to November. Both males and females differed in their degree of attractiveness to the opposite sex. The duration of courting association increased with the number of courting males in an association. The females exhibited selectivity by readily permitting some males to mate and avoiding, or even attacking others, if they attempted to mount. Frequency of mounting in courting association increased with the number of males present. There was a positive correlation between the duration of courting association and the frequency of mounting. The young adult males were more likely to copulate successfully than the old adult males. There was a negative correlation between the number of males present in an association and the number of successful copulations. In this study, six types of mating (monogamy, polygyny, promiscuity, polyandry, opportunity and rape were recorded. Mean (±S.E. duration of copulatory ties was 25.65 (±1.43 min. Several natural factors influencing the duration of copulatory ties were identified.

  5. Insight into the Genetic Basis of Craniofacial Morphological Variation in the Domestic Dog, Canis familiaris


    Rizk, Oliver Torres


    The domestic dog, Canis familiaris, presents a unique opportunity to identify and study the relationship between genotype and phenotype. Over the approximately 15,000 years since its domestication from the gray wolf, Canis lupus, the dog has undergone intense artificial selection for a variety of functional and aesthetic forms, resulting in hundreds of modern breeds that exhibit a wide range of behavior and morphology. Restrictive breeding histories have rendered each breed as a distinct ge...

  6. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758 from the Metropolitan Region of Recife – state of Pernambuco – Brazil

    Directory of Open Access Journals (Sweden)

    Auxiliadora de Moraes Ostermann


    Full Text Available This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of the animals and processed using Willis’s technique and spontaneous sedimentation. The results obtained in the necropsy indicated a positivity of 96.8% (93∕96, being 83.3%, 34.4%, 30.2%, 28.1%, 14.6%, 6.3% and 2.1% for Ancylostoma caninum, Dypilidium caninum, Toxocara canis, Trichuris vulpis, Ancylostoma braziliense, Toxascaris leonina and Spirocerca lupi, respectively. Results from the Willis technique, sedimentation and necropsy were only significantly different (p<0.05 in the detection of infection by Ancylostoma spp. The Willis technique and sedimentation did notpresent any differences for the other gastrointestinal helminthes.

  7. Breed Differences in Domestic Dogs' (Canis familiaris) Comprehension of Human Communicative Signals


    Wobber, Victoria Elizabeth; Wrangham, Richard W.; Hare, Brian; Koler-Matznick, Janice; Tomasello, Michael


    Recent research suggests that some human-like social skills evolved in dogs (Canis familiaris) during domestication as an incidental by-product of selection for “tame” forms of behavior. It is still possible, however, that the social skills of certain dog breeds came under direct selection that led to further increases in social problem solving ability. To test this hypothesis, different breeds of domestic dogs were compared for their ability to use various human communicative behaviors to fi...

  8. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California


    Courtney Hofman; Torben Rick


    Domesticated dogs (Canis familiaris) are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial charact...

  9. Interactions between jaw-muscle recruitment and jaw-joint forces in Canis familiaris.


    Dessem, D


    Electromyographic activity from the jaw-adductor muscles was recorded during mastication and bone crushing in domestic dogs (Canis familiaris). During mastication, balancing-side temporalis electromyographic activity was much less than that of the working side while masseter muscle electromyographic activities were of similar amplitude. Despite the large bite forces that were produced during bone crushing, balancing-side masseter and temporalis electromyographic activities were always smaller...

  10. The breakfast effect: dogs (Canis familiaris) search more accurately when they are less hungry. (United States)

    Miller, Holly C; Bender, Charlotte


    We investigated whether the consumption of a morning meal (breakfast) by dogs (Canis familiaris) would affect search accuracy on a working memory task following the exertion of self-control. Dogs were tested either 30 or 90 min after consuming half of their daily resting energy requirements (RER). During testing dogs were initially required to sit still for 10 min before searching for hidden food in a visible displacement task. We found that 30 min following the consumption of breakfast, and 10 min after the behavioral inhibition task, dogs searched more accurately than they did in a fasted state. Similar differences were not observed when dogs were tested 90 min after meal consumption. This pattern of behavior suggests that breakfast enhanced search accuracy following a behavioral inhibition task by providing energy for cognitive processes, and that search accuracy decreased as a function of energy depletion. PMID:23032958

  11. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    Directory of Open Access Journals (Sweden)

    Courtney Hofman


    Full Text Available Domesticated dogs (Canis familiaris are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial characteristics. No cutmarks were found on the bones, but one of the mandibles was burned. The CA-SRI-2 dogs appear to have eaten high trophic marine foods similar to what humans consumed, documenting the close bond between dogs and humans on the Channel Islands and broader North American Pacific Coast.

  12. Cooperation, leadership and numerical assessment of opponents in conflicts between groups of feral dogs (Canis lupus familiaris)


    Bonanni, Roberto


    This thesis attempted to assess the adaptive value of the behaviour of feral dogs (Canis lupus familiaris) by using such species as a model for testing predictions based on evolutionary theories. In particular, the following topics concerning dogs’ behaviour were examined: intergroup agonistic behaviour in relation to numerical assessment of opponents, cooperative behaviour during intergroup conflicts and decision making processes during collective activity changes. The research focuse...

  13. Can domestic dogs (Canis familiaris) use referential emotional expressions to locate hidden food? (United States)

    Buttelmann, David; Tomasello, Michael


    Although many studies have investigated domestic dogs' (Canis familiaris) use of human communicative cues, little is known about their use of humans' emotional expressions. We conducted a study following the general paradigm of Repacholi in Dev Psychol 34:1017-1025, (1998) and tested four breeds of dogs in the laboratory and another breed in the open air. In our study, a human reacted emotionally (happy, neutral or disgust) to the hidden contents of two boxes, after which the dog was then allowed to choose one of the boxes. Dogs tested in the laboratory distinguished between the most distinct of the expressed emotions (Happy-Disgust condition) by choosing appropriately, but performed at chance level when the two emotions were less distinct (Happy-Neutral condition). The breed tested in the open air passed both conditions, but this breed's differing testing setup might have been responsible for their success. Although without meaningful emotional expressions, when given a choice, these subjects chose randomly, their performance did not differ from that in the experimental conditions. Based on the findings revealed in the laboratory, we suggest that some domestic dogs recognize both the directedness and the valence of some human emotional expressions. PMID:22960805

  14. Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands. (United States)

    Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston


    Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history. PMID:23812648

  15. The effect of oxytocin on biological motion perception in dogs (Canis familiaris). (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József


    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills. PMID:26742930

  16. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris). (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X


    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  17. Effects of the Dog-Human Relationship on Problem-Solving Strategies in the Domestic Dog (Canis familiaris)


    Cook, Amy


    Dogs (Canis familiaris) are strongly responsive to human influence in general, and they also readily form preferences for specific humans, yet these lines of inquiry have not often been combined. The goal of this dissertation was to advance a more specific theory regarding the nature of the dog-human bond - that it is one characterized by dependency - and to investigate whether such bonds would influence dogs to use social strategies to solve non-social problems.In Chapter 1, I describe the f...

  18. Effects of organohalogen pollutants on haematological and urine clinical-chemical parameters in Greenland sledge dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Kirkegaard, Maja;


    Seven West Greenland sledge dog bitches (Canis familiaris) and their three pups were fed 50-200 g of contaminated West Greenland minke whale (Balaenoptera acutorostrata) blubber, and in a control cohort eight sister bitches and their .ve pups were fed a similar amount pork fat. Blood plasma and...... control group, while glucose was signi.cantly highest (ANCOVA: po0:05) in the exposed group. Furthermore, the blood cholesterol levels indicate that exposure via the diet to marine mammal blubber has a preventive effect on the development of cardiovascular diseases. We therefore suggest that the...

  19. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme


    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  20. Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

    Directory of Open Access Journals (Sweden)

    Llanos Mariana


    Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.

  1. Familiarity-connected or stress-based contagious yawning in domestic dogs (Canis familiaris)? Some additional data. (United States)

    Silva, Karine; Bessa, Joana; de Sousa, Liliana


    The present short note aimed at further exploring data from a recent study showing socially modulated auditory contagious yawning in domestic dogs (Canis familiaris). Two independent observers further extended the analysis of all video recordings made in the previous study and coded both the number of yawns performed by the dogs and the frequencies or durations of stress-related behaviors exhibited throughout the presentation of familiar and unfamiliar yawns. By showing no significant difference between conditions in the frequencies or durations of the coded behaviors, nor any association between the number of yawns and the frequencies or durations of stress-related behaviors, results raised doubt on the stress-induced yawn hypothesis, thus supporting social modulation. The exact mechanism underlying contagious yawning, however, needs further research. PMID:23982621

  2. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers


    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore


    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed o...

  3. Importance of social behaviour in eliciting A-not-B error in domestic dogs (Canis lupus familiaris) with “Unidentified Moving Object” (UMO) as partner


    Compton, Anna Bjurgård


    Domestic dogs (Canis lupus familiaris) are highly sociable animals that are observed to be experts at interacting, understanding and cooperating with humans (Homo sapiens). Social behaviour is difficult to study due to the lack of full control over interactions, but is important for understanding and interacting effectively with dogs. Robots have recently been introduced into canine research as a tool to investigate dog social behaviour. Unidentified Moving Object (UMO) is a term to explain a...

  4. Primer registro de perro doméstico prehispánico (canis familiaris entre los grupos cazadores recolectores del humedal de Paraná inferior (Argentina

    Directory of Open Access Journals (Sweden)

    Alejandro Acosta


    Full Text Available The first reliable record of the dog (Canis familiaris recovered in a hunter gatherer site from the lower Paraná wetlands (Argentina is analyzed in this paper. We discuss several aspects related to the origin, chronology and types of interactions established between dogs and aboriginal groups in the context of scarce information currently available about their presence among hunter gatherer groups of Southern South America.

  5. Primer registro de perro doméstico prehispánico (canis familiaris) entre los grupos cazadores recolectores del humedal de Paraná inferior (Argentina)


    Alejandro Acosta; Daniel Loponte; César García Esponda


    The first reliable record of the dog (Canis familiaris) recovered in a hunter gatherer site from the lower Paraná wetlands (Argentina) is analyzed in this paper. We discuss several aspects related to the origin, chronology and types of interactions established between dogs and aboriginal groups in the context of scarce information currently available about their presence among hunter gatherer groups of Southern South America.

  6. ESTUDIO PRELIMINAR DE LOS HALLAZGOS DE CANIS FAMILIARIS EN LA PIRÁMIDE CON RAMPA N°7, SANTUARIO DE PACHACAMAC, PERÚ/Preliminary study of Canis familiaris remains in the Pyramid with Ramp N°7, Pachacamac Sanctuary, Perú.

    Directory of Open Access Journals (Sweden)

    Denise Pozzi-Escot


    Full Text Available El Santuario arqueológico de Pachacamac tuvo una ocupación de alrededor de mil años, desde los primeros siglos de la era cristiana hasta la llegada de los conquistadores españoles al sitio. Durante el Horizonte Tardío (1470-1533 d.C., bajo el dominio Inca fue el más importante conjunto ceremonial de la costa central peruana, al cual acudían peregrinos de diversos y lejanos lugares. Recientemente, en el acceso a la Pirámide con Rampa N°7 (PCR 07, conectado a la principal vía de ingreso al santuario conocida como Calle Norte-Sur, se realizó el hallazgo de seis cánidos en muy buen estado de conservación que fueron identificados como Canis familiaris. El estudio de este contexto nos permite proponer una reconstrucción fenotípica de un perro prehispánico tardío; asimismo, nos permite evaluar el papel que jugaron estos animales en la época Inca, y relacionarlo al carácter sagrado del santuario. Abstract The Pachacamac Archeological Sanctuary was occupied of over a thousand years since the first centuries of the Christian era to the arrival of Spanish conquerors to the site. During the Late Horizon (1470-1533 AD, under the Inca rule, was the most important ceremonial complex of the central Peruvian coast, to which pilgrims arrived from different and distant places. Recently, in the access to the Pyramid with Ramp N°7, connected to the main entrance road to the sanctuary known as North-South Street, there was the discovery of six canines in very good condition that were identified as Canis familiaris. The study in this context allows us to propose a phenotypic reconstruction of a late pre-Hispanic dog, as well as evaluate the role played by these animals in the Inca period, and how they related to the sacredness of the sanctuary.

  7. Arterial anatomosurgical segments of the mammary glands in dogs (Canis familiaris, Linnaeus, 1758)

    International Nuclear Information System (INIS)

    Thirty mammary complexes (sixty antimers) from cross bred multiparous bitches, were injected with latex and then studied by means of radiology and dissection. The different anatomo-surgical arterial segments thus obtained were identified and designated according to the anatomical zone of irrigation of each mammary gland as follows: 1. Thoracic segment, by means of the fourth and fifth perforant arteries, penetrates the first mammary gland in 85% of the cases; 2. Thoracoabdominal segment, by means of the sixth and seventh perforant arteries, penetrates the second mammary gland in 48.33 % of the cases. This segment can also be divided as follows: 2.1. Retrograde branches of the cranial superficial epigastric artery that penetrates the second mammary gland in about 51.66% of the cases, as the toracoabdominal cranial segment; 2.2. Terminal branches of the last artery penetrate the third mammary gland in 73.32% of the cases, as the toracoabdominal caudal segment. 3. Inguinoabdominal segment may also possess two sub-- segments: 3.1. Caudal superficial epigastric artery with primary branches penetrating the fourth mamma and the ventral labial branches, penetrating the fifth mamma in 96.66% of the cases, as inguinoabdomninal caudal segment. 3.2. Terminal branches of the caudal superficial epigastric artery penetrates the third mamma in 51.66% of the cases as inguinoabdominal cranial segment. The anastomosis observed in 78.33% of the cases may not have significance in mastectomy

  8. Physiologically-based pharmacokinetic modelling of distribution, bioaccumulation and excretion of POPs in Greenland sledge dogs (Canis familiaris). (United States)

    Sonne, Christian; Gustavson, Kim; Letcher, Robert J; Dietz, Rune


    We used PBPK (physiologically-based pharmacokinetic) modelling to investigate distribution, bioaccumulation and excretion of the seven POPs (persistent organic pollutants) CB-99, CB-153, HCB, oxychlordane, p,p'-DDE, BDE-47 and BDE-99 in 4 adult captive Greenland sledge dog (Canis familiaris) bitches fed minke whale (Balaenoptera acuterostrata) blubber for 500-635 days. The PBPK modelled POP concentrations in adipose tissue, liver, kidney and plasma were mostly within a factor 2 of actual measured tissue levels even for those at the lower concentration end. The excretion route for oxychlordane and CB-153 was modelled to be via faeces while lung alveolar excretion dominated for BDE-47, BDE-99, HCB, p,p'-DDE and CB-99. Furthermore the model suggested the retained mass of POPs after 500 and 635 days of exposure, respectively, to be relatively low despite these POPs being highly recalcitrant. The retention increased in the following order (% of total intake); p,p'-DDE (1%)tool in risk assessment of POPs in arctic mammals. PMID:26210746

  9. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia). (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R


    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species. PMID:26364290

  10. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers. (United States)

    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore


    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal-domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  11. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers (United States)

    Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco


    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal–domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  12. Helminths parasites of stray dogs (Canis lupus familiaris from Cuiabá, Midwestern of Brazil

    Directory of Open Access Journals (Sweden)

    Dirceu Guilherme de Souza Ramos


    Full Text Available Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest region of Brazil. A total of 100 animals, from the Center for Zoonosis Control of Cuiabá were euthanized and necropsied for helminth searching. Overall 8,217 helminths were found in 85 animals identified in six species: Ancylostoma caninum, Ancylostoma. braziliense, Trichuris vulpis, Toxocara canis, Dirofilaria immitis and Dipylidium caninum. It was evidenced the wide distribution of helminths pathogenic to domestic dogs and especially with zoonotic potential as A. caninum, T. canis, D. caninum and D. immitis. The presence of D. immitis is an important finding, since it is a potentially zoonotic agent, however, this finding is considered sporadic.

  13. Ileal, colonic and total tract nutrient digestibility in dogs (Canis familiaris) compared with total tract digestibility in mink (Neovison vison)

    DEFF Research Database (Denmark)

    Tjernsbekk, Maria Therese; Tauson, Anne-Helene; Ahlstrøm, Øystein


    Mink (Neovison vison) was studied as a model for the determination of ileal crude protein (CP) and amino acid (AA) digestibility in dogs (Canis familiaris). Apparent ileal digestibility (AID) and apparent colonic digestibility (ACD) in dogs and apparent total tract digestibility (ATTD) in dogs and...... found between methods for digestibility of CP and most AA (p < 0.01) and for AA ranking with respect to digestibility level (p < 0.001). In dogs, ether extract digestibility was approximately 96% at all sites, while DM, starch and total carbohydrate digestibility increased from ileal to faecal level (p...

  14. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber. (United States)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette; Jenssen, Bjørn Munro; Letcher, Robert J; Dietz, Rune


    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw, respectively, which was significantly higher than the mean concentration of 53ng/g lw for all controls (peffects on immunity and reproduction and more focus should be conducted on this compound in Arctic wildlife. PMID:24725758

  15. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Rigét, Frank F; Beck Jensen, Jens-Erik;


    DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n=26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n=15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata...... individuals in the bitch generation were found (linear mixed effect model: both p>0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMD(femur), BMD(vertebrae) and groups of OHCs...

  16. Enteric Parasitic in canines (Canis familiaris) in the urban area of Coroico, Nor Yungas department of La Paz Bolivia


    Llanos Mariana; Condori Marcelina; Ibáñez Teddy; Loza-Murguia Manuel


    A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris), 96 dogs (58 males and 38 females) with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, ...

  17. Biologie a radiace šakala obecného (Canis aureus, Linnaeus, 1758)


    Krčmová, Hana


    This bachelor work is focused on biology and distribution of the species golden jackal (Canis aureus), which is the only one of three species of jackals which live outside the African continent and begins to expand increasingly into Europe and Asia. At first glance it's a reddish yellow-brown coloured beast resembling the red fox (Vulpes vulpes) or the small grey wolf (Canis lupus). Its typical distinguishing feature is partial symphysis of the digital pads in all paws, typically observabl...

  18. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery. (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco


    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests. PMID:26092534

  19. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.


    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  20. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiarisLINNAEUS, 1758 SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiarisLINNAEUS, 1758 SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiarisLinnaeus, 1758 sometidas a cesárea

    Directory of Open Access Journals (Sweden)

    Diogo José Cardilli


    Full Text Available

    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias após. O método de radioimunoensaio foi utilizado para a realização da dosagem do cortisol sérico (nos períodos já descritos. Realizou-se a análise estatística por meio dos testes t e Tukey. O teor de cortisol sérico apresentou diferença (p< 0,05 no dia da cesariana (6,83 µg/dL, porém não diferiu (p> 0,05 nos dias subsequentes (1,82 µg/dL, 24 horas após; 1,38 µg/dL, 48 horas após; 1,48 µg/dL dez dias após. Os valores médios do grupo controle foram 3,43, 2,01, 3,59 e 1,72 µg/dL, após o parto, 24, 48 horas e dez dias após, respectivamente. O estresse devido à distocia elevou a liberação desse hormônio, voltando à normalidade nos dias subsequentes, porém o estresse cirúrgico não promoveu aumento na liberação de cortisol em cadelas submetidas à cesariana. Os animais do grupo controle apresentaram teores séricos de cortisol, nos devidos períodos, compatíveis com os citados pela literatura.

    PALAVRAS-CHAVES: Cadelas, cesariana, cortisol.

    Bitches submitted to caesarian section, for being in a physiological different situation, can present alterations to adapt to this new stress condition. Into possible alterations are cortisol levels during per partum period. So, the objectives of this study was to quantify seric cortisol of bitches submitted to caesarian section in partum and postpartum period (in the day of the partum or surgery , 24, 48 hours and 10 days later. The reserved serum was used to realization of cortisol measure by radioimmunoassay (on already described periods. The statistics analyzes were made by t test and Tukey. The cortisol levels presented difference (p< 0.05 in the dog of caesarian section (6.83 µg/dL but this didn’t differ (p> 0.05 on subsequent days (1.82 µg/dL, 24 hours later; 1.38 µg/dL, 48 hour later; 1.48 µg/dL, 10 days later. The middle values of control group were 3.43, 2.01, 3.59 e 1.72 µg/dL, in partum day, 24 hours later, 48 hours later and 10 days later. The stress because partum dystocic induced to liberation of cortisol, normalizing in subsequent days, but don’t have variation after cesarian (surgical stress don’t induced bigger liberation of cortisol or partum natural, composed compatible with the one found in the literature.
    KEY WORDS: Bitches, caesarian section, cortisol.
    Perras sometidas a cesárea por estar en situación distinta de la fisiológica, pueden presentar alteraciones séricas para se adaptaren a esa nueva condición de estrés. Una de las posibles alteraciones, es la concentración de cortisol durante el período peri-parto. Siendo así, el objetivo de ese estudio fue cuantificar los niveles séricos del cortisol en perras sometidas a cesárea en la fase de parto y posparto en la fase de parto y posparto (en el día del acto quirúrgico o parto, 24h, 48h y 10 días después. El método de radioinmunoensayo fue utilizado para la realización del dosaje de cortisol sérico (en los períodos ya descritos. La evaluación estadística fue realizada por medio de los testes t y Tukey. El nivel de cortisol sérico presentó diferencia (p< 0,05 en el día de la cesárea (6,83 µg/dL, pero no hubo diferencia estadística (p> 0,05 en los días consecutivos (1,82 µg/dL, 24 horas después; 1,38 µg/dL, 48 horas después; 1,48 µg/dL 10 días después. Los niveles medios del grupo control fueron 3,43, 2,01, 3,59 y 1,72 µg/dL, después del parto, 24, 48 horas y 10 días después, respectivamente. El estrés debido a la distocia elevó la liberación de esa hormona, que volvió a la normalidad en los días siguientes, pero el estrés quirúrgico no promovió aumento en la liberación de cortisol en perras sometidas a cesárea, y los animales del grupo control presentaron niveles séricos de cortisol, en los debidos períodos, de acuerdo con los descritos por la literatura.

  1. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiarisLINNAEUS, 1758) SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiarisLINNAEUS, 1758) SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiarisLinnaeus, 1758) sometidas a cesárea


    Diogo José Cardilli; Patrícia Rotta Lopes; Gilson Hélio Toniollo; Valeska Rodrigues; João Ademir de Oliveira


    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias ap...

  2. Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris). (United States)

    Dubey, Jitender P; Sykes, Jane E; Shelton, G Diane; Sharp, Nick; Verma, Shiv K; Calero-Bernal, Rafael; Viviano, Jenifer; Sundar, Natarajan; Khan, Asis; Grigg, Michael E


    There are several reports of Sarcocystis sarcocysts in muscles of dogs, but these species have not been named. Additionally, there are two reports of Sarcocystis neurona in dogs. Here, we propose two new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in four domestic dogs (Canis familiaris), one each from Montana and Colorado in the USA, and two from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy (TEM), and polymerase chain reaction. Based on collective results two new species, S. caninum and S. svanai were designated. Sarcocystis caninum and S. svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By TEM, the sarcocyst wall was "type 9", 1-2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7-9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were "type 1", thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multilocus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to Sarcocystis canis or Sarcocystis arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica, a

  3. Contagious yawning in domestic dog puppies (Canis lupus familiaris): the effect of ontogeny and emotional closeness on low-level imitation in dogs. (United States)

    Madsen, Elainie Alenkær; Persson, Tomas


    Contagious yawning is a well-documented phenomenon in humans and has recently attracted much attention from developmental and comparative sciences. The function, development and underlying mechanisms of the phenomenon, however, remain largely unclear. Contagious yawning has been demonstrated in dogs and several non-human primate species, and theoretically and empirically associated with empathy in humans and non-human primates. Evidence of emotional closeness modulating contagious yawning in dogs has, nonetheless, been contradictory. Humans show a developmental increase in susceptibility to yawn contagion, with typically developing children displaying a substantial increase at the age of four, when a number of cognitive abilities (e.g. accurate identification of others' emotions) begin to clearly manifest. Explicit tests of yawn contagion in non-human animals have, however, thus far only involved adult individuals. Here, we report a study of the ontogeny of domestic dogs' (Canis lupus familiaris) susceptibility to yawn contagion, and whether emotional closeness to the yawning model affects this. Thirty-five dogs, aged 4-14 months, observed a familiar and unfamiliar human repeatedly yawn or gape. The dogs yawned contagiously, but emotional closeness with the model did not affect the strength of contagion, raising questions as to recent evidence of emotionally modulated auditory contagious yawning in dogs. The dogs showed a developmental effect, with only dogs above 7 months evidencing contagion. The results support the notion of a developmental increase in dogs' attention to others and identification of others' emotional states and suggest that yawn contagion is underpinned by developmental processes shared by humans and other animals. PMID:23076724

  4. Biomarkers in Canis lupus familiaris


    Fernandes, Mónica Figueiredo


    Introdução- Os animais de companhia como o cão desempenham hoje um papel a nível familiar e social importante podendo atuar como agentes em programas terapêuticos e de socorrismo. A qualidade de vida dos animais de companhia e o correspondente impacto na saúde pública pode beneficiar com o diagnóstico precoce e a intervenção terapêutica adequada. Com a evolução das abordagens Ómicas, nomeadamente dos estudos de proteómica foi gerado um grande volume de dados que retratam ...

  5. Effects of glutamine combined with panthenol on intestinal injury in burned canis familiaris%谷氨酰胺联合泛醇对烧伤家犬肠道损伤的影响及机制研究

    Institute of Scientific and Technical Information of China (English)

    王裴; 赵云; 戚华兵; 彭曦; 尤忠义; 汪仕良


    目的 观察应用谷氨酰胺、泛醇及其复方制剂对减轻烧伤家犬肠道损伤的疗效并探讨其机制.方法 采用30%体表面积Ⅲ度烧伤家犬模型,动物随机分为正常对照、烧伤对照、泛醇、谷氨酰胺、泛醇+谷氨酰胺5个组,每组6只家犬,观察伤后7 d各组动物肠道损伤和修复指标.结果 烧伤家犬乙酰胆碱、肠黏膜蛋白含量明显降低,血浆二胺氯化酶(DAO)含量和损伤指数则明显增高(P<0.05),给予谷氨酰胺、泛醇以及复方药物均可明减轻烧伤后肠道损伤,降低血浆DAO活性和黏膜损伤指数(P<0.05);给予泛醇则能明显增加乙酰胆碱合成.与单方组相比,复方制剂组上述各项指标均明显优于单方组.结论 烧伤后肠道损伤明显,给予谷氨酰胺能明显减轻肠道损伤,给予泛醇能明显促进乙酰胆碱合成,促进胃肠运动,复方制剂疗效明显优于单方.%Objective To observe the effects of glutamine , panthenol and its compound preparation on lessening intestinal injury in burned canis familiaris . Methods Thirty canis familiaris were randomly divided into five groups , i. e. normal control ( C) group, burn control (B) group, glutamine group , panthenol group and its compound preparation group. Burned canis familiaris were inflicted with 30% TBSA full thickness burn injury. Observe the intestinal injury and repair post burn 7 d. Results After burn injury , the activity of plasma diamine oxidase (DAO) , intestine mucosal damage index were significantly higher , and the contents of intestine mucosal protein and plasma acetylcholine were remarkable decrease than those of C group (P < 0. 05 ). Compare with B group , the activity of plasma DAO, intestine mucosal damage index were markedly decreased in glutamine group , and the plasma acetylcholine contents was significantly increased in panthenol group . Compare with simple recipe group , there were more conspicuous therapeutic effect on compound preparation

  6. Prvky chování vlka (Canis lupus) ve vztahu k prvkům chování německého ovčáka (Canis lupus f. familiaris).


    ZUNKOVÁ, Karolína


    The aim of my study was to compare similarities and differences in behavior among the general wolf (Canis lupus) and German Shepherd dog. My thesis is recherche. Behavior data and a comparison I gained from the literature and created questionnaires designed for breeders of German shepherds dogs. The available sources indicated that the differences between the general behavior of the wolf and German shepherd dog are given by the German Shepherd Dog domestication , environment and human impact ...

  7. Thyroid calcitonin cells in response to glucagon-induced hypocalcaemia in the Indian jackal, Canis aureus (Linnaeus--lex). (United States)

    Swarup, K; Tewari, N P


    Jackal (Canis aureus) puppies (10) were subjected to hypocalcaemia by a single intravenous injection of crystalline porcine glucagon (Eli Lilly and Co.) in a dosage of 0.2 mg/kg body weight. Fasting blood samples from each specimen were collected 30 minutes before injection. Then again after an interval of 15, 30, 60, 90, 120, 150, 180, 210, 240, 270 and 300 minutes blood samples were taken. For histological study animals were killed after 30, 90, 120, 240 and 300 minutes of the injection. The mean serum calcium level records a fall upto 90 minutes but it tends to return to normal and at 300 minutes it returns to the preinjection level. The mean serum inorganic phosphate level records a fall upto 180 minutes and therafter the value increases approaching the preinjection levles after 300 minutes. Specific stains were used for staining the calcitonin cells. Animals killed 30 minutes after the injection exhibit beginning of degranulation of secretory granules in their C cells, while those killed after 300 minutes show marked degranulation. A progressive degranulation of calcitonin cells at the various stages of experimentation displays correspondingly poorer response to the staining reaction. There is no change in the histological picture of the parathyroid. PMID:7424080

  8. Do dogs (Canis familiaris) show contagious yawning? (United States)

    Harr, Aimee L; Gilbert, Valerie R; Phillips, Kimberley A


    We report an experimental investigation into whether domesticated dogs display contagious yawning. Fifteen dogs were shown video clips of (1) humans and (2) dogs displaying yawns and open-mouth expressions (not yawns) to investigate whether dogs showed contagious yawning to either of these social stimuli. Only one dog performed significantly more yawns during or shortly after viewing yawning videos than to the open-mouth videos, and most of these yawns occurred to the human videos. No dogs showed significantly more yawning to the open-mouth videos (human or dog). The percentage of dogs showing contagious yawning was less than chimpanzees and humans showing this behavior, and considerably less than a recently published report investigating this behavior in dogs (Joly-Mascheroni et al. in Biol Lett 4:446-448, 2008). PMID:19452178

  9. Do dogs (Canis lupus familiaris) prefer family? (United States)

    Hamilton, Jennifer; Vonk, Jennifer


    Kin recognition requires the ability to discriminate between one's own genetic relatives and non-relatives. There are two mechanisms that aid in kin discrimination: phenotype matching and familiarity. Dogs may be a good model for assessing these mechanisms as dogs are a promiscuous social species with a keen sense of smell. Domestic dogs of both sexes were presented with two scents (close kin, distant-kin) and preference was assessed through three measures (latency to approach, number of visits, time spent). Experiment 1 explored the possibility of phenotype matching as subjects had no contact with sires, whose scent was presented alongside a control male's scent. Experiment 2 explored recognition of siblings raised with the subjects and then separated at seven weeks of age. Whereas female dogs in this experiment did not show a statistically significant preference, male dogs showed a preference for distant-kin when presented with sire and female sibling samples. PMID:26277060

  10. Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus) (United States)

    Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...

  11. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758) from the Metropolitan Region of Recife – state of Pernambuco – Brazil


    Auxiliadora de Moraes Ostermann; Marilene Maria de Lima; Márcia Paula Oliveira Farias; Alessandra Santos d’Alencar; Mariana Karolina Freitas Galindo; Carla Tejo da Silva; Leucio Câmara Alves; Maria Aparecida da Gloria Faustino


    This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of th...

  12. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  13. Word generalization by a dog (Canis familiaris): is shape important? (United States)

    van der Zee, Emile; Zulch, Helen; Mills, Daniel


    We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

  14. Quantity discrimination in wolves (Canis lupus

    Directory of Open Access Journals (Sweden)

    Ewelina eUtrata


    Full Text Available Quantity discrimination has been studied extensively in different non-human animal species. In the current study, we tested eleven hand-raised wolves (Canis lupus in a two-way choice task. We placed a number of food items (one to four sequentially into two opaque cans and asked the wolves to choose the larger amount. Moreover, we conducted two additional control conditions to rule out non-numerical properties of the presentation that the animals might have used to make the correct choice. Our results showed that wolves are able to make quantitative judgments at the group, but also at the individual level even when alternative strategies such as paying attention to the surface area or time and total amount are ruled out. In contrast to previous canine studies on dogs (Canis familiaris and coyotes (Canis latrans, our wolves’ performance did not improve with decreasing ratio, referred to as Weber’s law. However, further studies using larger quantities than we used in the current setup are still needed to determine whether and when wolves’ quantity discrimination conforms to Weber’s law.

  15. Morfologia de células neurológicas e imunológicas da medula espinhal de cães (Canis familiaris, Linnaeus, 1758 - DOI: 10.4025/actascianimsci.v27i3.1215 Morphology of neurological and immunologic cells of canine spinal cord - DOI: 10.4025/actascianimsci.v27i3.1215

    Directory of Open Access Journals (Sweden)

    Maria Rita Pacheco


    Full Text Available Analisou-se a morfologia de neurônios, de neuróglia e de células de defesa da pia-máter das regiões cervical, torácica e lombar da medula espinhal de cães. Utilizaram-se as técnicas da hematoxilina-eosina (HE, do tricrômico de Masson (TM, da impregnação pela prata e da peroxidase anti-peroxidase (PAP. Pela coloração com TM, evidenciaram-se neurônios com núcleo acidófilo e citoplasma basófilo e com HE, o núcleo mostrou-se basófilo e o citoplasma acidófilo. Observou-se irregularidade nos prolongamentos citoplasmáticos (núcleo grande, esférico ou oval, pouco corado, com cromatina frouxa e um ou mais nucléolos evidentes. Pela PAP, visualizou-se astrócitos com citoplasma marrom e núcleo roxo-azulado, possuindo os fibrosos prolongamentos longos e menos ramificados e os protoplasmáticos, prolongamentos curtos e abundantes. Pela prata, evidenciou-se oligodendróglia com corpo celular arredondado e micróglia com corpo celular alongado e pequeno, tanto nas substâncias brancas quanto nas cinzentas. As células ependimárias apresentaram epitélio cilíndrico simples ciliado e as células de defesa apresentaram neutrófilos segmentados e eosinófilosThis study analyzed neurons and neuroglia morphology, and pia mater defensive cells from canine spinal cord cervical, thoracic, and lumbar regions. Hematoxylin-eosin (HE, Masson’s trichrome (MT, silver and anti-peroxydase peroxydase (APP stains were used. By MT, neurons with acidophilic nucleus and basophilic cytoplasm were observed. HE showed neurons with basophilic nucleus and acidophilic cytoplasm. Irregularity of cytoplasmatic processes, large, round or oval nucleus, pale-stained, and one or more nucleolus was also noted. By APP, astrocytes were visualized with brown cytoplasm and blue-purple nucleus, showing fibrous astrocytes with long and less ramified processes, and protoplasmic astrocytes with short and ramified processes. Silver stain showed oligodendrocytes with round cell body and microglia with small and thin cell body, in both white and gray matter. Ependimary cells showed ciliated cylindrical epithelium, and the defensive cells found were mature neutrophiles and eosinophiles


    Chitwood, M Colter; Swingen, Morgan B; Lashley, Marcus A; Flowers, James R; Palamar, Maria B; Apperson, Charles S; Olfenbuttel, Colleen; Moorman, Christopher E; DePerno, Christopher S


    Coyotes (Canis latrans) have expanded recently into the eastern US and can serve as a source of pathogens to domestic dogs (Canis lupus familiaris), livestock, and humans. We examined free-ranging coyotes from central North Carolina, US, for selected parasites and prevalence of antibodies against viral and bacterial agents. We detected ticks on most (81%) coyotes, with Amblyomma americanum detected on 83% of those with ticks. Fifteen (47%) coyotes were positive for heartworms (Dirofilaria immitis), with a greater detection rate in adults (75%) than juveniles (22%). Serology revealed antibodies against canine adenovirus (71%), canine coronavirus (32%), canine distemper virus (17%), canine parvovirus (96%), and Leptospira spp. (7%). We did not detect antibodies against Brucella abortus/suis or Brucella canis. Our results showed that coyotes harbor many common pathogens that present health risks to humans and domestic animals and suggest that continued monitoring of the coyote's role in pathogen transmission is warranted. PMID:25984773

  17. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L.S.


    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  18. Assessing inbreeding and loss of genetic variation in canids, domestic dog (Canis familiaris) and wolf (Canis lupus), using pedigree data


    Jansson, Mija


    Genetic variation is necessary to maintain the ability of wild and domestic populations to genetically adapt to changed selective pressures. When relationships among individuals are known, conservation genetic management can be based on statistical pedigree analysis. Such approaches have traditionally focused on wild animal conservation breeding in captivity. In this thesis, I apply pedigree-based techniques to domestic and wild animal populations, focusing on two canids – the domestic dog an...

  19. Parasitology, virology, and serology of free-ranging coyotes (Canis latrans) from central Georgia, USA. (United States)

    Gates, Michelle; Gerhold, Richard W; Wilkes, Rebecca P; Gulsby, William D; Maestas, Lauren; Rosypal, Alexa; Miller, Karl V; Miller, Debra L


    We examined 31 free-ranging coyotes (Canis latrans) from central Georgia, USA, for select parasites and viral agents. Sixteen coyotes had adult heartworms (Dirofilaria immitis). Serum samples from 27 animals revealed antibodies against canine parvovirus (100%), canine distemper virus (48%), canine adenovirus (37%), and Trypanosoma cruzi (7%); none were detected against Leishmania spp. Twenty-two of 24 (92%) coyotes were positive for Toxoplasma gondii. Real-time PCR of feces revealed 32% of coyotes were shedding canine parvovirus, and sequencing revealed type 2b and 2c. Because coyotes could be a spillover host of domestic dog (Canis lupus familiaris) pathogens, studies of the transmission of pathogens between coyotes and domestic dogs are warranted. PMID:25098300

  20. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna Kis

    Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  1. Concomitant administration of GonaCon™ and rabies vaccine in female dogs (Canis familiaris) in Mexico. (United States)

    Vargas-Pino, Fernando; Gutiérrez-Cedillo, Verónica; Canales-Vargas, Erick J; Gress-Ortega, Luis R; Miller, Lowell A; Rupprecht, Charles E; Bender, Scott C; García-Reyna, Patricia; Ocampo-López, Juan; Slate, Dennis


    Mexico serves as a global model for advances in rabies prevention and control in dogs. The Mexican Ministry of Health (MMH) annual application of approximately 16 million doses of parenteral rabies vaccine has resulted in significant reductions in canine rabies during the past 20 years. One collateral parameter of rabies programs is dog population management. Enhanced public awareness is critical to reinforce responsible pet ownership. Surgical spaying and neutering remain important to prevent reproduction, but are impractical for achieving dog population management goals. GonaCon™, an anti-gonadotropin releasing hormone (GnRH) vaccine, was initially tested in captive female dogs on the Navajo Nation, 2008. The MMH led this international collaborative study on an improved formulation of GonaCon™ in captive dogs with local representatives in Hidalgo, Mexico in 2011. This study contained 20 bitches assigned to Group A (6 control), Group B (7 GonaCon™), and Group C (7 GonaCon™ and rabies vaccine). Vaccines were delivered IM. Animals were placed under observation and evaluated during the 61-day trial. Clinically, all dogs behaved normally. No limping or prostration was observed, in spite of minor muscle atrophy post-mortem in the left hind leg of dogs that received GonaCon™. Two dogs that began the study pregnant give birth to healthy pups. Dogs that received a GonaCon™ injection had macro and microscopic lesions consistent with prior findings, but the adverse injection effects were less frequent and lower in intensity. Both vaccines were immunogenic based on significant increases in rabies virus neutralizing antibodies and anti-GnRH antibodies in treatment Groups B and C. Simultaneous administration of GonaCon™ and rabies vaccine in Group C did not affect immunogenicity. Progesterone was suppressed significantly in comparison to controls. Future studies that monitor fertility through multiple breeding cycles represent a research need to determine the value of integrating this vaccine into dog rabies management. PMID:23871822

  2. Algorithm-supported visual error correction (AVEC) of heart rate measurements in dogs, Canis lupus familiaris. (United States)

    Schöberl, Iris; Kortekaas, Kim; Schöberl, Franz F; Kotrschal, Kurt


    Dog heart rate (HR) is characterized by a respiratory sinus arrhythmia, and therefore makes an automatic algorithm for error correction of HR measurements hard to apply. Here, we present a new method of error correction for HR data collected with the Polar system, including (1) visual inspection of the data, (2) a standardized way to decide with the aid of an algorithm whether or not a value is an outlier (i.e., "error"), and (3) the subsequent removal of this error from the data set. We applied our new error correction method to the HR data of 24 dogs and compared the uncorrected and corrected data, as well as the algorithm-supported visual error correction (AVEC) with the Polar error correction. The results showed that fewer values were identified as errors after AVEC than after the Polar error correction (p strings with deleted values seemed to be closer to the original data than were those with inserted means. We concluded that our method of error correction is more suitable for dog HR and HR variability than is the customized Polar error correction, especially because AVEC decreases the likelihood of Type I errors, preserves the natural variability in HR, and does not lead to a time shift in the data. PMID:25540125

  3. Whole Genome Association Study to Detect Single Nucleotide Polymorphisms for Behavior in Sapsaree Dog (Canis familiaris). (United States)

    Ha, J H; Alam, M; Lee, D H; Kim, J-J


    The purpose of this study was to characterize genetic architecture of behavior patterns in Sapsaree dogs. The breed population (n = 8,256) has been constructed since 1990 over 12 generations and managed at the Sapsaree Breeding Research Institute, Gyeongsan, Korea. Seven behavioral traits were investigated for 882 individuals. The traits were classified as a quantitative or a categorical group, and heritabilities (h(2)) and variance components were estimated under the Animal model using ASREML 2.0 software program. In general, the h(2) estimates of the traits ranged between 0.00 and 0.16. Strong genetic (r G ) and phenotypic (r P ) correlations were observed between nerve stability, affability and adaptability, i.e. 0.9 to 0.94 and 0.46 to 0.68, respectively. To detect significant single nucleotide polymorphism (SNP) for the behavioral traits, a total of 134 and 60 samples were genotyped using the Illumina 22K CanineSNP20 and 170K CanineHD bead chips, respectively. Two datasets comprising 60 (Sap60) and 183 (Sap183) samples were analyzed, respectively, of which the latter was based on the SNPs that were embedded on both the 22K and 170K chips. To perform genome-wide association analysis, each SNP was considered with the residuals of each phenotype that were adjusted for sex and year of birth as fixed effects. A least squares based single marker regression analysis was followed by a stepwise regression procedure for the significant SNPs (p<0.01), to determine a best set of SNPs for each trait. A total of 41 SNPs were detected with the Sap183 samples for the behavior traits. The significant SNPs need to be verified using other samples, so as to be utilized to improve behavior traits via marker-assisted selection in the Sapsaree population. PMID:26104397

  4. Do dogs (Canis lupus familiaris make counterproductive choices because they are sensitive to human ostensive cues?

    Directory of Open Access Journals (Sweden)

    Sarah Marshall-Pescini

    Full Text Available Dogs appear to be sensitive to human ostensive communicative cues in a variety of situations, however there is still a measure of controversy as to the way in which these cues influence human-dog interactions. There is evidence for instance that dogs can be led into making evaluation errors in a quantity discrimination task, for example losing their preference for a larger food quantity if a human shows a preference for a smaller one, yet there is, so far, no explanation for this phenomenon. Using a modified version of this task, in the current study we investigated whether non-social, social or communicative cues (alone or in combination cause dogs to go against their preference for the larger food quantity. Results show that dogs' evaluation errors are indeed caused by a social bias, but, somewhat contrary to previous studies, they highlight the potent effect of stimulus enhancement (handling the target in influencing the dogs' response. A mild influence on the dog's behaviour was found only when different ostensive cues (and no handling of the target were used in combination, suggesting their cumulative effect. The discussion addresses possible motives for discrepancies with previous studies suggesting that both the intentionality and the directionality of the action may be important in causing dogs' social biases.

  5. Influence of Owners' Attachment Style and Personality on Their Dogs' (Canis familiaris) Separation-Related Disorder


    Konok Veronika; Kosztolányi András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi Ádám


    Previous research has suggested that owners’ attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners’ attachment style, personality traits and the personality of the dog influence the occurrence ...

  6. Influence of owners' attachment style and personality on their dogs' (Canis familiaris) separation-related disorder. (United States)

    Konok, Veronika; Kosztolányi, András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi, Ádám


    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian) dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD), Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss. PMID:25706147

  7. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae from Panama

    Directory of Open Access Journals (Sweden)

    Roberto Miranda C


    Full Text Available Objetive. To determine the distribution of ectoparasites in dogs in Panama. Materials and methods. There were surveyed 720 canines belonging to 57 communities. Results. The results showed that 84% of the dogs were infested with at least one species of ectoparasite. Dogs from lowlands showed a higher percentage of parasitism and a greater biodiversity of parasites than dogs from highlands. There were found seven species of ticks, four species of fleas, two species of lice, and one specie of botfly. The ticks Rhipicephalus sanguineus, Amblyomma cajennense, A. ovale and the flea Ctenocephalides felis were widespread; however Ixodes boliviensis and Pulex simulans showed a much narrower geographic distribution and they were found only in dogs from highlands. The flea species Rhopalopsyllus cacicus and the tick Haemaphysalis juxtakochi were found for the first time in panamanian dogs. Conclusions. The environmental situation in Panama, can encourage that wildlife ectoparasites parasitized dogs in absence of their native hosts. This condition may increase transmission risk of some diseases where the ticks and fleas are vectors.

  8. Oxytocin Receptor Gene Polymorphisms Are Associated with Human Directed Social Behavior in Dogs (Canis familiaris)


    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Ádám; Rónai, Zsolt; Kubinyi, Enikő


    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associ...

  9. Helminths parasites of stray dogs (Canis lupus familiaris) from Cuiabá, Midwestern of Brazil


    Dirceu Guilherme de Souza Ramos; Bruna Karina Alexandria Zocco; Mariana de Medeiros Torres; Ísis Assis Braga; Richard de Campos Pacheco; Afonso Lodovico Sinkoc


    Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest...

  10. Verhaltensphysiologische Experimente zur Erkennung und Unterscheidung menschlicher Gesichter beim Haushund (Canis familiaris)


    Gutmann, Isabel


    In der vorliegenden Arbeit wurde die Fähigkeit von Hunden zur Erkennung und Unterscheidung menschlicher Gesichter untersucht. Zu diesem Zweck wurden verschiedene Verhaltensexperimente mit fünf Hunden durchgeführt. Zunächst wurden die Hunde darauf dressiert, ein einlaminiertes DIN A4 Blatt mit einem Gesicht im Zentrum in der dafür vorgesehenen Apparatur mit der Schnauze zu berühren. Bei der Dressur wurden immer zwei Folien präsentiert, wobei nur eine Wahl, nämlich die des Dressurgesichts, durc...

  11. Clinical, anatomic, and immunopathologic characterization of Babesia gibsoni infection in the domestic dog (Canis familiaris). (United States)

    Wozniak, E J; Barr, B C; Thomford, J W; Yamane, I; McDonough, S P; Moore, P F; Naydan, D; Robinson, T W; Conrad, P A


    The pathology associated with acute, chronic, and recrudescent Babesia gibsoni infections was characterized in a group of 6 naturally or experimentally infected, spleen-intact and splenectomized dogs. All experimentally infected dogs became acutely parasitemic, lethargic, anemic, thrombocytopenic, and hemoglobinuric. Anatomic lesions associated, with the disease included diffuse nonsuppurative periportal and centrilobular hepatitis, multifocal necrotizing arteritis, membranoproliferative glomerulonephritis, reactive lymphadenopathy, diffuse erythrophagocytosis, and extramedullary hematopoiesis. The density of CD3+ lymphocytes within the liver sinusoids was markedly increased. Aggregates of large mononuclear cells with immunohistochemical features of activated macrophages were demonstrated in the central veins of the liver. Kupffer cells throughout the hepatic sinusoids appeared hypertrophic and prominent. The density of sinusoidal T lymphocytes, macrophages in central veins, and the degree of Kupffer cell hypertrophy were greatest in the splenectomized dogs. Multifocal deposits of IgM antibody were immunohistochemically demonstrated within the walls of inflamed arteries and renal glomeruli. The results of this study suggest that intense immunostimulation resulting in activation and expansion of T and B lymphocyte populations, macrophage recruitment and activation, vasculitis, glomerulonephritis and anemia contribute to the pathology associated with B. gibsoni infections. PMID:9267413

  12. Performance of Pugs, German Shepherds, and Greyhounds (Canis lupus familiaris) on an odor-discrimination task. (United States)

    Hall, Nathaniel J; Glenn, Kelsey; Smith, David W; Wynne, Clive D L


    Public opinion and the scientific literature alike reflect a widespread assumption that there are differences in behavior between dog breeds. Direct empirical behavioral assessments of such differences, however, are rare and have produced mixed results. One area where breed differences are often assumed is olfaction, where German Shepherds, hounds, and Labradors are commonly used for odor-detection work, whereas toy breeds and brachycephalic dogs, such as Pugs, are not. Choice of breed for scent detection work, however, may be driven more by historical choices than data. In this article we directly assessed the ability of German Shepherds, Pugs, and Greyhounds to acquire a simple olfactory discrimination, and their ability to maintain performance when the target odorant was diluted. Our results show that contrary to expectations, Pugs significantly outperformed the German Shepherds in acquiring the odor discrimination and maintaining performance when the odorant concentration was decreased. Nine of 10 Greyhounds did not complete acquisition training because they failed a motivation criterion. These results indicate that Pugs outperformed German Shepherds in the dimensions of olfaction assessed. Greyhounds showed a general failure to participate. Overall, our results highlight the importance of direct behavioral measurement of assumed behavioral breed differences. PMID:26010195

  13. Canis familiaris, un nuevo hospedero de ornithodoros (a.) puertoricensis fox, 1947 (acari: ixodida) en colombia





    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de g...

  14. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)



    Full Text Available


    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave: garrapatas, perros, Ornithodoros puertoricensis, Ixodida, Colombia.


    Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

    Key words: Ticks, dogs, Ornithodoros puertoricensis, Ixodida, Colombia

  15. Pharmacokinetics of Ceftiofur Crystalline-Free Acid in Clinically Healthy Dogs (Canis lupus familiaris). (United States)

    Hooper, Sarah E; Korte, Scott W; Giguère, Steeve; Fales, William H; Davis, Jennifer L; Dixon, Lonny W


    Economical, injectable antibiotics are beneficial when clinical manifestations of an animal model prevent the use of oral antibiotics. Ceftiofur crystalline-free acid (CCFA) is an injectable, sustained-release form of ceftiofur, a third-generation cephalosporin that is labeled for use in swine, cattle, and horses. Because CCFA is an economical, injectable antibiotic that could be of value for use in research dogs, the objective of this study was to determine the pharmacokinetic properties of CCFA in apparently healthy dogs and to determine the minimal inhibitory concentrations of ceftiofur for veterinary pathogens cultured during 2011 through 2014 from the respiratory system, integumentary system, and urinary system of dogs. The study population comprised of 5 dogs (age, 1 y; weight, 24.7 to 26.9 kg) that were deemed healthy after no abnormalities were found on physical exam, CBC analysis, and clinical chemistry panel. Each dog received CCFA at 5.0 mg/kg SC, and blood samples were collected before administration of CCFA and at 1, 4, 8, 12, 24, 36, 48, 72, 96, 120, 144, 168, 192, 216, and 240 h after injection. The maximal plasma concentration (mean ± 1 SD) of CCFA was 1.98 ± 0.40 μ g/mL, time to reach maximal concentration was 22.3 ± 8.9 h, half-life was 56.6 ± 16.9 h, and AUC0-last was 124.98 ± 18.45 μ g-h/mL. The minimal inhibitory concentrations of ceftiofur ranged from ≤ 0.25 to ≥ 8.0 μ g/mL; ceftiofur was most effective against Pasteurella spp., Proteus spp., and Escherichia coli haemolytica and least effective against Bordatella bronchiseptica, Enterococcus spp., and Pseudomonas aeruginosa. PMID:27025816


    Directory of Open Access Journals (Sweden)



    Full Text Available

    Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato fisiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos fisiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  17. Comparative functional anatomy of the epaxial musculature of dogs (Canis familiaris) bred for sprinting vs. fighting. (United States)

    Webster, Emma L; Hudson, Penny E; Channon, Sarah B


    The axial musculoskeletal system of quadrupedal mammals is not currently well understood despite its functional importance in terms of facilitating postural stability and locomotion. Here we examined the detailed architecture of the muscles of the vertebral column of two breeds of dog, the Staffordshire bull terrier (SBT) and the racing greyhound, which have been selectively bred for physical combat and high speed sprint performance, respectively. Dissections of the epaxial musculature of nine racing greyhounds and six SBTs were carried out; muscle mass, length, and fascicle lengths were measured and used to calculate muscle physiological cross-sectional area (PCSA), and to estimate maximum muscle potential for force, work and power production. The longissimus dorsi muscle was found to have a high propensity for force production in both breeds of dog; however, when considered in combination with the iliocostalis lumborum muscle it showed enhanced potential for production of power and facilitating spinal extension during galloping gaits. This was particularly the case in the greyhound, where the m. longissimus dorsi and the m. iliocostalis lumborum were estimated to have the potential to augment hindlimb muscle power by ca. 12%. Breed differences were found within various other muscles of the axial musculoskeletal system, particularly in the cranial cervical muscles and also the deep muscles of the thorax which insert on the ribs. These may also highlight key functional adaptations between the two breeds of dog, which have been selectively bred for particular purposes. Additionally, in both breeds of dog, we illustrate specialisation of muscle function by spinal region, with differences in both mass and PCSA found between muscles at varying levels of the axial musculoskeletal system, and between muscle functional groups. PMID:24917310

  18. Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

    Directory of Open Access Journals (Sweden)

    Jennifer B Nagashima

    Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.

  19. Auditory contagious yawning in domestic dogs (Canis familiaris): first evidence for social modulation. (United States)

    Silva, Karine; Bessa, Joana; de Sousa, Liliana


    Dogs' capacity to 'catch' human yawns has recently attracted the attention of researchers in the field of animal cognition. Following recent studies suggesting that contagion yawning in humans, and some other primates, is empathy-related, some authors have considered the possibility that the same mechanism may underlie contagious yawning in dogs. To date, however, no positive evidence has been found, and more parsimonious hypotheses have been put forward. The present study explored the 'contagion-only' hypothesis by testing whether the mere sound of a human yawn can be sufficient to elicit yawning in dogs, in a way that is unaffected by social-emotional factors. Unexpectedly, results showed an interesting interplay between contagion and social effects. Not only were dogs found to catch human yawns, but they were also found to yawn more at familiar than unfamiliar yawns. Although not allowing for conclusive inferences about the mechanisms underlying contagious yawning in dogs, this study provides first data that renders plausible empathy-based, emotionally connected, contagious yawning in these animals. PMID:22526686

  20. Empathic-like responding by domestic dogs (Canis familiaris) to distress in humans: an exploratory study. (United States)

    Custance, Deborah; Mayer, Jennifer


    Empathy covers a range of phenomena from cognitive empathy involving metarepresentation to emotional contagion stemming from automatically triggered reflexes. An experimental protocol first used with human infants was adapted to investigate empathy in domestic dogs. Dogs oriented toward their owner or a stranger more often when the person was pretending to cry than when they were talking or humming. Observers, unaware of experimental hypotheses and the condition under which dogs were responding, more often categorized dogs' approaches as submissive as opposed to alert, playful or calm during the crying condition. When the stranger pretended to cry, rather than approaching their usual source of comfort, their owner, dogs sniffed, nuzzled and licked the stranger instead. The dogs' pattern of response was behaviorally consistent with an expression of empathic concern, but is most parsimoniously interpreted as emotional contagion coupled with a previous learning history in which they have been rewarded for approaching distressed human companions. PMID:22644113

  1. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L

    International Nuclear Information System (INIS)

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs

  2. A New Tapeworm Dipilidium Singhi N.sp. (EUCESTODA : DIPYLIDIDAE) From Canis Familiaris


    D. P. Patil


    The present communication deals with description of a new species of the genus, Dipylidium Leuckart (1863) with its type species, Dipylidium crassum Millzner (1926), Dipylidium longutum Millzner (1926) Dipylidium gracile Millzner (1926), Dipylidium wakleri Sandhi (1923), in having the number of testes, but differs from them, in many characters.

  3. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris). (United States)

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő


    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system. PMID:24454713

  4. Influence of owners' attachment style and personality on their dogs' (Canis familiaris separation-related disorder.

    Directory of Open Access Journals (Sweden)

    Veronika Konok

    Full Text Available Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD, Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  5. Cellular Microbiology of Mycoplasma canis. (United States)

    Michaels, Dina L; Leibowitz, Jeffrey A; Azaiza, Mohammed T; Shil, Pollob K; Shama, Suzanne M; Kutish, Gerald F; Distelhorst, Steven L; Balish, Mitchell F; May, Meghan A; Brown, Daniel R


    Mycoplasma canis can infect many mammalian hosts but is best known as a commensal or opportunistic pathogen of dogs. The unexpected presence of M. canis in brains of dogs with idiopathic meningoencephalitis prompted new in vitro studies to help fill the void of basic knowledge about the organism's candidate virulence factors, the host responses that it elicits, and its potential roles in pathogenesis. Secretion of reactive oxygen species and sialidase varied quantitatively (P < 0.01) among strains of M. canis isolated from canine brain tissue or mucosal surfaces. All strains colonized the surface of canine MDCK epithelial and DH82 histiocyte cells and murine C8-D1A astrocytes. Transit through MDCK and DH82 cells was demonstrated by gentamicin protection assays and three-dimensional immunofluorescence imaging. Strains further varied (P < 0.01) in the extents to which they influenced the secretion of tumor necrosis factor alpha (TNF-α) and the neuroendocrine regulatory peptide endothelin-1 by DH82 cells. Inoculation with M. canis also decreased major histocompatibility complex class II (MHC-II) antigen expression by DH82 cells (P < 0.01), while secretion of gamma interferon (IFN-γ), interleukin-6 (IL-6), interleukin-10 (IL-10), and complement factor H was unaffected. The basis for differences in the responses elicited by these strains was not obvious in their genome sequences. No acute cytopathic effects on any homogeneous cell line, or consistent patterns of M. canis polyvalent antigen distribution in canine meningoencephalitis case brain tissues, were apparent. Thus, while it is not likely a primary neuropathogen, M. canis has the capacity to influence meningoencephalitis through complex interactions within the multicellular and neurochemical in vivo milieu. PMID:27045036

  6. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available dog Canis lupus familiaris Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Canis_lupus..._familiaris_L.png Canis_lupus_familiaris_NL.png Canis_lupus_familiaris_S.png Canis_lupus_familiari...s_NS.png ...

  7. Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

    NARCIS (Netherlands)

    M.M. Hassan; O.F. Osman; F.M.A. El-Raba'a; H.D.F.H. Schallig; D.E.A. Elnaiem


    Background: The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a re

  8. ESTUDIO PRELIMINAR DE LOS HALLAZGOS DE CANIS FAMILIARIS EN LA PIRÁMIDE CON RAMPA N°7, SANTUARIO DE PACHACAMAC, PERÚ/Preliminary study of Canis familiaris remains in the Pyramid with Ramp N°7, Pachacamac Sanctuary, Perú.


    Denise Pozzi-Escot; Isabel Cornejo Rivera; Enrique Angulo Costaneira; Katiusha Bernuy Quiroga


    El Santuario arqueológico de Pachacamac tuvo una ocupación de alrededor de mil años, desde los primeros siglos de la era cristiana hasta la llegada de los conquistadores españoles al sitio. Durante el Horizonte Tardío (1470-1533 d.C.), bajo el dominio Inca fue el más importante conjunto ceremonial de la costa central peruana, al cual acudían peregrinos de diversos y lejanos lugares. Recientemente, en el acceso a la Pirámide con Rampa N°7 (PCR 07), conectado a la principal vía de ingreso al sa...

  9. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)


    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.



    Francimar Fernandes Gomes; Antonio Peixoto Albernaz; Farlen Jose Bebber Miranda; Luize Néli Nunes Garcia


    Os ancilostomatídeos são nematóides hematófagos parasitas do intestino delgado, podendo causar retardo no crescimento, inapetência, anorexia, apatia, anemia e até a morte. No homem, algumas espécies como Ancylostoma caninum, A. braziliense e A. tubaeforme podem causar larva migrans cutânea, quando as larvas infectantes de terceiro estágio penetram ativamente a pele íntegra. O objetivo deste trabalho foi detectar o parasitismo por ancilostomatídeos em fezes de cães domiciliados e assintomático...

  11. Toxocara canis y asma bronquial Toxocara canis and bronchial asthma

    Directory of Open Access Journals (Sweden)

    María de los Ángeles López


    Full Text Available A fin de evaluar la relación entre la infección por Toxocara canis y los síntomas del asma bronquial en niños de una región subtropical con alta prevalencia de toxocariosis, se estudiaron 47 niños con asma y 53 sin asma como grupo control. Se efectuó el examen físico completo, registrándose datos clínicos y epidemiológicos. En los niños con asma se categorizó el patrón de presentación, frecuencia y gravedad de los síntomas con una escala de I a IV. Se investigó la presencia de anticuerpos anti-Toxocara canis en ambos grupos mediante el método de ELISA en fase sólida, empleando antígeno de excreción/secreción y se efectuó dosaje de Ig E total. Los resultados muestran una seropositividad del 55% en el total de los niños, del 57.4% en los niños con asma y del 52.8% en los controles. En los niños con sintomatología más grave (grado II, III y IV hubo un 67.7% de seropositivos, mientras que en los niños con síntomas de grado I la seropositividad fue de 37.5% (p = 0.0470. La infección por T. canis actuaría como un co-factor agravante de los síntomas del asma bronquial.In order to evaluate the association between the infection by Toxocara canis and the symptoms of asthma in children from a subtropical region with high prevalence of toxocariasis, 47 asthmatic children and 53 non-asthmatics as a control group were studied. A complete physical examination was performed and clinical and epidemiological data were registered. In asthmatic children the frequency and severity of symptoms were classified in grades I to IV. The presence of anti-Toxocara canis antibodies in both groups was evaluated employing a solid phase ELISA method with excretion/secretion antigens, and total Ig E was also measured. Results showed a total seropositivity of 55%, 57.4% in children with asthma and 52.8% in the control group. Among asthmatics with severe symptoms (grade II, III and IV, there was a 67.7% of seropositivity while in children with


    Directory of Open Access Journals (Sweden)

    Adriana Jakovcevic


    Full Text Available El estudio de las diferencias individuales en el comportamiento de los perros domésticos tiene un gran valor aplicado dado que permite una mejor selección de los mismos para cumplir las variadas funciones que tienen en la sociedad humanacomo perros guía, policía, compañía, rescatistas de personas, etc. En el trabajo que se informa se presenta una revisión de estudios sobre diferencias individuales en perros, basada únicamente en las baterías conductuales que evalúan un conjunto de rasgos del temperamento. Con este objetivo se realiza una breve descripción de cada batería de pruebas utilizadas en la literatura, analizando las definiciones operacionales de las variables eva luadas y los diferentes tipos de estímulos utilizados. Los rasgos mayormente evaluados son: temerosidad, agresividad, disposición al entrenamiento y sociabilidad. La te merosidad, en general es evaluada a través de la respuesta del animal ante la aparición de un estímulo súbito que puede ser intenso o no, como por ejemplo la reacción frente a un ruido fuerte, la apertura de un paraguas, o la aparición repentina de una figura humana. La agresividad se mide a través de la reacción frentea la amenaza o provocación por parte de un humano, la sustracción de un objeto o la confrontación con un perro dominante. La disposición al entrenamiento es estudiada a través de la respuesta del animal frente a diferentes estímulos como el juego con un trapo o una cuerda, el ejercicio de devolución de un objeto o la obediencia frente a distintos comandos. Por último, la sociabilidad se evalúa con la aparición o el acercamiento de un humano desconocido o con la exposición a un perro no familiar. Se discuten además las limitaciones metodológicas de las baterías así como también los importantes usos aplicados de las mismas.

  13. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  14. Two new species of Sarcocystis, Sarcocystis caninum and Sarcocystis svanai (Apicomplexa: Sarcocystidae) from the domestic dog (Canis familiaris) (United States)

    Sarcocystis species have a 2-host life cycle with carnivores as definitive hosts and herbivores as intermediate hosts. Occasionally dogs are definitive as well as intermediate hosts for Sarcocystis species. There are several reports of Sarcocystis sarcocysts in muscles of dogs but these species have...

  15. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris. (United States)

    de Oliveira Filho, Jaires Gomes; Sarria, André Lucio Franceschini; Ferreira, Lorena Lopes; Caulfield, John C; Powers, Stephen J; Pickett, John A; de León, Adalberto A Pérez; Birkett, Michael A; Borges, Lígia Miranda Ferreira


    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed, the beagle, is mediated by volatile organic compounds (VOCs) 2-hexanone and benzaldehyde present in beagle odour. Ectoparasite location of animal hosts is affected by variation in these odour components and their ratios. The aim of this study was to quantify the release rate, and the ratio, of 2-hexanone and benzaldehyde from beagles. The odour of three beagles was collected, for four days, over one week (day 0, day 1, day 4 and day 7). The compounds were identified using coupled high-resolution gas chromatography-mass spectrometry (GC-MS), and authentic standards of compounds were used to generate external calibration curves for quantification. Both compounds were found in all dogs on all days. The amount of benzaldehyde was always higher than that of 2-hexanone and so their ratio varied from unity, on average (over time) being 3.128±0.365, 1.902±0.390, 1.670±0.671ngmL(-1) for beagle 1, 2 and 3, respectively. There was no significant (p<0.05, F-test) effect of time. The overall mean was 2.233±0.387ngmL(-1). These results further previous findings by documenting the presence of 2-hexanone and benzaldehyde in beagle odour samples covering a 7-day period. This knowledge enables development of repellents to protect dogs from R. sanguineus s. l. infestation. PMID:27085013

  16. Quantification of brown dog tick repellent, 2-hexanone and benzaldehyde, release from tick-resistant Beagle dogs, Canis lupus familiaris (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  17. [Formation of genetic polymorphism in connection with phylogenesis and microevolution of the domestic dog Canis familiaris L]. (United States)

    Kniazev, S P; Tikhonov, V N; Tanabe, Y; Morozov, P S


    The analysis of genetic relationships between numerous breeds and populations of domestic dogs of Asian and European origin was performed by studying their polymorphism for 14 loci of biochemical markers. Phylogenetic positions of different breed groups, related to one another and to ancestral forms from the center of domestication, were elucidated. Directions of gene flow in the formation of breed as well as dynamics and vectors of the forming genetic structure in microevolution of this extremely polytypic species, were established. PMID:10096028

  18. The response of guide dogs and pet dogs (Canis familiaris) to cues of human referential communication (pointing and gaze). (United States)

    Ittyerah, Miriam; Gaunet, Florence


    The study raises the question of whether guide dogs and pet dogs are expected to differ in response to cues of referential communication given by their owners; especially since guide dogs grow up among sighted humans, and while living with their blind owners, they still have interactions with several sighted people. Guide dogs and pet dogs were required to respond to point, point and gaze, gaze and control cues of referential communication given by their owners. Results indicate that the two groups of dogs do not differ from each other, revealing that the visual status of the owner is not a factor in the use of cues of referential communication. Both groups of dogs have higher frequencies of performance and faster latencies for the point and the point and gaze cues as compared to gaze cue only. However, responses to control cues are below chance performance for the guide dogs, whereas the pet dogs perform at chance. The below chance performance of the guide dogs may be explained by a tendency among them to go and stand by the owner. The study indicates that both groups of dogs respond similarly in normal daily dyadic interaction with their owners and the lower comprehension of the human gaze may be a less salient cue among dogs in comparison to the pointing gesture. PMID:18769948

  19. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics. (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M


    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds. PMID:22723482

  20. Bad math in Linnaeus' Philosophia Botanica. (United States)

    Podani, János; Szilágyi, András


    In Philosophia Botanica (1751), Carolus Linnaeus (1707-1778) presented a calculation of the number of plant genera that may be distinguished based on his taxonomic concepts. In order to derive that number, he relied upon the organs of fructification, which represent the flower and the fruit, by selecting over 30 elements from them, and then assuming that each could vary by four dimensions. However, while Linnaeus was good in counting stamens and pistils, he and many of his followers who edited or translated Philosophia Botanica were less careful, basing their calculations of the number of possible genera on flawed assumptions, or even introducing basic arithmetic errors. Furthermore, although mathematics was quite advanced in the eighteenth century, the gap between combinatorial and botanical thinking was too deep, preventing Linnaeus to seek a reasonable solution to the problem he raised. The authors demonstrate this by a historical analysis of 15 editions of Philosophia Botanica, plus many references to it, and conclude that the desired number almost always appeared in error during the past 265 years. The German botanist J. G. Gleditsch (1714-1786) was the most successful with respect to Linnaeus' original intention. Elementary mathematics demonstrates that if Linnaeus' assumptions were taken seriously, then the possible number of genera would be astronomical. The practice he followed in Genera Plantarum (1754) shows, however, that the fructification dimensions served as a universal set for Linnaeus from which he chose only the relevant ones for describing a particular genus empirically. Based on the corrections and modifications implemented in reworked editions, we suggest an evolutionary network for the historical and modern versions or translations of Philosophia Botanica. PMID:27412708

  1. A Novel Polypeptide from Cervus elaphus Linnaeus

    Institute of Scientific and Technical Information of China (English)

    LiangWENG; QiuLiZHOU; 等


    A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus). The velvet antler polypeptide consists of a single chain of 32 amino acid residues. Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.

  2. Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in Dogs in a Village of Eastern Sudan by Using a Screening PCR and Sequencing Methodologies


    Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; OKUDA, Masaru; Inokuma, Hisashi


    Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis.

  3. Carolus Linnaeus and the Edible Dormouse


    Carlo Violani; Bruno Zava


    Abstract Carolus Linnaeus was totally unacquainted with the Edible Dormouse Myoxus glis (L.), a species not found in Sweden: while describing Mus Rattus in the 10th Edition of the "Systema Naturae" (1758), the Swedish naturalist confessed his ignorance concerning the "Glis" of the ancients and suggested that it might have been the marmot or the hamster. Thanks to written information received from his ...

  4. Hallazgo de Ehrlichia canis en Chile, informe preliminar Ehrlichia canis in Chile; preliminary report

    Directory of Open Access Journals (Sweden)

    J. LÓPEZ


    Full Text Available Se describe el primer caso de Ehrlichiosis canina detectado en Chile, causado por la rickettsia Ehrlichia canis y transmitida por el vector Rhipicephalus sanguineus. El diagnóstico clínico fue confirmado en Alemania por Inmunofluorescencia Indirecta (IFATThe first case of canine ehrlichiosis detected in Chile is described. It is caused by the rickettsia Ehrlichia canis and carried by the vektor Rhipicephalus sanguineus. The clinical diagnosis was confirmed in Germany using the Immunofluorescent Antibody Test (IFA

  5. Carl Linnaeus and the visual representation of nature. (United States)

    Charmantier, Isabelle


    The Swedish naturalist Carl Linnaeus (1707-1778) is reputed to have transformed botanical practice by shunning the process of illustrating plants and relying on the primacy of literary descriptions of plant specimens. Botanists and historians have long debated Linnaeus's capacities as a draftsman. While some of his detailed sketches of plants and insects reveal a sure hand, his more general drawings of landscapes and people seem ill-executed. The overwhelming consensus, based mostly on his Lapland diary (1732), is that Linnaeus could not draw. Little has been said, however, on the role of drawing and other visual representations in Linnaeus's daily work as seen in his other numerous manuscripts. These manuscripts, held mostly at the Linnean Society of London, are peppered with sketches, maps, tables, and diagrams. Reassessing these manuscripts, along with the printed works that also contain illustrations of plant species, shows that Linnaeus's thinking was profoundly visual and that he routinely used visual representational devices in his various publications. This paper aims to explore the full range of visual representations Linnaeus used through his working life, and to reevaluate the epistemological value of visualization in the making of natural knowledge. By analyzing Linnaeus's use of drawings, maps, tables, and diagrams, I will show that he did not, as has been asserted, reduce the discipline of botany to text, and that his visual thinking played a fundamental role in his construction of new systems of classification. PMID:22363966

  6. Bibliographie der Flussperlmuschel Margaritifera Margaritifera (Linnaeus, 1758) [Mollusca: Pelecypoda


    Jungbluth, J.H.; H.E. Coomans; Grohs, H.


    Bibliography of the freshwater Pearlmussel Margaritifera margaritifera (Linnaeus, 1758) [Mollusca: Pelecypoda] The freshwater pearlmussel, described by Linnaeus as Mya margaritifera is one of the most important molluscs existing. It belongs with only a few congeneric fossil and recent species to the distinct family Margaritiferidae. The distribution of the species is Holarctic (figs. 1-2), being known from western, northern and central Europe, and via Siberia to Japan. In North America it is ...

  7. The transmission of Babesia canis to the wild dog Lycaon pictus (Temminck) and black-backed jackal Canis mesomelas Schreber. (United States)

    Van Heerden, J


    Babesia canis was successfully transmitted from the domestic dog to 3 wild dogs Lycaon pictus and 4 black-backed jackals Canis mesomelas. Both wild dogs and black-backed jackals showed no clinical signs or clinical pathological evidence of disease. Trophozoites of Babesia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from both black-backed jackals and wild dogs to the domestic dog. PMID:7252967

  8. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa


    Manuel Graziani


    Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazi...

  9. Forest fragmentation is associated with primary brood sex ratio in the treecreeper (Certhia familiaris).


    Suorsa, Petri; Helle, Heikki; Huhta, Esa; Jäntti, Ari; Nikula, Ari; Hakkarainen, Harri


    We studied the primary brood sex ratio of an old-growth forest passerine, the Eurasian treecreeper (Certhia familiaris), along a gradient of forest fragmentation. We found evidence that male nestlings were more costly to produce, since they suffered twofold higher nestling mortality and were larger in body size than females. Furthermore, the proportion of males in the brood was positively associated with the provisioning rate and the amount of food delivered to the nestlings. During the first...

  10. Pathogenic fungus Microsporum canis activates the NLRP3 inflammasome. (United States)

    Mao, Liming; Zhang, Liping; Li, Hua; Chen, Wei; Wang, Hongbin; Wu, Shuxian; Guo, Caiqin; Lu, Ailing; Yang, Guiwen; An, Liguo; Abliz, Paride; Meng, Guangxun


    Microsporum canis is a pathogenic fungus with worldwide distribution that causes tinea capitis in animals and humans. M. canis also causes invasive infection in immunocompromised patients. To defy pathogenic fungal infection, the host innate immune system is the first line of defense. As an important arm of innate immunity, the inflammasomes are intracellular multiprotein complexes that control the activation of caspase-1, which cleaves proinflammatory cytokine pro-interleukin-1β (IL-1β) into its mature form. To determine whether the inflammasome is involved in the host defense against M. canis infection, we challenged human monocytic THP-1 cells and mouse dendritic cells with a clinical strain of M. canis isolated from patients with tinea capitis. We found that M. canis infection triggered rapid secretion of IL-1β from both THP-1 cells and mouse dendritic cells. Moreover, by using gene-specific shRNA and competitive inhibitors, we determined that M. canis-induced IL-1β secretion was dependent on NLRP3. The pathways proposed for NLRP3 inflammasome activation, namely, cathepsin B activity, K(+) efflux, and reactive oxygen species production, were all required for the inflammasome activation triggered by M. canis. Meanwhile, Syk, Dectin-1, and Card9 were found to be involved in M. canis-induced IL-1β secretion via regulation of pro-IL-1β transcription. More importantly, our data revealed that M. canis-induced production of IL-1β was dependent on the NLRP3 inflammasome in vivo. Together, this study unveils that the NLRP3 inflammasome exerts a critical role in host innate immune responses against M. canis infection, and our data suggest that diseases that result from M. canis infection might be controlled by regulating the activation of inflammasomes. PMID:24478101

  11. West-to-east differences of Babesia canis canis prevalence in Dermacentor reticulatus ticks in Slovakia

    Czech Academy of Sciences Publication Activity Database

    Kubelová, M.; Tkadlec, Emil; Bednář, M.; Roubalová, Eva; Široký, P.


    Roč. 180, 3-4 (2011), s. 191-196. ISSN 0304-4017 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Babesia canis * Slovakia * Vector-borne disease * Natural focus * PCR-RFLP Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.579, year: 2011

  12. Carolus Linnaeus and the Edible Dormouse

    Directory of Open Access Journals (Sweden)

    Carlo Violani


    Full Text Available Abstract Carolus Linnaeus was totally unacquainted with the Edible Dormouse Myoxus glis (L., a species not found in Sweden: while describing Mus Rattus in the 10th Edition of the "Systema Naturae" (1758, the Swedish naturalist confessed his ignorance concerning the "Glis" of the ancients and suggested that it might have been the marmot or the hamster. Thanks to written information received from his correspondent in Slovenia, Giovanni Antonio Scopoli, Linnaeus was able to include the new species Sciurus Glis in his 12th Edition of the "Systema Naturae" (1766, reporting almost verbatim a summary of Scopoli's description of the rodent. Scopoli's letter is still preserved in the Library of the Linnean Society of London. The Linnean type locality "Habitat in Europa australi" for the Edible Dormouse Myoxus glis glis must therefore be restricted to "Southern Carniola, Slovenia", contra "Germany" as stated, for instance, by Miller (1912, Toschi (1965, Corbet (1978 and Storch (1978. A new name is required for the continental European form, for which M. glis germanicus ssp. nov. is here proposed. Some information on the appreciation of Myoxus glis as a delicacy ("carnes avide eduntur" in Linnaeus' words conclude the paper. Riassunto Carlo Linneo ed il Ghiro - Dopo aver descritto Mus Rattus nella decima edizione del "Systema Naturae" (1758 il naturalista svedese Carlo Linneo confessava di non essere a conoscenza del "Glis" degli antichi autori e ne suggeriva l'identificazione con la Marmotta o con il Criceto comune; è infatti noto che Myoxus glis non è diffuso in Svezia. In base ad una lettera ricevuta dal suo corrispondente in Slovenia, Giovanni Antonio Scopoli, Linneo fu in grado di descrivere questa nuova specie come Sciurus Glis nella dodicesima edizione del "Systema


    Directory of Open Access Journals (Sweden)



    Full Text Available The free-ranging urban dog, Canis domesticus (L. carcass decomposition in tropical region, i.e., Takht-i-Bahi, Mardan, Khyber Pakhtunkhwa, Pakistan during 15-25 May 2011 was characterized by 5 stages, i.e., fresh (12 h, bloated (13-48 h, active (49-96 h, advanced (97-144 h and dry (145-265 h and the ecological succession pattern of insect species collected were identified into 11 species of 3 orders. The insect species associated with the carcass of C. domesticus found that the blow flies, Chrysomya rufifacies (Macquart and house fly, Musca domestica (Linnaeus, 1758 were found in the fresh, bloat and active decay stages. However, the blow fly, C. megacephala (Fabricius; flesh fly, Parasarcophaga ruficornis (Meigen and the hornet wasp, Vespa orientalis (Linnaeus were existed in the fresh and bloat stages. Moreover, cheese fly, Piophila casei (Linnaeus was found bloat and active decay stages. Further, the hide beetle, Dermestes maculates (Geer, clown beetle, Hister sp. (Gullenhal; ham beetle, Necrobia rufipes (Fabricus and skin beetle, Trox sp. (Harold completed their life cycle in active decay, advance decay and dry stages. Furthermore, the jummper ant, Myrmecia pilosula (Smith was collected from only fresh stage. The specimens of insect species were collected minimum 0.8% of V. orientalis and maximum 21.3% of 2 species, i.e., C. rufifacies and M. domestica. The temperature, humidity and rainfalls were found affected insect larvae, pupae and adults, and rate of decomposition of C. domesticus. The average temperature, humidity and rainfalls were 35.34±1.54, 38.8% and 3.8 mm, respectively, of 11 experimental days. This research will be helpful for forensic entomologist for a case study of death to investigate of crimes in tropical region of Pakistan.

  14. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;


    exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw...

  15. Estudio histoquímico e inmunohistoquímico de los músculos de la lengua, paladar y faringe en el perro (Canis familiaris L.)


    Sánchez Collado, Cayetano


    Un análisis de los tipos de fibras y de su distribución fue realizado en muestras de músculos de la lengua (mm. geniogloso, estilogloso, hiogloso y lingual propio), del paladar y fauces (mm. palatofaríngeo, palatino, elevador y tensor del velo palatino) y de la faringe (mm. terigofaríngeo, estilofaríngeo caudal, hiofaríngeo, tirofaríngeo y cricofaríngeo) en la especie canina. Asimismo, se procesaron muestras del músculo semitendinoso, que fue utilizado como músculo control. La tipificación fi...

  16. Purification and characterization of the major whey proteins from the milks of the bottlenose dolphin (Tursiops truncatus), the Florida manatee (Trichechus manatus latirostris), and the beagle (Canis familiaris). (United States)

    Pervaiz, S; Brew, K


    The major whey proteins of the milks of the dolphin, manatee, and beagle were purified by gel filtration and ion exchange chromatography and characterized and identified by molecular weight determination, amino acid analysis, N-terminal sequencing, and activity measurements. The major whey protein components from all three species were found to be monomeric beta-lactoglobulins. These proteins were all active in binding retinol. Dolphin milk contained two beta-lactoglobulins (designated 1 and 2) which showed a slight difference in molecular weight and considerably divergent N-terminal sequences, whereas the other milks only contained a single form of beta-lactoglobulin. alpha-Lactalbumins were purified from dolphin and dog milks and were active in promoting lactose synthesis by bovine galactosyltransferase. The dolphin protein had an N-terminal sequence more similar to ruminant alpha-lactalbumins than to those known from other species. Although alpha-lactalbumin activity has been detected in manatee milk at low levels, the corresponding protein was not isolated. In addition, dog milk was found to contain high levels of lysozyme (greater than 1.0 mg/ml), which were identified by activity and sequencing. The functional and evolutionary implications of these results are discussed. PMID:3707136

  17. Distribución de los ectoparásitos de Canis lupus familiaris L. (Carnivora: Canidae) de Panamá


    Bermúdez, Sergio; Miranda, Roberto


    Objetivo. Determinar la distribución de ectoparásitos de perros en Panamá. Materiales y métodos. Se examinaron 720 individuos en 57 comunidades. Resultados. Los resultados demostraron que el 84% de los perros presentaron al menos una especie de ectoparásito. Los perros de tierras bajas mostraron un mayor porcentaje de parasitismo y mayor biodiversidad de parásitos que los animales de tierras altas. Se encontraron siete especies de garrapatas, cuatro de pulgas, dos de piojo...

  18. A Review of Domestic Dogs' (Canis Familiaris) Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs


    Udell, Monique A.R; Wynne, C. D. L.


    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are more human-like than any other species, including nonhuman primates. Behavior analysts should add their expertise to the study of dog behavior, both to...

  19. Effects of long-term dietary exposure to organohalogen contaminants on vitamin and hormonestatus in the Greenland Sledge dog (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, Maja

    conducted on Greenland sledge dogs. This aimed at exploring how a diet rich in OHCs affects vitamin and hormone status in Arctic top predator mammals. The dogs were supplemented with fat containing high (exposed group: minke whale blubber) or low (control group: porcine fat) amounts of OHCs, polyunsaturated...

  20. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Riget, Frank F.; Jensen, Jens-Erik Beck;


    There is a great need for understanding the impact from dietary OHCs (organohalogen compounds) on bone mineral composition - and thereby osteoporosis - in especially arctic wildlife such as polar bears (Ursus maritimus) as well as humans. For that purpose, we measured BMD (bone mineral density) by...... polluted marine species. (C) 2008 Elsevier Ltd. All rights reserved....

  1. Leaf extracts of Melia azedarach Linnaeus (Sapindales: Meliaceae act as larvicide against Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae Extratos de folhas de Melia azedarach Linnaeus (Sapindales: Meliaceae atuam como larvicida de Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Josiane Somariva Prophiro


    Full Text Available The objective of this study was to compare the larvicidal effect of hydroethanolic extracts of fresh and dry leaves of Melia azedarach Linnaeus (Sapindales: Meliaceae on Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae. All the extracts evaluated induced mortality among the third and fourth instar larvae of Aedes aegypti after 24 and 48 hours of exposure to the products. Although previous studies had demonstrated the action of seeds and fruits of Melia azedarach against the larvae of different Aedes aegypti populations, the present report is the first to show the larvicidal effect of the fresh and dry leaves of this plant.O objetivo deste trabalho foi comparar o efeito larvicida de extratos hidro-etanólicos de folhas verdes e secas de Melia azedarach Linnaeus (Sapindales: Meliaceae em Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae. Todos os extratos avaliados induziram mortalidade em larvas de 3º e 4º estágios de Aedes aegypti, após 24 e 48 horas de exposição aos produtos. Embora estudos prévios tenham demonstrado a ação de sementes e frutos de Melia azedarach em larvas de diferentes populações de Aedes aegypti, o presente estudo é o primeiro a reportar o efeito larvicida de folhas verdes e secas desta planta.

  2. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog

    Directory of Open Access Journals (Sweden)

    Tsachev Ilia


    Full Text Available A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  3. Infections with Ehrlichia canis and Borrelia burgdorferi in a dog


    Tsachev Ilia; Simeonov R.; Petrov Vladimir


    A clinical case of Ehrlichia canis and Borrelia burgdorferi infections in a 5year-old male German Shepherd is described. Clinical, serological, necropsy and histopathological examinations supporting the diagnosis have been performed.

  4. A WISE Census of Young Stellar Objects in Canis Major


    Fischer, William J.; Deborah L. Padgett(NASA/GSFC, Code 665, Greenbelt, MC 20770, USA); Stapelfeldt, Karl L.; Sewilo, Marta


    With the Wide-Field Infrared Survey Explorer (WISE), we searched for young stellar objects (YSOs) in a 100 deg^2 region centered on the lightly studied Canis Major star forming region. Applying stringent magnitude cuts to exclude the majority of extragalactic contaminants, we find 144 Class I candidates and 335 Class II candidates. The sensitivity to Class II candidates is limited by their faintness at the distance to Canis Major (assumed as 1000 pc). More than half the candidates (53%) are f...

  5. Pathogenic Fungus Microsporum canis Activates the NLRP3 Inflammasome


    Mao, Liming; Zhang, Liping; Li, Hua; Chen, Wei; Wang, Hongbin; Wu, Shuxian; Guo, Caiqin; Lu, Ailing; Yang, Guiwen; An, Liguo; Abliz, Paride; Meng, Guangxun


    Microsporum canis is a pathogenic fungus with worldwide distribution that causes tinea capitis in animals and humans. M. canis also causes invasive infection in immunocompromised patients. To defy pathogenic fungal infection, the host innate immune system is the first line of defense. As an important arm of innate immunity, the inflammasomes are intracellular multiprotein complexes that control the activation of caspase-1, which cleaves proinflammatory cytokine pro-interleukin-1β (IL-1β) into...

  6. The Role of Anthropogenic Influence on Biological Signal Field (BSF Characteristics of the Wolf, Canis lupus lupus (Canidae, Carnivora

    Directory of Open Access Journals (Sweden)

    Shkvyria M. G.


    Full Text Available The main goal of the current research includes studying the biological signal field (BSF characteristics of the wolf (Canis lupus lupus Linnaeus, 1758 at different values of anthropogenic load on territories with conservation (Białowieża National park (Poland and hunting status of the species (Chornobyl Exclusion Zone (Ukraine. The research in Białowieża Primeval Forest was conducted in two stages: study of the BSF characteristics of the wolf and finding correlation between data acquired from Ukraine (the first stage, and over-time study of intensity of the biological signal field (the second stage. In result of the first stage, there was no significant dependence on the characteristics of the territory and the differences between the behavior of wolves in the Białowieża Primeval Forest (conservation status of the species and the Exclusion Zone (game status. During the second stage it was determined that provided variance of the intensity between territory groups was insufficient, the degree of significance to animals of area categories varied with the stages of the pack’s life. It was found that the main factors which govern the character of wolf activity are not the level of the anthropic load and hunting pressure, but periods of the life cycle and spatial structure of groups.

  7. In vitro production of Toxocara canis excretory-secretory (TES) antigen. (United States)

    Thomas, Divyamol; Jeyathilakan, N; Abdul Basith, S; Senthilkumar, T M A


    Toxocara canis is a widespread gastrointestinal nematode parasite of dogs and cause Toxocara larva migrans, an important zoonotic disease in humans on ingestion of infective eggs. Toxocarosis is one of the few human parasitic diseases whose serodiagnosis uses a standardized antigen, T. canis excretory secretory antigen (TES). The present study describes collection of T. canis adult worm, collection and embryonation of T. canis eggs, hatching and separation of T. canis larvae, in vitro maintenance of T. canis second stage larvae for production of TES, concentration of culture fluid TES and yield of TES in correlation with various methods cited in literature. PMID:27605834

  8. Reviving the African wolf Canis lupus lupaster in North and West Africa: a mitochondrial lineage ranging more than 6,000 km wide.

    Directory of Open Access Journals (Sweden)

    Philippe Gaubert

    Full Text Available The recent discovery of a lineage of gray wolf in North-East Africa suggests the presence of a cryptic canid on the continent, the African wolf Canis lupus lupaster. We analyzed the mtDNA diversity (cytochrome b and control region of a series of African Canis including wolf-like animals from North and West Africa. Our objectives were to assess the actual range of C. l. lupaster, to further estimate the genetic characteristics and demographic history of its lineage, and to question its taxonomic delineation from the golden jackal C. aureus, with which it has been considered synonymous. We confirmed the existence of four distinct lineages within the gray wolf, including C. lupus/familiaris (Holarctic wolves and dogs, C. l. pallipes, C. l. chanco and C. l. lupaster. Taxonomic assignment procedures identified wolf-like individuals from Algeria, Mali and Senegal, as belonging to C. l. lupaster, expanding its known distribution c. 6,000 km to the west. We estimated that the African wolf lineage (i had the highest level of genetic diversity within C. lupus, (ii coalesced during the Late Pleistocene, contemporaneously with Holarctic wolves and dogs, and (iii had an effective population size of c. 80,000 females. Our results suggest that the African wolf is a relatively ancient gray wolf lineage with a fairly large, past effective population size, as also suggested by the Pleistocene fossil record. Unique field observations in Senegal allowed us to provide a morphological and behavioral diagnosis of the African wolf that clearly distinguished it from the sympatric golden jackal. However, the detection of C. l. lupaster mtDNA haplotypes in C. aureus from Senegal brings the delineation between the African wolf and the golden jackal into question. In terms of conservation, it appears urgent to further characterize the status of the African wolf with regard to the African golden jackal.

  9. Reviving the African wolf Canis lupus lupaster in North and West Africa: a mitochondrial lineage ranging more than 6,000 km wide. (United States)

    Gaubert, Philippe; Bloch, Cécile; Benyacoub, Slim; Abdelhamid, Adnan; Pagani, Paolo; Djagoun, Chabi Adéyèmi Marc Sylvestre; Couloux, Arnaud; Dufour, Sylvain


    The recent discovery of a lineage of gray wolf in North-East Africa suggests the presence of a cryptic canid on the continent, the African wolf Canis lupus lupaster. We analyzed the mtDNA diversity (cytochrome b and control region) of a series of African Canis including wolf-like animals from North and West Africa. Our objectives were to assess the actual range of C. l. lupaster, to further estimate the genetic characteristics and demographic history of its lineage, and to question its taxonomic delineation from the golden jackal C. aureus, with which it has been considered synonymous. We confirmed the existence of four distinct lineages within the gray wolf, including C. lupus/familiaris (Holarctic wolves and dogs), C. l. pallipes, C. l. chanco and C. l. lupaster. Taxonomic assignment procedures identified wolf-like individuals from Algeria, Mali and Senegal, as belonging to C. l. lupaster, expanding its known distribution c. 6,000 km to the west. We estimated that the African wolf lineage (i) had the highest level of genetic diversity within C. lupus, (ii) coalesced during the Late Pleistocene, contemporaneously with Holarctic wolves and dogs, and (iii) had an effective population size of c. 80,000 females. Our results suggest that the African wolf is a relatively ancient gray wolf lineage with a fairly large, past effective population size, as also suggested by the Pleistocene fossil record. Unique field observations in Senegal allowed us to provide a morphological and behavioral diagnosis of the African wolf that clearly distinguished it from the sympatric golden jackal. However, the detection of C. l. lupaster mtDNA haplotypes in C. aureus from Senegal brings the delineation between the African wolf and the golden jackal into question. In terms of conservation, it appears urgent to further characterize the status of the African wolf with regard to the African golden jackal. PMID:22900047

  10. Trophic cascades linking wolves (Canis lupus), coyotes (Canis latrans), and small mammals (United States)

    Miller, B.J.; Harlow, H.J.; Harlow, T.S.; Biggins, D.; Ripple, W.J.


    When large carnivores are extirpated from ecosystems that evolved with apex predators, these systems can change at the herbivore and plant trophic levels. Such changes across trophic levels are called cascading effects and they are very important to conservation. Studies on the effects of reintroduced wolves in Yellowstone National Park have examined the interaction pathway of wolves (Canis lupus L., 1758) to ungulates to plants. This study examines the interaction effects of wolves to coyotes to rodents (reversing mesopredator release in the absence of wolves). Coyotes (Canis latrans Say, 1823) generally avoided areas near a wolf den. However, when in the proximity of a den, they used woody habitats (pine or sage) compared with herbaceous habitats (grass or forb or sedge)- when they were away from the wolf den. Our data suggested a significant increase in rodent numbers, particularly voles (genus Microtus Schrank, 1798), during the 3-year study on plots that were within 3 km of the wolf den, but we did not detect a significant change in rodent numbers over time for more distant plots. Predation by coyotes may have depressed numbers of small mammals in areas away from the wolf den. These factors indicate a top-down effect by wolves on coyotes and subsequently on the rodents of the area. Restoration of wolves could be a powerful tool for regulating predation at lower trophic levels.

  11. Attempted eradication of Porphyrio porphyrio Linnaeus in the Florida Everglades


    Dave EGGEMAN; Marsha WARD; Ellen DONLAN; Scott HARDIN


    Porphyrio porphyrio (Fulica porphyrio Linnaeus) was reported to the South Florida Water Management District in a Water Conservation Area and in constructed wetlands in the Everglades in 2006. A rapid assessment, including casual observations and surveys of land managers, indicated a limited number of P. porphyrio (~300 birds) was present, and an eradication attempt was initiated. From 2006 – 2008, more than 3100 P. porphyrio were killed by shotgun from airboats during 73 hunts, suggesting the...

  12. Systematic B-metal substitution in CaNi5

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Bjerrum, Niels

    The aim of this work has been to study the effect of B metal substitutions in CaNi5 (AB(5)) which is known to suffer from poor cycling stability as a hydride electrode material. Systematic monosubstitutions of nickel with the most common other B metals (i.e. Al, Cr, Mn, Fe, Co, Cu, Zn and Sn) and...... Mg were performed. The overall composition was in all cases CaNi5-xMx (x=0.5 or 1) where M is the substituting element. The alloys were prepared by mechanical alloying. The hydrogen storage capacity was measured electrochemically ranging from 39 to 390 mAh/g, but none of the substitutions increased...... the cycling stability to any significant extend compared to pure CaNi5. X-ray diffraction patterns of the alloys revealed that only in a few cases the hexagonal CaCu5 structure of a true AB(5) alloy was preserved. In most cases diffraction patterns matching Ca2Ni7, CaNi3 or CaNi2 were seen. It can be...

  13. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani


    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  14. Sarcocystis canis associated hepatitis in a Steller sea lion (Eumetopias jubatus) from Alaska. (United States)

    Welsh, Trista; Burek-Huntington, Kathy; Savage, Kate; Rosenthal, Benjamin; Dubey, J P


    Sarcocystis canis infection was associated with hepatitis in a Steller sea lion (Eumetopias jubatus). Intrahepatocellular protozoal schizonts were among areas of necrosis and inflammation. The parasite was genetically identical to S. canis and is the first report in a Steller sea lion, indicating another intermediate host species for S. canis. PMID:24484486

  15. Brucella canis causing infection in an HIV-infected patient. (United States)

    Lucero, Nidia E; Maldonado, Patricia I; Kaufman, Sara; Escobar, Gabriela I; Boeri, Eduardo; Jacob, Néstor R


    From the blood culture of an HIV-positive patient with a febrile syndrome (CD4 count 385 cells/microL and viral load nondetectable), Brucella canis was isolated. The patient was presumptively infected from his dogs, which tested positive, and showed good outcome after the therapy with doxycycline-ciprofloxacin, and the HIV infection would seem not to have been influenced by brucellosis. To our knowledge, no other case of B. canis in the setting of HIV infection has been reported in the literature, and the emerging zoonotic potential of the disease in urban areas should be considered. PMID:19725766

  16. Occurrence of gastrointestinal parasites in dogs (Canis familiaris with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/ Ocorrência de parasitos gastrintestinais em cães (Canis familiaris com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Pedro Luiz de Camargo


    Full Text Available One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1 and from 50 dogs without diarrhea (Group 2 were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3% of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%, Ancylostoma sp. (7.3%, Cystoisospora (7.3%, Entamoeba sp. (6.7%, Toxocara sp.(4%, Pentatrichomanas hominis (3.3%, and Trichurisvulpis (1.3%. From the 50 animals without diarrhea, six (12% were positive by coproparasitologic evaluation: two (4% for Ancylostoma sp., three (6% with Giardia sp., and one (2% for both Ancylostoma sp. and Cystoisospora sp. There was a significant relationship between infection and diarrhea (P=0,005, age and infection (PForam examinadas 150 amostras de fezes colhidas de cães com diarréia aguda (Grupo 1, e outras 50 de animais sem diarréia (Grupo 2, atendidos entre outubro de 2004 e outubro 2005, no Hospital Veterinário Escola da Universidade Estadual de Londrina. Dos 150 animais do G1, 44 (29,3% estavam infectados por helmintos e/ou protozoários, sendo que destes, 32 (72,7% apresentavam infecção simples e 12 (27,3% infecções múltiplas. Os gêneros identificados nestes animais foram: Giardia sp. (9,3%, Cystoisospora sp. (7,3%, Ancylostoma sp. (7,3%, Entamoeba sp. (6,7%, Toxocara sp. (4%, Pentatrichomonas hominis (3,3% e Trichuris vulpis (1,3%. Dos 50 animais sem diarréia, seis (12% eram positivos, dois (4% para Ancylostoma sp., três (6% para Giardia sp. e um (2% para Ancylostoma sp. e Cystoisospora simultaneamente. Houve relação estatisticamente significativa (P=0,005 entre o parasitismo e a ocorrência de diarréia, assim como entre a faixa etária e a proporção de infecções (P<0,001, porém, machos e fêmeas foram igualmente acometidos (P=0,08. O número de cães com raça definida foi significativamente maior do que de cães sem definição racial (P=0,01. Os resultados demonstram a importância de realizaçãoperiódica de exames parasitológicos em cães com e sem diarréia para tratamento específico e adoção medidas de controle e profilaxia.

  17. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in Canis familiaris

    Directory of Open Access Journals (Sweden)

    Expedito Jr Matos Santana


    Full Text Available O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC e a altura (H de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR e do índice de pulsatilidade (IP do ramo principal da artéria renal. No estudo foram utilizados 22 cães adultos sem raça definida, sendo 11 machos e 11 fêmeas. Os animais foram previamente aferidos quanto a DAC e a H. Os exames ultra-sonográficos foram realizados com um aparelho HDI 4000 PHILIPS munido de um transdutor microconvexo multifreqüêncial (5-8 MHz, dispositivos Doppler Colorido e Doppler de Fluxo. Os animais foram posicionados em decúbito lateral direito ou esquerdo, de acordo com o rim a ser avaliado. Os diâmetros longitudinal (DL e dorsoventral (DDV dos rins foram mensurados na secção longitudinal e, o diâmetro transversal (DT foi aferido no plano transversal. O volume (V foi calculado automaticamente pelo software do ultra-som. Com o uso do Triplex Doppler, o IR e o IP das artérias renais direita e esquerda foram obtidos. Todos os dados foram apresentados em média ± EPM. Análises de regressão linear foram realizadas tendo o DL, DDV, DT e V como variáveis dependentes e a DAC e H como variáveis independentes. Os IR e IP dos rins direito e esquerdo foram comparados pelo teste t de Student. A DAC variou de 54-78cm para machos e 37-71cm para fêmeas e a altura variou entre 34-64 cm para os machos e 24-57cm para as fêmeas. As médias obtidas para DL, DDV, DT e V dos rins esquerdo e direito foram: 5,24±0,27cm, 3,07±0,15cm, 3,07±0,9cm, 28,01±3,4mL e 4,50±0,19cm, 2,88±0,14cm, 2,71±0,15cm, 21,27±2,6mL, respectivamente. As análises de regressão linear entre as medidas lineares e volume renal com a DAC e a H foram significativas para os interceptos e coeficientes de regressão (PThe aim of this paper was to establish the relation between the kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in adult healthy dogs, to obtain normality parameters for assessment of renal size and volume, as well as establish reference values to evaluate kidney blood perfusion by the resistivity index (RI and pulsatility index (PI of main renal artery. The study was applied at 22 adult dogs, 11 males and 11 females. Previously, the DAC and H of all animals were measured. For ultrasonographic examination, the ultra-sound system HDI 4000 PHILIPS equipped with a multi-frequency microconvex transducer, Color Doppler and Spectral Doppler devices was used. The animals were placed into right or left lateral decubitus position, in agreement with the kidney to be assessed. The longitudinal (LD and dorsoventral diameters (DVD of kidney were measured in longitudinal plane, and the transverse diameter (TD was determined in transversal section. The renal volume (V was automatically calculated by the ultrasound software. With Triplex Doppler, the RI and PI of right and left main renal arteries were obtained. All data were represented in mean ± SEM. Linear regression analyses were performed with renal LD, DVD, TD and V as dependent variable, and ACD and H as independent variable. RI and PI were compared between right and left renal arteries with Student's t-test. The LD, DVD, TD (cm and V (ml mean measurements for the left and right kidneys were: 5.24±0.27, 3.07±0.15, 3.07±0.9, 28.01±3.4 and 4.50±0.19, 2.88±0.14, 2.71±0.15, 21.27±2.6. All regression analyses were significant for the intercept and regression coefficient (P<0.01. There were statistical differences on RI and PI means between right and left renal arteries (P=0.001. The RI and PI means of left and right renal artery obtained were: 0.62±0.08 and 1.34±0.18; 0.70±0.06 and 1.62±0.13. The data obtained in the present paper can be used as parameters for evaluation of the renal size, volume and perfusion in adult dogs.

  18. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD) and height (H) in Canis familiaris


    Expedito Jr Matos Santana; Poliana S. Beserra; Adriel B. Brito; Stefânia A. Miranda; Elizabeth Nikolak; Sheyla F.S. Domingues


    O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC) e a altura (H) de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR) e do índice de pulsatilidade (IP) do ramo principal da artéria renal. No estudo foram utilizados 22 ...

  19. Occurrence of gastrointestinal parasites in dogs (Canis familiaris) with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/
    Ocorrência de parasitos gastrintestinais em cães (Canis familiaris) com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil


    Pedro Luiz Camargo; Odilon Vidotto; Milton Hissashi Yamamura; Fábio Augusto Galli dos Santos


    One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1) and from 50 dogs without diarrhea (Group 2) were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3%) of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%), Ancylostoma sp. (7.3%), Cystoi...

  20. Morfologia externa dos imaturos de Caligo teucer (Linnaeus (Lepidoptera, Nymphalidae External morphology of the immatures of Caligo teucer (Linnaeus (Lepidoptera, Nymphalidae

    Directory of Open Access Journals (Sweden)

    Neuda A. de Souza


    Full Text Available Este trabalho descreve os imaturos de Caligo teucer (Linnaeus, 1758. O material criado é proveniente do nordeste do Brasil. As larvas se alimentam de folhas de bananeira Musa spp. (Musaceae, Heliconia bihai (Heliconiaceae, Canna indica (Cannaceae e Alpinia purpurata (Zingiberaceae.This paper describes the immatures of Caligo teucer teucer (Linnaeus,1758, from material reared in northeast Brazil. The larva feed on leaves of Musa spp. (Musaceae, Heliconia bihai (Heliconiaceae, Canna indica (Cannaceae and Alpinia purpurata (Zingiberaceae.

  1. Morfologia externa dos imaturos de Caligo teucer (Linnaeus) (Lepidoptera, Nymphalidae) External morphology of the immatures of Caligo teucer (Linnaeus) (Lepidoptera, Nymphalidae)


    Neuda A. de Souza; Antônio F. S. L. Veiga; Casagrande, Mirna M; Manoel G. C. Gondim Jr


    Este trabalho descreve os imaturos de Caligo teucer (Linnaeus, 1758). O material criado é proveniente do nordeste do Brasil. As larvas se alimentam de folhas de bananeira Musa spp. (Musaceae), Heliconia bihai (Heliconiaceae), Canna indica (Cannaceae) e Alpinia purpurata (Zingiberaceae).This paper describes the immatures of Caligo teucer teucer (Linnaeus,1758), from material reared in northeast Brazil. The larva feed on leaves of Musa spp. (Musaceae), Heliconia bihai (Heliconiaceae), Canna ind...

  2. Fluctuating feather asymmetry in relation to corticosterone levels is sex-dependent in Eurasian treecreeper (Certhia familiaris) nestlings


    Helle, Samuli; Suorsa, Petri; Huhta, Esa; Hakkarainen, Harri


    Fluctuating asymmetry (FA) has been widely used as a stress-related phenotypic marker of developmental instability. However, previous studies relating FA to various stressful conditions have produced inconsistent results and we still lack quantitative individual-level evidence that high FA is related to stress in wild vertebrate species. We studied how baseline plasma levels of corticosterone predicted FA of wing and tail feathers in free-living Eurasian treecreeper (Certhia familiaris) nestl...

  3. Hepatozoon canis infection in Slovakia: imported or autochthonous? (United States)

    Majláthová, Viktória; Hurníková, Zuzana; Majláth, Igor; Petko, Branislav


    Tissue samples from nine red foxes (four samples of striated muscle tissue and five samples of heart tissue) that originated from the Michalovce district (Slovakia), an area with endemic occurrence of canine babesiosis were examined by PCR method using primers amplifying a fragment of the 18S rRNA spanning the V4 region of Babesia and Theileria. An unexpected determination of 450 bp DNA fragment of Hepatozoon canis was found in four samples. Partial sequences of the 18S rRNA gene from the H. canis showed 100% similarity with the sequence from Brasil isolate of H. canis from a pampas fox (Pseudalopex gymnocercus) (AY471615) as well as from a fox in Spain (AY150067) and from a dog in Brazil (AY864677). In the present study, we report the first PCR detection of Hepatozoon canis in a naturally infected red fox from Slovakia, a Rhipicephalus sanguineus-free region. We assume that the infection was spread by infected R. sanguineus that might have been brought to Slovakia by travelers, by golden jackals, or by foxes migrating because of expansion of golden jackals and environmental and climate changes. PMID:17627439

  4. Serodetection of Ehrlichia canis amongst dogs in central Namibia

    Directory of Open Access Journals (Sweden)

    Rutendo Manyarara


    Full Text Available Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories. The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6% compared with apparently healthy dogs (41.6% (P = 0.00. Location of habitation was significant (P < 0.017, with a high percentage of dogs exposed to E. canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.

  5. MRI findings of spinal visceral larva migrans of Toxocara canis

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  6. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)


    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  7. Ledra aurita (Linnaeus, 1758) (Hem., Cicadellidae) rediscovered in Norway



    The remarkable leafhopper Ledra aurita (Linnaeus, 1758) has been rediscovered in Norway. Three specimens were captured at light at Ø, Hvaler: Asmaløy (EIS 12) in July-Aug. 1995. An unpublished record from AK, Frogn: Drøbak (EIS 28) from August 1949 is also presented. In Norway the species has previously only been recorded from Ø, Hvaler: Kirkøen (EIS 20) in last century and again in 1915. Biology and distribution are briefly discussed. Due to the sparse and local distribution in Norway, the s...

  8. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  9. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  10. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  12. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  13. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  15. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  17. Phylogenetic characterization of Babesia canis vogeli in dogs in the state of Goiás, Brazil Caracterização filogenética de Babesia canis vogeli em cães do estado de Goiás, Brasil


    Sabrina Castilho Duarte; Juliana Alves Parente; Maristela Pereira; Célia Maria de Almeida Soares; Guido Fontgalland Coelho Linhares


    The genus Babesia comprises protozoa that cause diseases known as babesiosis. Dogs are commonly affected by Babesia canis or Babesia gibsoni. Babesia canis is divided into the subspecies Babesia canis canis, Babesia canis vogeli and Babesia canis rossi. Among these, Babesia canis vogeli predominates in Brazil. The objective of this study was to conduct a phylogenetic analysis on Babesia isolates from dogs in Goiânia, Goiás. Blood samples were obtained from 890 dogs presenting clinical signs s...

  18. First record of Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae in Brazil

    Directory of Open Access Journals (Sweden)

    Ubirajara R. Martins


    Full Text Available Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae is recorded for the first time in Brazil (Bahia. It was originally described from Europe and is currently widely distributed in that continent and Asia.

  19. Evidence of Sperm Storage in Nursehound (Scyliorhinus stellaris, Linnaeus 1758): Juveniles Husbandry and Tagging Program


    Micarelli, Primo; Sperone, Emilio; Serena, Fabrizio; Compagno, Leonard J. V.


    Nursehound, Scyliorhinus stellaris (Linnaeus 1758), is a shark of the Scyliorhinidae family, close to the Scyliorhinus canicula (Linnaeus 1758), frequently hosted in public aquaria. Information on biology and ecology is deficiently available regarding this species of sharks. In the Mediterranean basin, they are occasional rare and vulnerable species (Serena, 2005). In 2003 a female specimen of Scyliorhinus stellaris, 90 cm long, fished in the Tyrrhenian Sea was transferred to Tuscany Argentar...

  20. Disodium cromoglycate prevents ileum hyperreactivity to histamine in Toxocara canis-infected guinea pigs. (United States)

    Sá-Nunes, A; Corrado, A P; Baruffi, M D; Faccioli, L H


    The aim of this study was to investigate whether Toxocara canis infection in guinea pigs provokes changes in ileum responsiveness to histamine. Ileum segments from control and T. canis-infected groups were placed at isometric conditions and submitted to various doses of histamine. No changes were observed between controls and T. canis-infected groups at days 3, 6 and 12 after infection. However, at days 18 and 24 after infection, there was a significant increase in ileum responsiveness to histamine in T. canis-infected group. Pre-incubation of ileum segments with 1mgml(-1) disodium cromoglycate (DSCG) prevented the increased responsiveness to histamine in T. canis-infected guinea pigs and did not affect ileum contractility in non-infected animals. These results indicate that T. canis-infected guinea pigs develop increased intestinal responsiveness to histamine and that DSCG prevents alterations in smooth-muscle contractility. PMID:12967589

  1. Microsporum canis scalp ringworm: its primary or secondary ectothrix character. (United States)

    Vismer, H F


    This study supports the view that, in cases of tinea capitis due to a Microsporum canis infection, ectothrix arthroconidium formation is extrapilary and arises from intrapilary hyphae. The hyphae of M. canis perforate and digest the hair cuticle to alter its appearance from a normally identifiable structure of imbricated cells with a distal free border, to a grossly altered and pathological layer. Conidium production mainly takes place outside the hair shaft and forms thick clusters between the cuticular tiles. Finally, a shaft of conidia is formed around the hair. The cuticular covering of such a conidium sheath belongs to the root sheath of the hair follicle, and not to the hair structure proper. PMID:8108682

  2. A new star-forming region in Canis Major (United States)

    Magakian, T. Yu.; Movsessian, T. A.; Bally, J.


    A new southern star-formation region, located at an estimated distance of ˜1.5 kpc in the Lynds 1664 dark cloud in Canis Major, is described. Lynds 1664 contains several compact star clusters, small stellar groups and young stars associated with reflection nebulae. Narrow-band H α and [S II] images obtained with the 4-m telescope at the Cerro Tololo Inter-American Observatory reveal more than 20 new Herbig-Haro objects associated with several protostellar outflows.

  3. Toxocara canis: Larvicidal activity of fatty acid amides. (United States)

    Mata-Santos, Taís; D'Oca, Caroline da Ros Montes; Mata-Santos, Hílton Antônio; Fenalti, Juliana; Pinto, Nitza; Coelho, Tatiane; Berne, Maria Elisabeth; da Silva, Pedro Eduardo Almeida; D'Oca, Marcelo Gonçalves Montes; Scaini, Carlos James


    Considering the therapeutic potential of fatty acid amides, the present study aimed to evaluate their in vitro activity against Toxocara canis larvae and their cytotoxicity for the first time. Linoleylpyrrolidilamide was the most potent, with a minimal larvicidal concentration (MLC) of 0.05 mg/mL and 27% cytotoxicity against murine peritoneal macrophages C57BL/6 mice, as assessed by the MTT assay. PMID:26783180

  4. Schistosoma spindale infection in a captive jackal (Canis aureus)


    Vimalraj, P. G.; Latchumikanthan, A.


    This report is based on the findings from a captive jackal (Canis aureus) housed in Amirthi Zoological Park, Javadu Hills, Vellore. The animal was reported to be dull, depressed and also had diarrhea. Fecal samples were collected in 10 % formalin and subjected to direct and sedimentation method of faecal examination and was examined for endoparasitic infection. Surprisingly, fecal examination revealed two spindle shaped eggs having terminal spine with a size of 250μ by 60μ. The eggs were iden...

  5. Acral lick dermatitis in a jackal (Canis aureus). (United States)

    Yeruham, I; Nyska, A


    Acral lick dermatitis was diagnosed in a 6-mo-old female jackal (Canis aureus) that was born and housed in a zoological garden in Hafez-Haim, Israel. Other dermatologic diseases were ruled out. Although the lesions were presumed to be psychogenic in origin, they resolved with topical therapy using an ointment containing benzocaine, neomycin sulfate, and hydrocortisone acetate. No recurrence has been observed. PMID:9732044

  6. Probable Pulmonary Blastomycosis in a Wild Coyote (Canis latrans)


    Luis E. Rodríguez-Tovar; Nevárez-Garza, Alicia M.; Ricardo Vladimir Barajas-Juárez; Juan J. Zarate-Ramos; Ledezma-Torres, Rogelio A.; Armando Trejo-Chávez


    A female coyote (Canis latrans) was fatally injured by a vehicle on a road in San Luis Potosi, Mexico. Because of deteriorating clinical signs, the animal was euthanized. Postmortem examination of the lungs showed numerous small multifocal white nodules (0.5–1 cm diameter) disseminated throughout. Histopathologic examination revealed multifocal coalescing granulomas with abundant macrophages, numerous neutrophils, fibroblasts, plasma cells, and lymphocytes. Abundant intracellular and extracel...

  7. A new star-forming region in Canis Major


    Magakian, T. Yu.; Movsessian, T. A.; Bally, J


    A new southern star-formation region, located at an estimated distance of ~1.5 kpc in the Lynds 1664 dark cloud in Canis Major, is described. Lynds 1664 contains several compact star clusters, small stellar groups, and young stars associated with reflection nebulae. Narrow-band H{\\alpha} and [SII] images obtained with 4-m CTIO telescope reveal more than 20 new Herbig-Haro objects associated with several protostellar outflows.

  8. Mycoplasma canis and urogenital disease in dogs in Norway

    DEFF Research Database (Denmark)

    L'Abee-Lund, T.M.; Heiene, R.; Friis, N.F.;


    mycoplasma was cultivated only from urinary sediment, and it was typically obtained in smaller numbers than would be considered indicative of a urinary tract infection. In contrast with most mycoplasmas, the M canis isolated from all the dogs grew on ordinary blood agar plates used for routine...... bacteriological cultivation. Specific mycoplasma media were not used and the presence of other Mycoplasma or Ureaplasma species cannot be excluded....

  9. Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs

    Directory of Open Access Journals (Sweden)

    Ciarmela, M. L.


    Full Text Available The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated and scored according to Lỳsek’s ovicidal effect classification. These procedures were repeated three times which each fungal species. Chrysosporium merdarium and F. oxysporum showed very high ovicidal activity, F. sulphureum high ovicidal activity, F. moniliforme intermediate ovicidal activity and T. harzianum did not affect the viability of T. canis eggs. Taking into account the effects on human and animal health and the environment, the species with better prospects for studying its potential use as biological control was F. sulphureum.

  10. Antibodies reactive with Ehrlichia canis, Ehrlichia phagocytophila genogroup antigens and the spotted fever group rickettsial antigens, in free-ranging jackals (Canis aureus syriacus) from Israel. (United States)

    Waner, T; Baneth, G; Strenger, C; Keysary, A; King, R; Harrus, S


    A seroepidemiological survey was conducted to investigate the prevalence of antibodies reactive with the Ehrlichia canis and Ehrlichia phagocytophila genogroup antigens, and the spotted fever group (SFG) rickettsiae antigens in jackals in Israel (Canis aureus syriacus), to assess the possible role of the jackal in the epidemiology of these diseases. Fifty-three serum samples from jackals were assayed by the indirect immunofluorescence antibody test. Antibodies to E. canis were detected in 35.8% serum samples while 26.4% of the samples tested were positive to Ehrlichia chaffeensis. Twenty-six percent of the jackals tested were seropositive to E. phagocytophila, of which 5.7% were seropositive to E. phagocytophila alone without any seroreactivity to either E. canis or E. chaffeensis. Fifty-five percent of the jackals were seropositive to the SFG-rickettsiae antigens. The results suggest a high exposure rate of jackals in Israel to E. canis. Positive reactivity to E. chaffeensis was considered to be due to antigenic cross-reactions with E. canis. The study demonstrated for the first time the presence of E. phagocytophila antibodies in free-range jackals. The high incidence of antibodies to the SFG-rickettsiae and their relatively high antibody titers was suggestive of either recent or persistent infection. The possibility that jackals may play a role in the transmission of E. canis, E. phagocytophila and the SFG-rickettsiae for human and canine infections is discussed. PMID:10321583

  11. Attempted eradication of Porphyrio porphyrio Linnaeus in the Florida Everglades

    Directory of Open Access Journals (Sweden)

    Dave EGGEMAN


    Full Text Available Porphyrio porphyrio (Fulica porphyrio Linnaeus was reported to the South Florida Water Management District in a Water Conservation Area and in constructed wetlands in the Everglades in 2006. A rapid assessment, including casual observations and surveys of land managers, indicated a limited number of P. porphyrio (~300 birds was present, and an eradication attempt was initiated. From 2006 – 2008, more than 3100 P. porphyrio were killed by shotgun from airboats during 73 hunts, suggesting the initial population assessment was severely underestimated. After removing nearly 1500 P. porphyrio in 2008, we concluded that eradication was not possible. Failure of this eradication attempt is attributed to P. porphyrio’s affinity with dense emergent vegetation, which greatly limited shooting effectiveness. Further, the failed eradication underscores the importance of a reporting network to improve early detection and the chance to eliminate naturalized or feral populations of non‐native species.

  12. Tick Acquisition of Ehrlichia canis from Dogs Treated with Doxycycline Hyclate▿


    Schaefer, John J.; Needham, Glen R.; Bremer, William G; Rikihisa, Yasuko; Ewing, S. A.; Stich, R W


    Doxycycline generally alleviates clinical monocytic ehrlichiosis, but its efficacy in the control of monocytotropic ehrlichial pathogens requires further investigation. In this study, Ehrlichia canis was detected in dogs treated with doxycycline for 14 days and in ticks fed on these dogs, suggesting that treated dogs can remain reservoirs for E. canis.

  13. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus... (United States)


    ... gray wolf (Canis lupus) (72 FR 6052). Three parties challenged this rule (Humane Society of the United...) from the western wolf (Canis lupus). In our May 5, 2011, proposed rule (76 FR 26806), we proposed to... that identified and delisted the WGL DPS of the gray wolf (Canis lupus) (72 FR 6052). Three...

  14. A golden jackal (Canis aureus) from Austria bearing Hepatozoon canis--import due to immigration into a non-endemic area? (United States)

    Duscher, Georg Gerhard; Kübber-Heiss, Anna; Richter, Barbara; Suchentrunk, Franz


    The protozoan Hepatozoon canis, which is transmitted via ingestion of infected ticks by canine hosts, is not endemic to mid-latitude regions in Europe. Its distribution is supposed to be linked to the occurrence of its primary tick vector Rhipicephalus sanguineus. A young male golden jackal (Canis aureus) found as road kill close to Vienna, Austria, was infected by this pathogen. Cloning and sequencing of the PCR product revealed 6 different haplotypes of H. canis. Based on the sequences, no clear relationship to the origin of infection could be traced. This is the first report of H. canis for Austria, and wild canines such as the currently found jackal may provide a source of natural spread of this parasite into non-endemic areas. This natural immigration of wild animals represents a way of pathogen introduction, which has to be considered in disease prevention in addition to human-made introduction due to animal import and export. PMID:23306030

  15. Behavioral changes in Rattus norvegicus experimentally infected by Toxocara canis larvae Alterações de comportamento em Rattus norvegicus experimentalmente infectados por larvas de Toxocara canis

    Directory of Open Access Journals (Sweden)

    Pedro P. Chieffi


    Full Text Available Toxocara canis is a common canine nematode parasite and one of its possible transmission mechanisms is the predation of infected rodents by canids. Fifty Rattus norvegicus were used to study behavioral alterations in rodents infected by T. canis larvae. The rats were divided into three groups: G1, 20 rats infected with 300 T. canis eggs; G2, 20 rats infected with 2,000 T. canis eggs; and G3, 10 non-infected rats. Thirty and 60 days post-infection, rats from all the groups were submitted to an open-field apparatus for five min and subsequently, to an elevated plus-maze apparatus, again for five min. The data obtained indicated improvement in mobility (total locomotion time and rearing frequency and exploratory behavior in infected rats, principally in G2, which provides some support for the hypothesis that behavioral alterations in rodents infected by Toxocara canis larvae enhance the transmission rate of this ascarid to dogs.Toxocara canis é um nematódeo parasita habitual do intestino delgado de cães. Um dos mecanismos conhecidos de transmissão para cães é representado pela predação de pequenos roedores que, como hospedeiros paratênicos albergam larvas de Toxocara canis em seus tecidos. Para avaliar a ocorrência de alterações de comportamento em roedores infectados por Toxocara canis 50 exemplares de Rattus norvegicus foram utilizados no experimento. Os animais foram divididos em três grupos: G1 - 20 ratos infectados com 300 ovos de Toxocara canis; G2 - 20 ratos infectados com 2.000 ovos de Toxocara canis e G3 - 10 ratos sem infecção. Trinta e 60 dias após a infecção avaliou-se a ocorrência de alterações comportamentais nos três grupos submetendo os animais, primeiramente, a uma arena de campo aberto durante cinco minutos e, a seguir, a labirinto em cruz elevado por mais cinco minutos. Os resultados obtidos indicaram aumento significativo da mobilidade (tempo total de movimentação e número de vezes em que os animais se

  16. Schistosoma spindale infection in a captive jackal (Canis aureus). (United States)

    Vimalraj, P G; Latchumikanthan, A


    This report is based on the findings from a captive jackal (Canis aureus) housed in Amirthi Zoological Park, Javadu Hills, Vellore. The animal was reported to be dull, depressed and also had diarrhea. Fecal samples were collected in 10 % formalin and subjected to direct and sedimentation method of faecal examination and was examined for endoparasitic infection. Surprisingly, fecal examination revealed two spindle shaped eggs having terminal spine with a size of 250μ by 60μ. The eggs were identified as belonging to Schistosoma spindale and as per the standard keys (Soulsby 1982). PMID:25698875

  17. Linnaeus' study of Swedish swidden cultivation: Pioneering ethnographic work on the 'economy of nature'. (United States)

    Dove, Michael R


    Carl Linnaeus' work on the 'economy of nature' was a major early development in what became the modern field of ecology. This analysis suggests that a key subject of this work that has been ignored or misunderstood for 250 years is the rural livelihoods, especially swidden (or slash-and-burn) agriculture, which Linnaeus studied during his expeditions through rural Sweden. Rereading his reports in the light of modern work on swiddens, political ecology, and the history of science affords a new appreciation of Linnaeus' insights into traditional systems of resource exploitation. The logic of nutrient cycling in swidden agriculture and its utilization of natural dynamics to serve human ends exemplify the principles of the 'economy of nature', and gave Linnaeus a philosophical basis for understanding and defending this system of agriculture as well as other rural resource use systems in Sweden. This analysis sheds new light on Linnaeus' ethnographic work, his view of folk environmental knowledge, and his often derided identification with Sweden's ethnic peoples. PMID:25155194

  18. Infracommunities of intestinal helminths of the Red Fox Vulpes vulpes (Linnaeus, 1758 from Italian Alps

    Directory of Open Access Journals (Sweden)

    Anna Rita Di Cerbo


    Full Text Available Vulpes vulpes (Linnaeus, 1758 is one of the most common carnivore in Italy and its spread includes almost the whole national territory. The species shows an high ecological plasticity and a variable diet composition connected in part to human sources. This high adaptability permits the red foxes to colonize different habitats like the suburbs of large cities as well as the small villages located in mountain areas. On the other hand, the tourism pressure seems to assume a great importance in the Alps, also in those areas where the foxes live. So, indirect interactions could take place between these animals and the humans. The role of V. vulpes in the zoonoses has not to be understated since this carnivore could transmit parasitic diseases that are able to cause serious pathologies in humans. This study aims just to investigate on intestinal communities of helmiths of V. vulpes in order to make progress in current knowledge on epidemiological situation in Italian Alps. During 1998-2003, we have examined 450 foxes from Trentino Alto Adige, Veneto, Lombardia and Valle d'Aosta. The specimens collected were found dead or have been hunted (according to national law n. 157/92 in localities situated between 170 and 2200 m a.s.l. The carcasses were carried to the provincial sections of Zooprofilattici Institutes, where the intestine was drawn by each sample and all the material was sent to the Faculty of Veterinary Medicine of Milan. Parasitological examination of the small intestines was performed by the analysis of the whole sediment and counting technique (SCT. Parasites were preserved in alcohol 70° before to be clarified or stained and identified by microscope (Zeiss Axioscop. Mean abundance, mean intensity and prevalence were calculated for each taxon of helminth. Dates of sampling were grouped within the four seasons. Statistic tests were performed with software package SPSS rel. 11.5 and spatial analysis with the

  19. Toxocara canis: una zoonosis frecuente a nivel mundial

    Directory of Open Access Journals (Sweden)

    Ana Carolina Rojas-Salamanca


    Full Text Available La toxocariasis, causada principalmente por Toxocara canis, es una de las zoonosis más comunes a nivel mundial; se presenta con mayor frecuencia en niños, asociada a condiciones desfavorables de higiene, hacinamiento, convivencia con perros parasitados, el nivel socioeconómico, la ubicación geográfica y los entornos en los cuales los animales depositan sus heces, lo que se convierte en un gran foco de contaminación para los humanos. El Toxocara canis ingresa al ser humano por contacto directo con heces de perro o por contaminación de alimentos. La carga parasitaria es de vital importancia, ya que está relacionada directamente con la gravedad de la enfermedad, con los diferentes síndromes que se producen y con la respuesta inmune desencadenada por el organismo, teniendo en cuenta el ciclo de vida que se lleva a cabo en el organismo humano. Para esta enfermedad no se puede realizar un diagnóstico por técnicas coproparasitológicas, por lo cual es necesario utilizar otros métodos, como el aumento de leucocitos con presencia de eosinofilia, la prueba de ELISA y, en algunos casos, por medio de biopsias.

  20. A WISE Census of Young Stellar Objects in Canis Major

    CERN Document Server

    Fischer, William J; Stapelfeldt, Karl L; Sewilo, Marta


    With the Wide-Field Infrared Survey Explorer (WISE), we searched for young stellar objects (YSOs) in a 100 deg^2 region centered on the lightly studied Canis Major star forming region. Applying stringent magnitude cuts to exclude the majority of extragalactic contaminants, we find 144 Class I candidates and 335 Class II candidates. The sensitivity to Class II candidates is limited by their faintness at the distance to Canis Major (assumed as 1000 pc). More than half the candidates (53%) are found in 16 groups of more than four members, including four groups with more than 25 members each. The ratio of Class II to Class I objects, N_II/N_I, varies from 0.4 to 8.3 in just the largest four groups. We compare our results to those obtainable with combined Two Micron All Sky Survey (2MASS) and post-cryogenic Spitzer Space Telescope data; the latter approach recovers missing Class II sources. Via a comparison to protostars characterized with the Herschel Space Observatory, we propose new WISE color criteria for flat...

  1. Demodicosis caused by Demodex canis and Demodex cornei in dogs. (United States)

    Sivajothi, S; Sudhakara Reddy, B; Rayulu, V C


    Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears examination large number of adult short-tail Demodex mites were found. D. cornei was identified by based on the morphological characters including short opisthosoma with blind and round terminal end. Mean length of total body, opisthosoma of both types of the mites were differed statistically significant (P  0.05). Dogs were treated with daily oral ivermectin @ 500 μg/kg/day, external application of amitraz along with supportive therapy. After completion of 45 days of therapy dogs were recovered completely without any side effects. PMID:26688632

  2. Visceral larva migrans: migratory pattern of Toxocara canis in pigs

    DEFF Research Database (Denmark)

    Helwigh, Birgitte; Lind, Peter; Nansen, Peter


    The migratory pattern of Toxocara canis was investigated following infection of pigs with 60 000 infective eggs. Groups of six pigs were slaughtered at 7, 14 and 28 days after infection (p.i.), and the number of larvae in selected organs and muscles was determined by digestion. A group of uninfec...... in the pig. However, the importance of the pig as a paratenic host is probably minor, because of the relatively early death of most of the larvae....... uninfected pigs was used as negative controls for blood parameters and weight gain. Toxocara canis migrated well in the pig, although the relative numbers of larvae recovered decreased significantly during the experiment. On day 7 p.i., high numbers of larvae were recovered from the lymph nodes around the...... recovered from the brain on days 14 and 21, with a maximum on day 14 p.i. No larvae were found in the eyes. Severe pathological changes were observed in the liver and lungs, especially on day 14 p.i.; also, development of granulomas was observed in the kidneys. Finally, a strong specific antibody response...

  3. Fluctuating feather asymmetry in relation to corticosterone levels is sex-dependent in Eurasian treecreeper (Certhia familiaris) nestlings (United States)

    Helle, Samuli; Suorsa, Petri; Huhta, Esa; Hakkarainen, Harri


    Fluctuating asymmetry (FA) has been widely used as a stress-related phenotypic marker of developmental instability. However, previous studies relating FA to various stressful conditions have produced inconsistent results and we still lack quantitative individual-level evidence that high FA is related to stress in wild vertebrate species. We studied how baseline plasma levels of corticosterone predicted FA of wing and tail feathers in free-living Eurasian treecreeper (Certhia familiaris) nestlings. We found a sex-specific association between corticosterone levels and FA: high corticosterone levels were related to an increased FA in male but not in female nestlings. These results suggest that in treecreepers, FA may correlate with individual stress hormone levels, male developmental trajectory being potentially more sensitive to stress than that of the female. PMID:20129951

  4. Inhibitory effect of interferon gamma on frequency of Ehrlichia canis-infected cells in vitro. (United States)

    Tajima, Tomoko; Wada, Makoto


    Ehrlichia canis is an obligate intracellular bacterium that infects the macrophage-monocyte cells of dogs, causing canine monocytic ehrlichiosis. Interferon-γ (IFN-γ), along with other cytokines, mediates the immune response to such intracellular bacterial invasions. To determine the role of IFN-γ in the immunity of dogs to E. canis infection, peripheral blood mononuclear cells (PBMC) and white blood cells (WBC) were collected from E. canis-infected dogs and added to a culture of E. canis in DH82 cells. The number of E. canis inclusion-positive cells was significantly reduced in cultures containing PBMC and WBC from E. canis-infected dogs compared to uninfected dogs. However, this resistance was inhibited by the addition of an anti-dog IFN-γ antibody. Resistance was also observed when PBMC were added to the Cell Culture Inserts, which prohibited contact of PBMC to DH82 cells, while allowed the diffusion of soluble cell products. The results of this study indicate that resistance was not dependent on cell to cell contact, but was associated with soluble cell products, such as IFN-γ. The addition of recombinant canine IFN-γ to the E. canis culture also reduced the number of infected cells. A commercial recombinant canine IFN-γ, which is sold in Japan, was also effective at reducing E. canis-infected cell number. These results indicate that IFN-γ has an inhibitory effect on the frequency of E. canis-infected cells in vitro and that contact between effector and target cells is not necessary for the resistance. PMID:24148826

  5. Stability of CaNi5Hx stored at temperatures between 20 and 150 degrees C

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Møller, T.S.; Bjerrum, Niels


    The stability of CaNi5Hx stored at different temperatures was studied as a function of time. In general AB(5) metal hydrides are known to be metastable with a tendency to disproportionate at elevated temperatures. In the present study samples of CaNi5 were stored in the hydrided state (as CaNi5......Hsimilar to4.7) at temperatures between 20 and 150degreesC. After different periods of time, up to 120 days, the hydrogen absorption capacity was measured electrochemically. Significant capacity decays were observed at temperatures of 40degreesC and higher. The capacity decay with storage time tended to...

  6. Aislamiento de Brucella canis en un humano conviviente con caninos infectados. Informe de un caso.

    Directory of Open Access Journals (Sweden)

    Martha Olivera


    Full Text Available Objective: To report a case of bacteremia in a woman living in close contact with dogs infected with Brucella canis. Methods: Previous written consent of the woman a blood sample was taken to perform rapid agglutination test, immunofluorescence, and hemoculture. Results: Brucella canis was isolated and the isolation was confirmed by the Instituto Nacional ANLIS «Carlos G. Malbran» from Argentina. The woman did not present any symptoms associated with brucellosis. Conclusion: There is a risk of contamination by B. canis for people keeping tight contact with infected dogs.

  7. Probable Pulmonary Blastomycosis in a Wild Coyote (Canis latrans

    Directory of Open Access Journals (Sweden)

    Luis E. Rodríguez-Tovar


    Full Text Available A female coyote (Canis latrans was fatally injured by a vehicle on a road in San Luis Potosi, Mexico. Because of deteriorating clinical signs, the animal was euthanized. Postmortem examination of the lungs showed numerous small multifocal white nodules (0.5–1 cm diameter disseminated throughout. Histopathologic examination revealed multifocal coalescing granulomas with abundant macrophages, numerous neutrophils, fibroblasts, plasma cells, and lymphocytes. Abundant intracellular and extracellular thick-walled, refractile, spherical yeasts (10–15 μm were observed within the granulomas. The yeasts were intensely PAS-positive, with granular protoplasm. Broad-based single budding yeasts were occasionally present. Based on the microscopic findings of the pulmonary lesions and the morphological features of the organism, a diagnosis of chronic pyogranulomatous pneumonia caused by Blastomyces dermatitidis was made. To our knowledge, the case described herein is the first report of pulmonary blastomycosis in a wild coyote.

  8. Urbanization, Grassland, and Diet Influence Coyote (Canis latrans) Parasitism Structure. (United States)

    Watts, Alexander G; Lukasik, Victoria M; Fortin, Marie-Josée; Alexander, Shelley M


    Land use change can alter the ecological mechanisms that influence infectious disease exposure in animal populations. However, few studies have empirically integrated the environmental, spatial, and dietary patterns of wildlife epidemiology. We investigate how urbanization, habitat type, and dietary behavior are associated with coyote (Canis latrans) parasitism structure along a gradient of rural to urban land cover using multivariate redundancy analyses. Coyote fecal samples were collected in eight urban and six rural sites in Calgary, Alberta, Canada. Parasite and diet components were identified using common flotation procedures and fecal dietary analysis, respectively. Redundancy analysis was used to identify the best land cover, connectivity, and dietary predictors. We tested for significance using multiple permutation tests and ANOVAs. Significant factors affecting enteric parasite prevalence included dietary and land cover factors (R (2) = 0.4130, P coyote hosts to enteric parasites and pioneers future investigation of disease ecology for natural populations in anthropogenic landscapes. PMID:26122205

  9. Prolonged intensive dominance behavior between gray wolves, Canis lupus (United States)

    Mech, L. David; Cluff, H. Dean


    Dominance is one of the most pervasive and important behaviors among wolves in a pack, yet its significance in free-ranging packs has been little studied. Insights into a behavior can often be gained by examining unusual examples of it. In the High Arctic near Eureka, Nunavut, Canada, we videotaped and described an unusually prolonged and intensive behavioral bout between an adult male Gray Wolf (Canis lupus) and a male member of his pack, thought to be a maturing son. With tail raised, the adult approached a male pack mate about 50 m from us and pinned and straddled this packmate repeatedly over 6.5 minutes, longer than we had ever seen in over 50 years of studying wolves. We interpreted this behavior as an extreme example of an adult wolf harassing a maturing offspring, perhaps in prelude to the offspring?s dispersal.

  10. Searching for RR Lyrae stars in the Canis Major Overdensity

    CERN Document Server

    Mateu, Cecilia; Zinn, Robert; Miller, Lissa; .,; 10.1017/S1743921307008459


    The Canis Major overdensity (CMa) was initially proposed to be the remnant of a tidally disrupting dSph galaxy. Since its nature is still subject of debate, the goal of the present work was to conduct a large-scale RR Lyrae survey in CMa, in order to see if there is an overdensity of these stars. The survey spans a total area of ~34 sq. deg. with observations in V and R filters, made with the 1.0m Jurgen Stock Schmidt telescope at the National Astronomical Observatory of Venezuela. Current results in a subregion, including spectroscopic observations, show that the small number of RR Lyrae stars found can be accounted for by the halo and thick disk components of our Galaxy.

  11. Pasteurella canis Isolation following Penetrating Eye Injury: A Case Report. (United States)

    Rashid, Noor-Khairul; Zam, Zarifah; Mdnoor, Siti-Suraya; Siti-Raihan, Ishak; Azhany, Yaakub


    A 3-year-old boy presented with history of trauma to the left eye after he accidentally injured his eye with a broom stick made up from coconut skewers. There was history of cats as their pets but not dogs. Ocular examination revealed left superonasal conjunctival laceration and scleral perforation with prolapsed vitreous. Fundus examination showed minimal vitreous haemorrhage and flat retina. Conjunctiva swab at the wound site was sent for gram staining, culture, and sensitivity. He underwent scleral suturing, vitreous tap, and intravitreal injection of Ceftazidime and Amikacin. Vitreous tap was sent for gram stained, culture and sensitivity. Postoperatively, he was started empirically on IV Ciprofloxacin 160 mg BD, Guttae Ciprofloxacin, and Guttae Ceftazidime. Conjunctiva swab grew Pasteurella canis which was sensitive to all Beta lactams, Ciprofloxacin, Chloramphenicol, and Aminoglycoside. Post-operative was uneventful, absent signs of endophthalmitis or orbital cellulitis. PMID:22606491

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...

  13. Functional genomics of the horn fly, Haematobia irritans (Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Quiroz-Romero Héctor


    Full Text Available Abstract Background The horn fly, Haematobia irritans (Linnaeus, 1758 (Diptera: Muscidae is one of the most important ectoparasites of pastured cattle. Horn flies infestations reduce cattle weight gain and milk production. Additionally, horn flies are mechanical vectors of different pathogens that cause disease in cattle. The aim of this study was to conduct a functional genomics study in female horn flies using Expressed Sequence Tags (EST analysis and RNA interference (RNAi. Results A cDNA library was made from whole abdominal tissues collected from partially fed adult female horn flies. High quality horn fly ESTs (2,160 were sequenced and assembled into 992 unigenes (178 contigs and 814 singlets representing molecular functions such as serine proteases, cell metabolism, mitochondrial function, transcription and translation, transport, chromatin structure, vitellogenesis, cytoskeleton, DNA replication, cell response to stress and infection, cell proliferation and cell-cell interactions, intracellular trafficking and secretion, and development. Functional analyses were conducted using RNAi for the first time in horn flies. Gene knockdown by RNAi resulted in higher horn fly mortality (protease inhibitor functional group, reduced oviposition (vitellogenin, ferritin and vATPase groups or both (immune response and 5'-NUC groups when compared to controls. Silencing of ubiquitination ESTs did not affect horn fly mortality and ovisposition while gene knockdown in the ferritin and vATPse functional groups reduced mortality when compared to controls. Conclusions These results advanced the molecular characterization of this important ectoparasite and suggested candidate protective antigens for the development of vaccines for the control of horn fly infestations.

  14. Toxocara Canis IgG Seropositivity in Patients with Chronic Urticaria

    Directory of Open Access Journals (Sweden)

    Mehmet Burak-Selek


    Full Text Available We aimed to investigate IgG antibody levels specific to Toxocara canis (T. canis, a parasite which subsists in dog’s intestine, on serum samples obtained from patients with chronic urticaria (CU to evaluate effective risk in CU etiopathogenesis.In this study, 73 patients diagnosed with CU and 109 healthy individuals as control group, were included. Various factors such as sex, age, education and income, daily hand washing habits, history of dog owning and soil eating were questioned in patient anamnesis. T. canis IgG antibodies were detected using an enzyme linked immunosorbent assay (ELISA kit prepared with T. canis larval excretory-secretory antigens. Positive results were confirmed with western blot (WB WB test.We found T. canis IgG positivity in 17.8% (n=13 of patients (n=73 with CU. But we did not observe any T. canis IgG positivity in healthy controls (n=109. Low molecular weight bands (24-35 kDa were observed in 11 samples in WB analyses while two of the samples were weakly positive. It is revealed that dog owning history increases T. canis seropositivity12.9 times while insufficient daily hand washing habit (less than six times a day increasesseropositivity 20.7 times. Our study showed that T. canis may trigger CU since we found17.8% seropositivity in 73 patients with CU and none in 109 healthy individuals.Moreover, various socio-demographic characteristics have been shown to affect T. canisseropositivity in patients with CU. 

  15. Expression of Ubiquitin Gene in Microsporum canis and Trichophyton mentagrophytes Cultured with Fluconazole


    KANO, Rui; Okabayashi, Ken; Nakamura, Yuka; Watanabe, Shinichi; Hasegawa, Atsuhiko


    The expression of the ubiquitin (Ub) gene in dermatophytes was examined for its relation to resistance against the antifungal drug fluconazole. The nucleotide sequences and the deduced amino acid sequences of the Ub gene in Microsporum canis were proven to be 99% similar to those of the Ub gene in Trichophyton mentagrophytes. Expression of mRNA of Ub in M. canis and T. mentagrophytes was enhanced when the fungi were cultured with fluconazole. The antifungal activity of fluconazole against the...

  16. Ancient Himalayan wolf ( Canis lupus chanco ) lineage in Upper Mustang of the Annapurna Conservation Area, Nepal


    Chetri, Madhu; Jhala, Yadvendradev V.; Jnawali, Shant R.; Subedi, Naresh; Dhakal, Maheshwar; Yumnam, Bibek


    Abstract The taxonomic status of the wolf ( Canis lupus ) in Nepal’s Trans-Himalaya is poorly understood. Recent genetic studies have revealed the existence of three lineages of wolves in the Indian sub-continent. Of these, the Himalayan wolf, Canis lupus chanco , has been reported to be the most ancient lineage historically distributed within the Nepal Himalaya. These wolves residing in the Trans-Himalayan region have been suggested to be smaller and very different from the European wolf. Du...

  17. Clinical, Hematologic, and Molecular Findings in Naturally Occurring Babesia canis vogeli in Egyptian Dogs


    Salem, N. Y.; H. S. Farag


    Background. Canine babesiosis is a clinically important hemoprotozoan parasite affecting dogs. The goal of this present study was to determine the clinical symptoms and to establish its hematological and microscopic detection and compare it with the PCR findings attained from dogs infected with Babesia canis vogeli. Methodology/Principal Findings. 13-PCR confirmed Babesia-infected dogs were examined; seminested PCR was used to discover the precise type of Babesia and Babesia canis vogeli was ...

  18. Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Maisa Leite de Queiroz


    Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.

  19. A Fluoroquinolone Induces a Novel Mitogen-Encoding Bacteriophage in Streptococcus canis


    Ingrey, Keely T.; Ren, Jun; Prescott, John F.


    This study investigated whether the recently recognized emergence of canine streptococcal toxic shock syndrome (STSS) and necrotizing fasciitis (NF) might be partly attributed to the use of fluoroquinolones to treat Streptococcus canis infections in dogs. Both mitomycin and the fluoroquinolone enrofloxacin caused bacteriophage-induced lysis of S. canis strain 34, an isolate from a case of canine STSS and NF. Fluoroquinolone-evoked, bacteriophage-induced lysis occurred over a range of concentr...

  20. A report of a Hepatozoon canis infection in a dog with transmissible venereal tumour


    Namakkal Rajamanickam Senthil; Subramanian Subapriya; Subbaiah Vairamuthu


    In the present study, a case of a Hepatozoan canis infection in a dog with a sexually transmissible venereal tumour is reported. Haematological examination revealed marked decrease in haemoglobin, PCV and RBC counts and the blood smear revealed rouleaux formation of RBC, hypochromasia, leptocytes and neutrophilia. Neutrophils were parasitized with both non-nucleated and stained nucleated forms of H. canis. Serum biochemistry results showed elevated levels of alkaline phosphatise, whereas bloo...

  1. Experimental infection and co-infection of dogs with Anaplasma platys and Ehrlichia canis: hematologic, serologic and molecular findings

    Directory of Open Access Journals (Sweden)

    Diniz PPVP


    Full Text Available Abstract Background Rhipicephalus sanguineus is a ubiquitous tick responsible for transmitting Ehrlichia canis and most likely Anaplasma platys to dogs, as either single or co-infections. The objective of this study was to assess the effects of either simultaneous or sequential experimental infections with E. canis and A. platys on hematological and serological parameters, duration of infection, and efficacy of doxycycline therapy in dogs infected with one or both organisms. Six dogs per group were either uninfected, A. platys infected, E. canis infected, A. platys and E. canis co-infected, A. platys infected and E. canis challenged or E. canis infected and A. platys challenged at day 112 post-infection (PI. Doxycycline treatment was initiated at 211 days PI, followed by dexamethasone immunosuppression beginning 410 days PI. Results Initially, transient decreases in hematocrit occurred in all groups infected with E. canis, but the mean hematocrit was significantly lower in the A. platys and E. canis co-infected group. All dogs except the controls developed marked thrombocytopenia after initial infection followed by gradually increased platelet counts by 112 days PI in groups with the single infections, while platelet counts remained significantly lower in the A. platys and E. canis co-infected group. Both sequential and simultaneous infections of A. platys and E. canis produced an enhanced humoral immune response to A. platys when compared to infection with A. platys alone. Likewise, co-infection with E. canis and A. platys resulted in a more persistent A. platys infection compared to dogs infected with A. platys only, but nearly all A. platys infected dogs became A. platys PCR negative prior to doxycycline treatment. E. canis infected dogs, whether single or co-infected, remained thrombocytopenic and E. canis PCR positive in blood for 420 days. When treated with doxycycline, all E. canis infected dogs became E. canis PCR negative and the

  2. Intestinal nematode infections in Turkish military dogs with special reference to Toxocara canis. (United States)

    Senlik, B; Cirak, V Y; Karabacak, A


    The prevalence and potential zoonotic risk factors of intestinal nematodes of military working dogs, which are used for different military purposes, were assessed. Faecal samples from 352 defined-breed Turkish military dogs were investigated and 107 (30.4%) dogs were found to be infected with one or two nematode species. The following nematodes, with their respective prevalences, were diagnosed in the faecal samples: Toxascaris leonina (21.8%), Toxocara canis (13.3%), Trichuris vulpis (2.9%) and Uncinaria stenocephala (1.2%). Toxocara canis infections were more frequently seen in puppies (0-6 months old). The prevalence of T. canis was significantly higher in male than in female dogs and also higher in dogs which were exercised daily than in those without exercise. The highest prevalence was found in Belgian malinois breed dogs. Toxocara canis infections were not influenced by the floor type of the kennels (i.e. concrete or soil floor). There was no difference in the occurrence of T. canis infection when the last anthelmintic treatment was carried out less or more than 3 months prior to sampling. It is suggested that T. canis infected military dogs would be a threat not only for dog trainers but also for military personnel, notably during national and international operations. PMID:16923275

  3. Structural stability, electronic, mechanical and thermodynamical properties of CaNi2P2 and CaNi2Sb2 compounds by band structure calculation (United States)

    Harish, R. Sugan; Jayalakshmi, D. S.; Viswanathan, E.; Sundareswari, M.


    The mechanical, electronic, thermodynamic properties and structural stability of tetragonal structured CaNi2P2 and CaNi2Sb2 intermetallic compounds has been studied using the FP-LAPW method based on density functional theory. The PBE-GGA exchange correlation has been applied. Using the computed elastic constants, various elastic moduli such as bulk, shear, Young’s modulus, Poisson’s ratio and anisotropy constant are calculated and discussed. Stability of the compounds is confirmed by using their elastic constants. Pugh’s ratio is calculated to analyze the mechanical nature of the compound.

  4. Experimentelle Untersuchungen zu kognitiven und sozialen Mechanismen der Kooperation an je einer Gruppe Europäischer Wölfe (Canis l. lupus L.) und Deutscher Schäferhunde (C. lupus familiaris) unter Gehegebedingungen – Eine Fallstudie


    Plagmann, Silke


    Kooperation spielt bei vielen Arten eine wichtige Rolle, doch über die Mechanismen ist noch vieles unbekannt. Diese Arbeit untersuchte kognitive und soziale Mechanismen des kooperativen Problemlöseverhaltens beim Wolf und beim Haushund im experimentellen Ansatz. Obwohl die Wölfe in der Testsituation nicht kooperierten, wiesen bestimmte Verhaltensmerkmale auf grundlegende Voraussetzungen zur Kooperation hin. Haushunde kooperieren bei der Futterbeschaffung, sie passen ihr Verhalten an das eines...

  5. Steroid hormones in blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen polutted minke whale (Balanenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Letcher, J.;


    contaminant exposure were concomitant with elevation in concentrations of steroid hormones in blood plasma of exposed sledge dogs. Based on these unexpected results, data suggest that more investigations should be focused on steroid endocrine disruption and potential health effects in Arctic top predators...

  6. Brucella canis: inquéritos sorológico e bacteriológico em população felina Brucella canis: serological and bacteriological surveys in the feline population

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson


    Full Text Available De 134 soros de felinos domésticos examinados pela prova de soroaglutinação lenta em tubos, 4 (3% foram positivos para Brucella canis, todos com título igual a 100. Não se obteve êxito na tentativa de isolamento de Brucella canis através de hemocultura desses animais.Of the 134 feline sera tested by tube agglutination test, 4 (3% were positive for Brucella canis antibodies, all with titer 100. It was not possible to isolate Brucella canis by blood culture in the case of these animals.

  7. Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

    Directory of Open Access Journals (Sweden)

    Decaprariis Donato


    Full Text Available Abstract Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling and also by PCR for H. canis (second sampling. In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season, the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively, with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8% out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to

  8. Phylogeography of the Golden Jackal (Canis aureus in India.

    Directory of Open Access Journals (Sweden)

    Bibek Yumnam

    Full Text Available The golden jackal (Canis aureus is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster mtDNA lineages. In the present study, we sequenced 440 basepairs (bp of control region (CR and 412 bp of cytochrome b (cyt b gene of mtDNA from 62 golden jackals sampled from India (n = 55, Israel (n = 2 and Bulgaria (n = 5, to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history

  9. Phylogeography of the Golden Jackal (Canis aureus) in India. (United States)

    Yumnam, Bibek; Negi, Tripti; Maldonado, Jesús E; Fleischer, Robert C; Jhala, Yadvendradev V


    The golden jackal (Canis aureus) is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt) DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster) mtDNA lineages. In the present study, we sequenced 440 basepairs (bp) of control region (CR) and 412 bp of cytochrome b (cyt b) gene of mtDNA from 62 golden jackals sampled from India (n = 55), Israel (n = 2) and Bulgaria (n = 5), to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian) golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history in India

  10. Phylogeography of the Golden Jackal (Canis aureus) in India (United States)

    Yumnam, Bibek; Negi, Tripti; Maldonado, Jesús E.; Fleischer, Robert C.; Jhala, Yadvendradev V.


    The golden jackal (Canis aureus) is one of the most common and widely distributed carnivores in India but phylogeographic studies on the species have been limited across its range. Recent studies have observed absence of mitochondrial (mt) DNA diversity in European populations while some North African populations of golden jackal were found to carry gray wolf (Canis lupus lupaster) mtDNA lineages. In the present study, we sequenced 440 basepairs (bp) of control region (CR) and 412 bp of cytochrome b (cyt b) gene of mtDNA from 62 golden jackals sampled from India (n = 55), Israel (n = 2) and Bulgaria (n = 5), to obtain a total of eighteen haplotypes, comprising sixteen from India and one each from Israel and Bulgaria. Except for three previously described haplotypes represented by one cyt b and one CR haplotype both from India, and one CR haplotype from Bulgaria, all haplotypes identified in this study are new. Genetic diversity was high in golden jackals compared to that reported for other canids in India. Unlike the paraphyletic status of African conspecifics with the gray wolf, the Indian (and other Eurasian) golden jackal clustered in a distinct but shallow monophyletic clade, displaying no evidence of admixture with sympatric and related gray wolf and domestic dog clades in the region. Phylogeographic analyses indicated no clear pattern of genetic structuring of the golden jackal haplotypes and the median joining network revealed a star-shaped polytomy indicative of recent expansion of the species from India. Indian haplotypes were observed to be interior and thus ancestral compared to haplotypes from Europe and Israel, which were peripheral and hence more derived. Molecular tests for demographic expansion confirmed a recent event of expansion of golden jackals in the Indian subcontinent, which can be traced back ~ 37,000 years ago during the late Pleistocene. Our results suggest that golden jackals have had a potentially longer evolutionary history in India

  11. The effect of the synthetic oviductal fluid medium (SOF supplemented with insulin-like growth factor-I (IGF-I on in vitro maturation of canine oocytes (Canis familiaris/ Influência do fator de crescimento semelhante à insulina I (IGF-I adicionado ao meio fluido sintético de tuba uterina (SOF sobre a maturação in vitro de oócitos caninos (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Kellen Oliveira


    Full Text Available The follicular growth and oocyte maturation knowledge are very important to the development and improvement ofnew biotechnologies such as in vitro fertilization and somatic cell nuclear transfer. In order to the necessity of clarifythe basic mechanisms related to canine oocyte maturation, this investigation focuses on the evaluation of the effectof insulin-like growth factor-i (IGF-I, added to synthetic oviductal fluid medium (SOF on the in vitro maturation ofdomestic dog oocytes. Thirty-seven bitches undergoing ovariohysterectomy for castration or due to pathologicalconditions of the uterus were selected as oocytes’ donors (n=875. The oocytes were allocated in the followinggroups: M0 (stained in the collection’s time, Control (72h in SOF and Experimental (72h in SOF plus 100 ng IGF-I.After 72 hours of maturation the oocytes’ nuclear status were assessed by Hoechst 33342 dye. The best results interms of oocyte harvest were observed in those juvenile donors, females in estrus, nuliparous and pure breeds. Nosignificant differences were observed between treatments control (SOF or experimental (IGF-I.O conhecimento da regulação do crescimento folicular e da maturação oocitária é de grande importância no desenvolvimento e aperfeiçoamento de novas biotecnologias como a fecundação in vitro e a transferência nuclear. Considerando-se a necessidade de elucidação dos mecanismos básicos envolvidos na maturação oocitária na espécie canina, a presente pesquisa foi desenvolvida com o objetivo de avaliar o efeito do fator de crescimento semelhante à insulina-I (IGF-I, adicionado ao meio fluido sintético de tuba uterina (SOF, sobre a maturação de oócitos caninos. Foram utilizadas 37 cadelas submetidas à ovariohisterectomia, eletivas e terapêuticas, como doadoras dos complexos cumulus oócitos grau 1 (n=875 que foram alocados em três grupos: M0 (coloração no momento da colheita, Controle (72 h no meio SOF e Experimental (72h no meio SOF + 100 ng de IGF-I. Após 72 horas de maturação dos oócitos o estádio de maturação nuclear foi avaliado, por meio de coloração com Hoechst 33342. Os maiores índices de recuperação das estruturas foram obtidos daquelas doadoras com raças definidas, fêmeas jovens, nulíparas e em estro. Não houve diferenças estatísticas entre os dados analisados quanto à maturação nuclear entre os grupos controle (SOF e experimental (IGF-I.

  12. Freqüencia da infecção por Giardia lamblia (Kunstler, 1882 em cães (Canis familiaris avaliada pelo Método de Faust e cols. (1939 e pela Coloração da Auramina, no município de Canoas, RS, Brasil Frequence of infection by Giardia lamblia (Kunstler, 1882 in dogs (Canis familiaris available trough the Faust and Collaborators Method (1939 and Auramine Staining in Canoas, RS, Brazil

    Directory of Open Access Journals (Sweden)

    Cristiane Beck


    Full Text Available Giardia lamblia é um protozoário que acomete mais comumente animais jovens e que convivem em grupos. Apesar da alta prevalência, nem todos os animais apresentam a forma clínica da doença. Mesmo assim, a giardíase tem importância epidemiológica por possuir um elevado potencial zoonótico. O presente estudo teve como objetivo determinar a freqüência de Giardia lamblia em cães no município de Canoas, RS, Brasil, através do Método de Faust e cols. (1939 e da Técnica de Coloração da Auramina. Os grupos experimentais foram divididos de acordo com a procedência e o sexo. Das 332 amostras analisadas pelo Método de Faust e cols, a freqüência obtida foi de 34,04%, podendo variar de 28,95 a 39,13%, dentro de um intervalo de confiança de 95%. Destas amostras positivas, 40,96% foram de canil e 27,11% de cães de rua. O Teste Exato de Fisher aplicado a esses dados revelou existir uma diferença significativa (p=0,0107 entre as variáveis resultado e procedência. A variável sexo, neste método, não apresentou diferença significativa em relação ao resultado (P=0,8162 totalizando 33,11% de machos e 34,08% de fêmeas infectadas com o parasita. Das 147 amostras realizadas pela Técnica de Coloração da Auramina, 23 foram positivas, totalizando 15,65%. A análise estatística pelo Teste McNemar revelou existir diferença significativa entre as duas técnicas (P=0,0004. O valor Kappa foi igual a 0,07, considerado como um grau de concordância fraco. Os resultados encontrados neste estudo nos permitem afirmar que o Método de Faust e cols. foi o mais adequado para o diagnóstico da infecção por Giardia lamblia, sendo este parasita altamente prevalente na região estudada.Giardia lamblia is a protozoan that commonly infects young animals which live in groups. Despite its high prevalence many animals don’t exhibit clinical signs. Giardiasis is epidemiologically important concerning the zoonotic potential of the disease. The objective of this study was to determine the frequence of Giardia lamblia in the canine population of Canoas, RS, Brazil, applying the Faust and Collaborators Method (1939 and the Auramine Staining Technique. The dogs were classified according to the origin and gender. Feces samples of 332 dogs were analyzed by the Faust and Collaborators Method. The frequency of the infection obtained was 34.04%, ranging from 28.95% to 39.13% (confident interval at a 95% level. For kennel bred animals 40,96% of the samples were positive and for stray dogs 27.11%. Applying Fisher’s Exact Test to these figures there was a significant difference (P=0.0107 when comparing the origin of the animals and the results of the tests. However when comparing genders there was no significant difference (P=0.8162, the former with 33.11% of positive males and 34.08% positive females. When submitted to the Auramine Staining Technique(147 samples, 15.67% (23 of the samples resulted positive. The statistical analysis using the McNemar Test exposed a significant difference between both techniques (P=0.0004. The Kappa value of 0.07 obtained was considered of low rate. The results allow one to affirm that the Faust and Collaborators Method was the most suitable diagnostic test for Giardia lamblia infection, considering the high prevalence of this parasite in the studied region.

  13. Freqüencia da infecção por Giardia lamblia (Kunstler, 1882) em cães (Canis familiaris) avaliada pelo Método de Faust e cols. (1939) e pela Coloração da Auramina, no município de Canoas, RS, Brasil Frequence of infection by Giardia lamblia (Kunstler, 1882) in dogs (Canis familiaris) available trough the Faust and Collaborators Method (1939) and Auramine Staining in Canoas, RS, Brazil


    Cristiane Beck; Flávio Antônio Pacheco de Araújo; Adriana Tarnowski Olicheski; Adriana Schneider Breyer


    Giardia lamblia é um protozoário que acomete mais comumente animais jovens e que convivem em grupos. Apesar da alta prevalência, nem todos os animais apresentam a forma clínica da doença. Mesmo assim, a giardíase tem importância epidemiológica por possuir um elevado potencial zoonótico. O presente estudo teve como objetivo determinar a freqüência de Giardia lamblia em cães no município de Canoas, RS, Brasil, através do Método de Faust e cols. (1939) e da Técnica de Coloração da Auramina. Os g...

  14. Digital gene expression analysis of Microsporum canis exposed to berberine chloride.

    Directory of Open Access Journals (Sweden)

    Chen-Wen Xiao

    Full Text Available Berberine, a natural isoquinoline alkaloid of many medicinal herbs, has an active function against a variety of microbial infections including Microsporum canis (M. canis. However, the underlying mechanisms are poorly understood. To study the effect of berberine chloride on M. canis infection, a Digital Gene Expression (DGE tag profiling was constructed and a transcriptome analysis of the M. canis cellular responses upon berberine treatment was performed. Illumina/Hisseq sequencing technique was used to generate the data of gene expression profile, and the following enrichment analysis of Gene Ontology (GO and Pathway function were conducted based on the data of transcriptome. The results of DGE showed that there were 8476945, 14256722, 7708575, 5669955, 6565513 and 9303468 tags respectively, which was obtained from M. canis incubated with berberine or control DMSO. 8,783 genes were totally mapped, and 1,890 genes have shown significant changes between the two groups. 1,030 genes were up-regulated and 860 genes were down-regulated (P<0.05 in berberine treated group compared to the control group. Besides, twenty-three GO terms were identified by Gene Ontology functional enrichment analysis, such as calcium-transporting ATPase activity, 2-oxoglutarate metabolic process, valine catabolic process, peroxisome and unfolded protein binding. Pathway significant enrichment analysis indicated 6 signaling pathways that are significant, including steroid biosynthesis, steroid hormone biosynthesis, Parkinson's disease, 2,4-Dichlorobenzoate degradation, and tropane, piperidine and Isoquinoline alkaloid biosynthesis. Among these, eleven selected genes were further verified by qRT-PCR. Our findings provide a comprehensive view on the gene expression profile of M. canis upon berberine treatment, and shed light on its complicated effects on M. canis.

  15. Analysis on Nutrient Compositions and Nutritional Quality of Lota lota( Linnaeus) Muscle

    Institute of Scientific and Technical Information of China (English)

    Xu; Gefeng; Wang; Yuyu; Bai; Qingli; Li; Xiaolong; Jia; Zhonghe


    In order to evaluate the nutritional quality of Lota lota(Linnaeus) muscle,the common nutrient components,amino acid composition and fatty acid composition in muscle of wild Lota lota(captured in Hailang reaches of Mudan River) were determined by routine methods. The results showed that the contents of moisture,crude protein,crude fat and ash were 81. 82%,15. 93%,0. 44% and 1. 06% in fresh muscle of Lota lota,respectively. Totally 17 amino acids,including seven kinds of essential amino acids(EAA),were detected in dry muscle of Lota lota(Linnaeus),accounting for 72. 43% of total dry muscle. The content of EAA was 29. 82%,accounting for 41. 17% of TAA,meeting the amino acid composition of high-quality protein standard required by Food and Agriculture Organization /Word Health Organization(FAO /WHO). There were four delicious amino acids(DAA) in dry muscle,accounting for 28. 34% of total dry weight.The percentage of DAA to TAA was 39. 13% in dry muscle. The contents of C20:5n- 3(EPA) and C22:6n- 3(DHA) in dry muscle were 8. 65% and 20. 32%respectively,which were significantly higher than that of the artificially cultured fish species,such as Oxyeleotris marmorata(EPA:2. 24%,DHA:4. 74%),Spinibarbus sinensis(EPA:0. 87%,DHA:3. 08%) and Glossogobius giuris(EPA: 3. 94%,DHA: 8. 10%). Based on the amino acids score(AAS) and chemical score(CS),the first limited amino acid in Lota lota(Linnaeus) was sulfur-containing amino acid(methionine + cysteine). The essential amino acids index(EAAI) of Lota lota(Linnaeus) was 62.58. It is concluded that Lota lota(Linnaeus) is abundant in amino acids and high-unsaturated fatty acids,and rational in composition of amino acids. Thus,Lota lota(Linnaeus) is a high quality freshwater fish with high nutritional value and health value,possessing good exploitation and utilization prospects.

  16. Cross-fostering in gray wolves (Canis lupus lupus). (United States)

    Scharis, Inger; Amundin, Mats


    Cross-fostering in canids, with captive-bred pups introduced into endangered wild populations, might aid conservation efforts by increasing genetic diversity and lowering the risk of inbreeding depression. The gray wolf (Canis lupus lupus) population in Scandinavia suffers from severe inbreeding due to a narrow genetic base and geographical isolation. This study aimed at evaluating the method to cross-foster wolf pups from zoo-born to zoo-born litters. The following was assessed: female initial acceptance of foster pups, growth rate in relation to age difference between foster pups and pups in recipient litters and survival over the first 33 weeks. The study included four litters added by two foster pups in each. The age differences between the foster pups and the recipient litters were 2-8 days. After augmentation, all four females accepted the foster pups, demonstrated by her moving the entire litter to a new den site. Growth rate was dependent on the age difference of the pups in the foster litters, with a considerably slower growth rate in the 8 days younger pups. However, these pups later appeared to be at no disadvantage. Foster pups had a higher survival rate than females' pups, however, the causes of death were probably not kin or non-kin related. The results indicate that cross-fostering works in gray wolves and that this might be a plausible way to increase genetic variation in the wild population. PMID:25773058

  17. Hypertrophic Osteodystrophy in Two Red Wolf (Canis rufus Pups

    Directory of Open Access Journals (Sweden)

    Jenessa L. Gjeltema


    Full Text Available A 6-month-old red wolf (Canis rufus pup presented for evaluation of progressive thoracic and pelvic limb lameness, joint swelling, and decreased body condition. Radiographic evaluation revealed medullary sclerosis centered at the metaphyses of multiple long bones, well-defined irregular periosteal proliferation, and ill-defined lucent zones paralleling the physes, consistent with hypertrophic osteodystrophy (HOD. Biopsies of affected bone revealed medullary fibrosis and new bone formation. The pup improved following treatment with nonsteroidal anti-inflammatories, opioids, and supportive care over the course of 4 weeks. Metaphyseal periosteal bone proliferation persisted until the animal was humanely euthanized several years later for poor quality of life associated with bilateral cranial cruciate ligament rupture. A second red wolf pup of 4.5 months of age presented for evaluation of lethargy, kyphotic posture, and swollen carpal and tarsal joints. Radiographs revealed bilateral medullary sclerosis and smooth periosteal reaction affecting multiple long bones, suggestive of HOD. Further diagnostics were not pursued in this case to confirm the diagnosis, and the clinical signs persisted for 4 weeks. In light of these two case reports, HOD should be recognized as a developmental orthopedic disease in growing red wolves.

  18. Large dust grains in the wind of VY Canis Majoris

    CERN Document Server

    Scicluna, P; Wesson, R; Blommaert, J A D L; Kasper, M; Voshchinnikov, N V; Wolf, S


    Massive stars live short lives, losing large amounts of mass through their stellar wind. Their mass is a key factor determining how and when they explode as supernovae, enriching the interstellar medium with heavy elements and dust. During the red supergiant phase, mass-loss rates increase prodigiously, but the driving mechanism has proven elusive. Here we present high-contrast optical polarimetric-imaging observations of the extreme red supergiant VY Canis Majoris and its clumpy, dusty, mass-loss envelope, using the new extreme-adaptive-optics instrument SPHERE at the VLT. These observations allow us to make the first direct and unambiguous detection of submicron dust grains in the ejecta; we derive an average grain radius $\\sim$ 0.5 $\\mu$m, 50 times larger than in the diffuse ISM, large enough to receive significant radiation pressure by photon scattering. We find evidence for varying grain sizes throughout the ejecta, highlighting the dynamical nature of the envelope. Grains with 0.5 $\\mu$m sizes are likel...

  19. Helminth parasites in the endangered Ethiopian wolf, Canis simensis. (United States)

    van Kesteren, F; Piggott, K J; Bengui, T; Kubri, S B; Mastin, A; Sillero-Zubiri, C; Paris, M; Millar, R P; Macdonald, D W; Shiferaw, F; Craig, P S


    Ethiopian wolves, Canis simensis, are an endangered carnivore endemic to the Ethiopian highlands. Although previous studies have focused on aspects of Ethiopian wolf biology, including diet, territoriality, reproduction and infectious diseases such as rabies, little is known of their helminth parasites. In the current study, faecal samples were collected from 94 wild Ethiopian wolves in the Bale Mountains of southern Ethiopia, between August 2008 and February 2010, and were screened for the presence of helminth eggs using a semi-quantitative volumetric dilution method with microscopy. We found that 66 of the 94 faecal samples (70.2%) contained eggs from at least one group of helminths, including Capillaria, Toxocara, Trichuris, ancylostomatids, Hymenolepis and taeniids. Eggs of Capillaria sp. were found most commonly, followed by Trichuris sp., ancylostomatid species and Toxocara species. Three samples contained Hymenolepis sp. eggs, which were likely artefacts from ingested prey species. Four samples contained taeniid eggs, one of which was copro-polymerase chain reaction (copro-PCR) and sequence positive for Echinococcus granulosus, suggesting a spillover from a domestic parasite cycle into this wildlife species. Associations between presence/absence of Capillaria, Toxocara and Trichuris eggs were found; and egg burdens of Toxocara and ancylostomatids were found to be associated with geographical location and sampling season. PMID:25007150

  20. Retrospective analysis of clinical and laboratory findings in hunting dogs with serologic reactions to tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Ricketsia conorii

    Directory of Open Access Journals (Sweden)

    Spasojević-Kosić Ljubica


    Full Text Available Seroprevalence of tick-borne infections in endemic areas could be high. In this study, we investigated the seroprevalence of tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Rickettsia conorii in hunting dogs, naturally infected with one or more pathogens. Serological test results of the investigated animals were compared to those from clinical examination, as well as from haematological and biochemical analyses. A total of 74.14% dogs were seropositive (R.conorii 44.83%, B. canis 32.76%, B. burgdorferi 25.86%, E. canis 13.79%, A. phagocytophilum 8.47%, with 25.86% of dogs seropositive to two pathogens, 15.52% seropositive to three pathogens, and 1.72% of dogs seropositive to four pathogens. Among all registered clinical signs, only pyrexia (p<0.05 and arrhythmia (p<0.05 were significant in seropositive dogs. There was no significant difference between seropositive and seronegative dogs regarding the majority of haematological and biochemical parameters. Statistically significant difference was registered for particular haematological (number of red blood cells and seroreactivity to B. burgdorferi and biochemical parameters (albumin concentration and seroreactivity to E. canis, and AST and seroreactivity to R. conorii but these values were not clinically significant. The high exposure to tick-borne pathogens suggests that ectoparasitic profilactic treatment is not adequate in examined population of hunting dogs. Clinical finding of pyrexia need to be further investigated and explained etiologically, which means that molecular diagnosis should be used in order to identify larger number of pathogens because of the possibility of coinfection. [Projekat Ministarstva nauke Republike Srbije, br. TR 31084

  1. A serological diagnostic survey for Brucella canis infection in Turkish patients with Brucellosis-like symptoms. (United States)

    Sayan, Murat; Erdenlig, Sevil; Stack, Judy; Kilic, Selcuk; Guducuoglu, Huseyin; Aksoy, Yavuz; Baklan, Ayhan; Etiler, Nilay


    The incidence of Brucella canis infection in humans is unknown in Turkey. In this study, we investigated the prevalence of B. canis infection in human sera obtained from six regions in Turkey and comparatively evaluated the results obtained by agglutination-based techniques using standardized antigens made from B. canis. The patients (n = 1,746) presented with clinical symptoms that were similar to those of brucellosis. All patients who tested negative in the Rose Bengal test for the smooth Brucella strains (abortus, melitensis, and suis) were screened for evidence of B. canis infection using the rapid slide agglutination test (RSAT), the microagglutination test (MAT), and the 2-mercaptoethanol RSAT test (2ME-RSAT). Of the samples tested, 157 (8.9%), 68 (3.8%), and 66 (3.7%) were positive for B. canis, as determined by RSAT, MAT, and 2ME-RSAT, respectively. The diagnostic sensitivity, specificity, positive predictive value, and negative predictive value of RSAT were 100%, 94.6%, 42%, and 100%, respectively, and of MAT were 100%, 99.9%, 97%, and 100%, respectively. We recommend the routine use of MAT and 2ME-RSAT to check the sera of all patients with symptoms of brucellosis who are negative for brucellosis using a smooth Brucella antigen. PMID:22116333

  2. Babesia canis vogeli infection in dogs and ticks in the semiarid region of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Andreina C. Araujo


    Full Text Available Abstract:This study aimed to report the prevalence of Babesia canis vogeli in dogs and ticks in the urban and rural areas of Petrolina, Pernambuco. Serum and peripheral blood samples of 404 dogs were tested by indirect immunofluorescence assay (IFA and by blood smears, respectively. The presence of tick infestation was evaluated, and some specimens were submitted to DNA amplification by polymerase chain reaction (PCR. The presence of antibodies anti-B. canis vogeli was determinate in 57.9% (234/404 of dogs. The direct detection of Babesia spp was obtained in 0.5% (2/404 dogs by visualization of intraerythrocytic forms. Infestation by Rhipicephalus sanguineus sensu lato was observed in 54.5% (220/404 of dogs in both urban and rural areas. DNA of Babesia canis vogeli were obtained by PCR in 6% individual (3/50 and 8.7% of pool of ticks (7/80. The risk factors for the presence of anti-B. canis vogeli antibodies, as determined through the application of logistic regression models (P<0.05, were the following: medium breed size variables (P<0.001; contact with areas of forest (P=0.021; and access on the street (P=0.046. This study describes, for the first time, the confirmation of infection of B. canis vogeli in dogs and ticks in the semiarid region of Pernambuco, Brazil.

  3. Genetic variability in Microsporum canis isolated from cats, dogs and humans in Brazil. (United States)

    da Costa, Fernanda V A; Farias, Marconi R; Bier, Daniele; de Andrade, Caroline P; de Castro, Luiza A; da Silva, Sérgio C; Ferreiro, Laerte


    Dermatophytosis caused by Microsporum canis is a heterogeneous disease with variable clinical manifestations. M. canis is a zoophilic dermatophyte and the most frequent fungi isolated from dogs, cats and children in Brazil. The aim of this study was to investigate the genetic variability of M. canis isolates from different animal species using two microsatellite markers, namely, McGT(13) and McGT(17), and to correlate the results with the clinical and epidemiological patient data in Brazil. The study included a global set of 102 M. canis strains, including 37 symptomatic cats, 35 asymptomatic cats, 19 human patients with tinea, 9 asymptomatic dogs and 2 symptomatic dogs. A total of 14 genotypes were identified, and 6 large populations were distinguished. There was no correlation between these multilocus genotypes and the clinical and epidemiological data, including the source, symptomatology, clinical picture, breed, age, sex, living conditions and geographic location. These results demonstrate that the use of microsatellite polymorphisms is a reliable method for the differentiation of M. canis strains. However, we were unable to demonstrate a shared clinical and epidemiological pattern among the same genotype samples. PMID:23551796

  4. Linnaeus' restless system: translation as textual engineering in eighteenth-century botany. (United States)

    Dietz, Bettina


    In this essay, translations of Linnaeus' Systema naturae into various European languages will be placed into the context of successively expanded editions of Linnaeus' writings. The ambition and intention of most translators was not only to make the Systema naturae accessible for practical botanical use by a wider readership, but also to supplement and correct it, and thus to shape it. By recruiting more users, translations made a significant contribution to keeping the Systema up to date and thus maintaining its practical value for decades. The need to incorporate countless additions and corrections into an existing text, to document their provenance, to identify inconsistencies, and to refer to relevant observations, descriptions, and illustrations in the botanical literature all helped to develop and refine techniques of textual montage. This form of textual engineering, becoming increasingly complex with each translation cycle, shaped the external appearance of new editions of the Systema, and reflected the modular architecture of a botanical system designed for expansion. PMID:27391666

  5. The mortality of Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae induced by powdered plants

    Directory of Open Access Journals (Sweden)

    Kłyś Małgorzata


    Full Text Available The aim of this study was to investigate whether powdered plants of different species namely: peppermint Mentha piperita (L. (Lamiaceae, wormwood Artemisia absinthium (L. (Asteraceae, common sage Salvia officinalis (L. (Lamiaceae, allspice Pimenta dioica (Linnaeus et Merrill (Myrtaceae and common garlic Allium sativum (L. (Amaryllidaceae, added to semolina using concentrations of 1.23, 3.61, and 5.88%, influence the mortality rate in the saw-toothed grain beetle Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae. Experiments were conducted in a laboratory at 28°C and relative humidity 60±5%. At the concentration of 1.23%, allspice seeds caused the highest mortality amongst the saw-toothed grain beetle. When concentrations of 3.61 and 5.88% were used, sage, peppermint and wormwood caused the highest statistically significant mortality of O. surinamensis

  6. An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico

    Directory of Open Access Journals (Sweden)

    Alejandro Salinas-Castro


    Full Text Available An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico. Larvae of Cydia pomonella (Linnaeus, 1758 were discovered on floral cones of Magnolia schiedeana (Schltdl, 1864 near the natural reserve of La Martinica, Veracruz, México. Magnolia represents an unusual host for this moth species, which is known throughout the world as the "codling moth", a serious pest of fruits of Rosaceae, especially apples. The larvae were identified using taxonomic keys, and identification was corroborated using molecular markers. Further sampling resulted in no additional larvae, hence, the observation was probably that of an ovipositional error by the female, and M. schiedeana is not at risk of attack by this important moth pest.

  7. Molecular identification and antigenic characterization of a merozoite surface antigen and a secreted antigen of Babesia canis (BcMSA1 and BcSA1)


    Zhou, Mo; Cao, Shinuo; Luo, Yuzi; Liu, Mingming; Wang, Guanbo; Moumouni, Paul Franck Adjou; Jirapattharasate, Charoonluk; IGUCHI, Aiko; Vudriko, Patrick; Terkawi, Mohamad Alaa; Löwenstein, Mario; Kern, Angela; Nishikawa, Yoshifumi; Suzuki, Hiroshi; Igarashi, Ikuo


    Background Babesia canis is an apicomplexan tick-transmitted hemoprotozoan responsible for causing canine babesiosis in Europe and west Asia. Despite its importance, there is no known rapid diagnostic kit detection of B. canis infection in dogs. The present study identified two novel antigens of B. canis and used the recombinant antigens to establish a rapid, specific and sensitive serodiagnostic technique for detection of B. canis infection. Methods A complementary DNA (cDNA) expression libr...

  8. Progress of Chemical Composition and Pharmacological Effects of Meretrix meretrix Linnaeus

    Institute of Scientific and Technical Information of China (English)

    Du; Zhengcai; Hou; Xiaotao; Huang; Qing; Deng; Jiagang; Fanshi; Fangcao


    Meretrix meretrix Linnaeus is a traditional marine drug. There are more than two thousand years of history using clamshell as a component of medicine.After a review of relevant literature at home and abroad for nearly 20 years,the author summarized chemical composition and pharmacological effects of M. meretrix,in order to provide a scientific basis for further development and utilization of M. meretrix.

  9. Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus) (Coleoptera, Curculionidae)


    Andréa Roveré Franz; Neiva Knaak; Lidia Mariana Fiuza


    Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus) (Coleoptera, Curculionidae). Stored grains are subject to losses in quality nutritional value and in sanitation from the time they are stored to the time they are consumed. Botanical insecticides may offer an alternative solution for pest control. The objective was to test the insecticidal properties of the essential oils of Cymbopogon citratus (leaf), Zingiber officinale (root) and Mentha sp. (leaf). The efficacy of ...

  10. First Occurrence Of The Tilapia Oreochromis Niloticus Niloticus (Linnaeus, 1758) In Lesina Lagoon (Eastern Italian Coast)




    Individuals of the tilapia species Oreochromis niloticus niloticus(Linnaeus, 1758) were caught in Lesina Lagoon during experimental sampling for the shrimp Penaeus kerathurus using fyke net traps from December 1999 to September 2000. The species O. niloticusis not native in Italian coastal waters, although attempts of tilapia culture in land-based aquaculture farms were occasionally carried out in the past. The number of individuals captured in the samples suggests a colonization of the area ...

  11. New records of Piscicola geometra (Linnaeus 1758 (Hirudinea, Piscicolidae in Ebro River Basin (N Spain.

    Directory of Open Access Journals (Sweden)

    Oscoz, J., Tomás, P., Durán, C.


    Full Text Available This note represents a contribution to the knowledge of the presence of the fish leech Piscicola geometra (Linnaeus 1758 (Hirudinea, Piscicolidae in the Ebro River Basin. This species was collected in two rivers in the Ebro River Basin. Although this species has been reported from the Iberian Peninsula, these records are scarce and, to the author’s best knowledge, this study presents the first record of Piscicola geometra in the Ebro River Basin.

  12. Grammoplites vittatus (Valenciennes), (Scorpaeniformes, Platycephalidae), removed from synonymy with Grammoplites scaber (Linnaeus). (United States)

    Knapp, Leslie W; Imamura, Hisashi


    Grammoplites vittatus (Valenciennes), often previously overlooked by authors or regarded as a junior synonym of G. scaber (Linnaeus), is shown here to be a valid species.  It has more gill rakers (7-8) then G. scaber and G. knappi (usually 6) and a narrower interorbital width than G. scaber.  A key to the species of Grammoplites Fowler is  given.  PMID:25112262

  13. Chromosome analysis in the Kruger National Park - the chromosomes of the saddle-backed jackal Canis Mesomelas

    Directory of Open Access Journals (Sweden)

    C. Wallace


    Full Text Available Among the present-day members of the Canidae family are included the dogs and foxes (Wurster and Benirschke 1968. The genus Canis is represented in Africa by four species of jackal (Bigaike 1972. This paper presents the chromosome Findings in a male saddle-backed jackal Canis mesomelas studied in the Kruger National Park, Republic of South Africa.

  14. Predação oportunista de Artibeus planirostris (Spix, 1823) e Carollia perspicillata (Linnaeus, 1758) (Chiroptera, Phyllostomidae) por marsupiais e anuro na APA do Rio Curiaú, Amapá, Brasil Opportunistic predation of Artibeus planirostris (Spix, 1823) and Carollia perspicillata (Linnaeus, 1758) (Chiroptera, Phyllostomidae) by marsupials and anuran in the APA do Rio Curiaú, Amapá State, Brazil


    Isai Jorge de Castro; Claudia Regina Silva; Arley José Silveira Da Costa; Ana Carolina Moreira Martins


    Durante estudos com morcegos em floresta de várzea na APA do Rio Curiaú, Amapá, Brasil, observamos três casos de predações oportunistas de morcegos frugívoros capturados em redes de neblina. Duas destas predações ocorreram por marsupiais e uma por anuro. Artibeus planirostris (Spix, 1823) (Chiroptera, Phyllostomidae) foi predado por Didelphis marsupialis Linnaeus, 1758 e Philander opossum (Linnaeus, 1758) (Didelphimorphia, Didelphidae). Carollia perspicillata (Linnaeus, 1758) (Chiroptera, Phy...

  15. Data on the parasitological status of golden jackal (Canis aureus L., 1758) in Hungary. (United States)

    Takács, András; Szabó, László; Juhász, Lajos; Takács, András Attila; Lanszki, József; Takács, Péter Tamás; Heltai, Miklós


    In Hungary, twenty Canis aureus individuals were submitted to parasitological examinations in 2010-2012. Two Coccidia: Cystoisospora canis (15%) and Toxoplasma-type oocysts (5%), one Trematoda: Alaria alata (10%), six Cestoda: Mesocestoides lineatus (20%), Echinococcus granulosus (10%), Dipylidium caninums (5%), Taenia hydatigena (15%), Taenia pisiformis (20%), Taenia crassiceps (40%), and nine Nematoda: Angiostrongylus vasorum (10%), Crenosoma vulpis (30%), Capillaria aerophila (5%), Toxocara canis (20%), Toxascaris leonina (15%), Trichuris vulpis (10%), Ancylostoma caninum (45%), Uncinaria stenocephala (40%), Capillaria plica (45%) have been identified. Angiostronglyus vasorum has been reported from carnivores in Europe, Africa, South America and North America. The helminth A. vasorum or French heartworm is a metastrongylid nematode, widely distributed in Western Europe, that infects the pulmonary arterial tree of dogs, various species of foxes, wolves, Eurasian badgers, coyotes and stoats. To our knowledge, this is the first report of natural A. vasorum infection in golden jackal. PMID:24334089

  16. Comparative Experimental Infection Study in Dogs with Ehrlichia canis, E. chaffeensis, Anaplasma platys and A. phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Arathy D S Nair

    Full Text Available Dogs acquire infections with the Anaplasmataceae family pathogens, E. canis, E. chaffeensis, E. ewingii, A. platys and A. phagocytophilum mostly during summer months when ticks are actively feeding on animals. These pathogens are also identified as causing diseases in people. Despite the long history of tick-borne diseases in dogs, much remains to be defined pertaining to the clinical and pathological outcomes of infections with these pathogens. In the current study, we performed experimental infections in dogs with E. canis, E. chaffeensis, A. platys and A. phagocytophilum. Animals were monitored for 42 days to evaluate infection-specific clinical, hematological and pathological differences. All four pathogens caused systemic persistent infections detectible throughout the 6 weeks of infection assessment. Fever was frequently detected in animals infected with E. canis, E. chaffeensis, and A. platys, but not in dogs infected with A. phagocytophilum. Hematological differences were evident in all four infected groups, although significant overlap existed between the groups. A marked reduction in packed cell volume that correlated with reduced erythrocytes and hemoglobin was observed only in E. canis infected animals. A decline in platelet numbers was common with E. canis, A. platys and A. phagocytophilum infections. Histopathological lesions in lung, liver and spleen were observed in all four groups of infected dogs; infection with E. canis had the highest pathological scores, followed by E. chaffeensis, then A. platys and A. phagocytophilum. All four pathogens induced IgG responses starting on day 7 post infection, which was predominantly comprised of IgG2 subclass antibodies. This is the first detailed investigation comparing the infection progression and host responses in dogs after inoculation with four pathogens belonging to the Anaplasmataceae family. The study revealed a significant overlap in clinical, hematological and pathological

  17. Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India. (United States)

    Singh, B B; Sharma, R; Gill, J P S


    Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts. PMID:26345057

  18. First molecular evidence of Hepatozoon canis infection in red foxes and golden jackals from Hungary


    Farkas, Róbert; Solymosi, Norbert; Takács, Nóra; Hornyák, Ákos; Hornok, Sándor; Nachum-Biala, Yaarit; Baneth, Gad


    Background Recently, Hepatozoon canis infection has been detected among shepherd, hunting and stray dogs in the southern part of Hungary, which is considered to be free of Rhipicephalus sanguineus sensu lato and close to the border with Croatia. The aim of this study was to acquire information on the possibility that red foxes and/or golden jackals could play a role in the appearance and spread of H. canis in Hungary. Methods A conventional PCR was used to amplify a 666 bp long fragment of th...


    Directory of Open Access Journals (Sweden)

    Paula de Lima Telmo


    Full Text Available Toxocariasis is a widespread zoonosis and is considered an important worldwide public health problem. The aim of this study was to investigate the frequency of trans-mammary Toxocara canis infection in newborn BALB/c mice nursed by females experimentally infected with 1,200 eggs after delivery. After 50 days of age, the presence of larvae in different organs of the offspring was investigated. Trans-mammary infection was confirmed in 73.9% of the mice that had been nursed by infected females. These data show a high trans-mammary transmission of T. canis and confirm the significance of this transmission route in paratenic hosts.

  20. Uji Efektivitas Beberapa Minyak Atsiri terhadap Pertumbuhan Microsporum canis secara in Vitro

    Directory of Open Access Journals (Sweden)

    Bunga Saridewi Nurmansyah


    Full Text Available AbstrakDermatofitosis merupakan masalah kesehatan masyarakat yang penting di daerah tropis. Minyak atsiri merupakan salah satu potensi alam Indonesia yang diketahui memiliki daya antifungi. Tujuan penelitian ini adalah mengetahui efektivitas beberapa minyak atsiri (serai wangi, kayu manis dan cengkeh sebagai antijamur dalam mengendalikan pertumbuhan Microsporum canis penyebab dermatofitosis secara in vitro. Penelitian dilakukan di Laboratorium Fitopatologi KP Balittro Laing Solok dari  Februari sampai April 2014. Studi eksperimental ini dilakukan dengan metode pengenceran disusun  dalam Desain Rancang Acak Lengkap dalam Faktorial. Faktor pertama adalah jenis minyak atsiri (daun serai wangi, daun kayu manis, daun cengkeh. Faktor kedua adalah tingkat konsentrasi minyak atsiri (100 ppm, 250 ppm, 500 ppm, 1000 ppm dan 2000 ppm. Hasil penelitian ini menunjukkan bahwa minyak atsiri daun serai wangi, daun kayu manis dan daun sarasah cengkeh efektif dalam menekan pertumbuhan M. canis secara in vitro. Ketiga minyak atsiri pada konsentrasi 500 ppm telah mampu menghambat pertumbuhan M. canis hingga 100%. Minyak atsiri daun sarasah cengkeh memiliki efek antifungi paling tinggi (89,17%, diikuti minyak atsiri daun serai wangi (80,98% dan kayu manis (77,07%.                Kata kunci: minyak atsiri, serai wangi, cengkeh, kayumanis, microsporum canis AbstractDermatophytosis is an important public health problem in tropical areas. Essential oil is one of natural potential from Indonesia has been predicted as antifungal. The objective of this study was to detect effectivity some essential oils such as citronella, cinnamon and clove as antifungal to control the growth of dermatophyte infections caused by Microsporum canis by in vitro . The study was done  in the Laboratory of Phytopathology KP Balitro of Laing Solok from February until April 2014. This is an experimental study with dilution method arranged in Complete Randomized Design in

  1. A report of a Hepatozoon canis infection in a dog with transmissible venereal tumour

    Directory of Open Access Journals (Sweden)

    Namakkal Rajamanickam Senthil


    Full Text Available In the present study, a case of a Hepatozoan canis infection in a dog with a sexually transmissible venereal tumour is reported. Haematological examination revealed marked decrease in haemoglobin, PCV and RBC counts and the blood smear revealed rouleaux formation of RBC, hypochromasia, leptocytes and neutrophilia. Neutrophils were parasitized with both non-nucleated and stained nucleated forms of H. canis. Serum biochemistry results showed elevated levels of alkaline phosphatise, whereas blood urea nitrogen, creatinine, total protein, albumin and globulin were in the normal range.

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0725 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0725 ref|NP_001005764.1| purinergic receptor P2Y, G-protein coupled, 1 [Canis lupus... familiaris] gb|AAU87363.1| purinergic receptor P2Y1 variant 1 [Canis lupus familiaris] gb|AAU8...7364.1| purinergic receptor P2Y1 variant 2 [Canis lupus familiaris] NP_001005764.1 3e-71 97% ...

  3. Efficacy of SAD (Berne) rabies vaccine given by the oral route in two species of jackal (Canis mesomelas and Canis adustus). (United States)

    Bingham, J; Kappeler, A; Hill, F W; King, A A; Perry, B D; Foggin, C M


    Eight black-backed jackals (Canis mesomelas) and seven side-striped jackals (Canis adustus) were given SAD (Berne) rabies vaccine by direct oral instillation. Three different vaccine doses were used: 10(6.3), 10(6.8) and 10(7.5) median tissue culture infectious doses. Two additional jackals were given vaccine in chicken heads. One group of jackals was challenged with a lethal dose of jackal-derived rabies virus 1 mo after vaccination and a second group 12 mo after vaccination. All 17 vaccinated jackals developed high and persistent serum neutralizing antibody titers. All challenged jackals resisted a lethal dose of rabies virus, whereas three control jackals given the same challenge succumbed to rabies. PMID:8592368

  4. Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs

    Directory of Open Access Journals (Sweden)

    Maurício Franco Zanette


    Full Text Available Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA, indirect immunofluorescent antibody test (IFAT and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tested, 24 (42.1% tested positive using one of the three serological methods: 10/57 (17.5% for ELISA, 11/57 (19.3% for IFAT and 3/57 (5.3% for Kalazar Detect™. Conclusions: Our results demonstrated that the presence of other infectious agents may lead to cross-reactivity on leishmaniasis serological tests.

  5. First record of a golden jackal (Canis aureus) in the Savinja Valley (Northern Slovenia): Prvi podatek o pojavljanju šakala (Canis aureus) v Savinjski dolini (S Slovenija):


    Krofel, Miha; Potočnik, Hubert


    The article presents the record of an adult female golden jackal (Canis aureus) accidentally shot in 2005 near Gornji Grad in the Upper Savinja Valley, Northern Slovenia (UTM VM82, 980 m a.). Although this individual was most likely a vagrant, it indicates that golden jackals may soon, or perhaps already have, established permanent territories in Slovenia. Further studies are necessary to determine the status and distribution of this protected species in Slovenia, as well as public awareness ...

  6. Isolasi dan Identifikasi Microsporum canis dari Anjing Penderita Dermatofitosis di Yogyakarta (ISOLATION AND IDENTIFICATION OF Microsporum Canis FROM DERMATOPHYTOSIS DOGS IN YOGYAKARTA)


    Soedarmanto Indarjulianto; Yanuartono .; Hary Purnamaningsih; Puspa Wikansari; Gerson Yohanes Imanuel Sakan


    Dermatophytosis in dogs can be caused by one species of dermatophytes group called Microsporumcanis. This study aims to isolation and identification of M. canis in dogs suspected dermatophytosis inYogyakarta. Skin scrapings from 50 dogs that clinically showed lesions such as combination of alopecia,erythema, papules, pustules, scaly and crusty used in this study. Samples of skin scraping were culturedin the Sabouraud’s dextrose agar media for fungi identification macroscopically and microscop...

  7. First identification of Trichinella sp. in golden jackal (Canis aureus) in Romania. (United States)

    Blaga, R; Gherman, C; Seucom, D; Cozma, V; Boireau, P


    Larvae of Trichinella sp. were identified in a golden jackal (Canis aureus) from Romania by both trichinelloscopy and artificial digestion. The larvae were identified as Trichinella britovi using a multiplex polymerase chain reaction biotyping method. This is the first report of Trichinella sp. in a jackal in Romania. PMID:18436679

  8. Antibodies reactive with Bartonella henselae and Ehrlichia canis in dogs from the communal lands of Zimbabwe

    Directory of Open Access Journals (Sweden)

    P.J. Kelly


    Full Text Available The prevalences of antibodies against Bartonella henselae and Ehrlichia canis were determined in sera from 228 dogs in 5 communal lands of Zimbabwe, areas where traditional subsistence agro-pastoralism is practised. The sera were collected from apparently healthy dogs during routine rabies vaccination programmes and tested with indirect fluorescent antibody assays using B. henselae (Houston-I and E. canis (Oklahoma as antigens. We found reactive antibodies (>1:80 against B. henselae in 14 % of the dogs tested. Seropositive animals were found in Bikita (41 %; 17/42, Omay (13 %; 6/48, Chinamora (5 %; 2/38 and Matusadona (15 %; 7/48. No seropositive dogs were found in Chiredzi (0 %; 0/52. Antibodies reactive with E. canis (>1:80 were found in 34%of the dogs tested, from Bikita (88 %; 37/42, Chiredzi (31 %; 16/52, Omay (17 %; 8/48, Chinamora (26 %; 10/38 and Matusadona (15 %; 7/48. Our survey shows dogs in the communal lands of Zimbabwe are frequently exposed to E. canis and B. henselae or closely related species. Further studies are indicated to determine the pathogenicity of the organisms infecting these dogs and their clinical significance.

  9. Successful treatment of mitral valve endocarditis in a dog associated with 'Actinomyces canis-like' infection. (United States)

    Balakrishnan, N; Alexander, K; Keene, B; Kolluru, S; Fauls, M L; Rawdon, I; Breitschwerdt, E B


    Infective endocarditis, an inflammation of the endocardial surface due to invasion by an infectious agent, is more common in middle sized to large breed dogs. We herein report a case of mitral valve endocarditis in a 9-year-old male-castrated Weimaraner caused by an Actinomyces canis-like bacterium, not previously reported in association with infection in dogs. PMID:27364088

  10. BEHAVIORAL AND MEMORY CHANGES IN Mus musculus COINFECTED BY Toxocara canis AND Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Flávia Motta Corrêa


    Full Text Available Several researchers have stated that parasites can alter the behavior of their hosts, in order to increase the transmission rate, principally when prey-predator relationships are a reliable way of infection transmission. The aim of this study was to verify the occurrence of changes in anxiety and short-term memory patterns in experimentally infected Mus musculus by Toxocara canis and/or Toxoplasma gondii. Forty male Mus musculus (Balb/c eight-week-old were divided into four groups of 10 mice each. One group was infected with 300 eggs of Toxocara canis; a second group was submitted to infection with 10 cysts of Toxoplasma gondii; a third group was concomitantly infected with both parasites with the same inoculums and the last group was maintained without infection. The anxiety levels were evaluated using an elevated plus maze and an actometer; the short-term memory was determined by a two-way active avoidance equipment. The determination of anxiety levels were conducted 40 and 70 days after infection and the short-term memory was evaluated 140 days after infection. Mice chronically infected by Toxoplasma gondii showed impaired learning and short-term memory, but no significant differences were found in mice infected by Toxocara canis or concomitantly infected by Toxocara canis and Toxoplasma gondii when compared to non infected mice.

  11. Gray wolf (Canis lupus) is a natural definitive host for Neospora caninum (United States)

    The gray wolf (Canis lupus) was found to be a new natural definitive host for Neospora caninum. This finding is based on the recovery of Neospora-like oocysts from the feces of 3 of 73 wolves from Minnesota examined at necropsy, and on successful amplification of N. caninum-specific sequences from ...

  12. Seroprevalence of Borrelia burgdorferi, Anaplasma phagocytophilum, Ehrlichia canis, and Dirofilaria immitis among dogs in Canada


    Villeneuve, Alain; Goring, Jonas; Marcotte, Lynne; Overvelde, Sébastien


    The seropositivity of dogs to Borrelia burgdorferi, Anaplasma phagocytophilum, and Ehrlichia canis antibodies, and Dirofilaria immitis antigen was assessed in Canada. Borrelia burgdorferi had the highest seroprevalence, while that of Dirofilaria immitis has not changed significantly in the past 20 y. The risk for these vector-borne infectious agents in Canadian dogs is low but widespread with foci of higher prevalence.

  13. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  14. A virulent genotype of Microsporum canis is responsible for the majority of human infections. (United States)

    Sharma, Rahul; de Hoog, S; Presber, Wolfgang; Gräser, Yvonne


    The zoophilic dermatophyte species Microsporum canis belongs to the Arthroderma otae complex and is known to mate with tester strains of that teleomorph species, at least in the laboratory. Human infections are likely to be acquired from the fur of cats, dogs and horses. Epidemiological studies to reveal sources and routes of infection have been hampered by a lack of polymorphic molecular markers. Human cases mainly concern moderately inflammatory tinea corporis and tinea capitis, but, as cases of highly inflammatory ringworm are also observed, the question arises as to whether all lineages of M. canis are equally virulent to humans. In this study, two microsatellite markers were developed and used to analyse a global set of 101 M. canis strains to reveal patterns of genetic variation and dispersal. Using a Bayesian and a distance approach for structuring the M. canis samples, three populations could be distinguished, with evidence of recombination in one of them (III). This population contained 44 % of the animal isolates and only 9 % of the human strains. Population I, with strictly clonal reproduction (comprising a single multilocus genotype), contained 74 % of the global collection of strains from humans, but only 23 % of the animal strains. From these findings, it was concluded that population differentiation in M. canis is not allopatric, but rather is due to the emergence of a (virulent) genotype that has a high potential to infect the human host. Adaptation of genotypes resulting in a particular clinical manifestation was not evident. Furthermore, isolates from horses did not show a monophyletic clustering. PMID:17893177

  15. Serological survey of Brucella canis in dogs in urban Harare and selected rural communities in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Simbarashe Chinyoka


    Full Text Available A cross-sectional study was conducted in order to detect antibodies for Brucella canis (B. canis in dogs from urban Harare and five selected rural communities in Zimbabwe. Sera from randomly selected dogs were tested for antibodies to B. canis using an enzyme-linked immunosorbent assay. Overall, 17.6% of sera samples tested (57/324, 95% CI: 13.5–21.7 were positive for B. canis antibodies. For rural dogs, seroprevalence varied from 11.7% – 37.9%. Rural dogs recorded a higher seroprevalence (20.7%, 95% CI: 15.0–26.4 compared with Harare urban dogs (12.7%, 95% CI: 6.9–18.5 but the difference was not significant (p = 0.07. Female dogs from both sectors had a higher seroprevalence compared with males, but the differences were not significant (p > 0.05. Five and two of the positive rural dogs had titres of 1:800 and 1:1600, respectively, whilst none of the positive urban dogs had a titre above 1:400. This study showed that brucellosis was present and could be considered a risk to dogs from the studied areas. Further studies are recommended in order to give insight into the epidemiology of brucellosis in dogs and its possible zoonotic consequences in Zimbabwe. Screening for other Brucella spp. (Brucella abortus, Brucella melitensis and Brucella suis other than B. canis is also recommended.

  16. In vitro and in vivo effects of Enterococcus faecalis CECT7121 on Toxocara canis

    Directory of Open Access Journals (Sweden)

    Paula G Chiodo


    Full Text Available The aim of the present paper was to evaluate the larvicidal effect of Enterococcus faecalis CECT7121 (Ef7121 on the Toxocara canis cycle both in vitro and in vivo. For the in vitro experiments, T. canis larvae were incubated with the supernatants of Ef7121 (EI and mutant Ef7121 (EIm, in a pre-culture of Ef7121 (EII and in a fresh culture with Ef7121 (EIII and the Ef7121 mutant strain (EIIIm. The viability of the larvae was calculated after a 48 h incubation. A significant reduction of the viability of T. canis larvae was observed in EI, EII and EIII. A decrease of this inhibitory effect was observed in EIm and EIIIm (p = 0.008. In the in vivo experiments, mice were orally inoculated with three doses of Ef7121. To study the probiotic persistence in the intestine, the animals were sacrificed every four days and their intestines were dissected. The initial average bacterial levels were 9.7 x 10(4 for Ef7121 (colony forming units/g. At the end of the assay the levels were 1.46 x 10(4. No bacterial translocation was detected in mesenteric lymphatic nodules and spleen. Ef7121 interference with the biological cycle was evaluated in mice challenged with T. canis. The interference was significant when the mice were challenged with probiotic and T. canis simultaneously (p = 0.001, but it was not significant when the challenge was performed 15 days after administration of the bacterial inoculum (p = 0.06. In conclusion, Ef7121 possessed in vitro and in vivo larvicidal activity.

  17. Short communication: Streptococcus canis is able to establish a persistent udder infection in a dairy herd. (United States)

    Król, Jarosław; Twardoń, Jan; Mrowiec, Jacek; Podkowik, Magdalena; Dejneka, Grzegorz; Dębski, Bogdan; Nowicki, Tadeusz; Zalewski, Wojciech


    Bovine mastitis caused by Streptococcus canis is relatively rare. Consequently, many epidemiologic aspects of the infection, including factors that mediate crossing of host species barriers by the pathogen, infectiousness of the microorganism to the mammary gland, and the course of the disease within a herd, are still not elucidated. Therefore, the aim of the present study was to describe results of a 15-mo observation of subclinical Strep. canis mastitis on a dairy farm housing 76 lactating Holstein-Friesian cows. Upon 3 visits to the farm during a period between April 2013 and June 2014, Strep. canis was cultured from milk samples of 17 (22.4% of the herd), 7 (9.6%), and 8 (11.3%) cows, respectively. The isolates obtained were characterized phenotypically by means of the API Strep identification kit (bioMérieux, Marcy l'Etoile, France), as well as genetically by using random amplified polymorphic DNA and macrorestriction analysis of the chromosomal DNA by pulsed-field gel electrophoresis. All strains displayed the same biochemical features, and the molecular methods revealed that the isolates belonged to a single clone or were very closely related. Results of the study indicate that Strep. canis is capable of causing intramammary infections of long duration, behaving in a contagious manner. Because a persistently infected cow may serve as the source of Strep. canis infection for other animals, effective control of this type of udder infection within a herd may require similar measures to those adopted in Streptococcus agalactiae eradication programs. PMID:26233445

  18. Four cases of pediculosis caused by Pthirus pubis Linnaeus, 1758 (Diptera: Anoplura) from peninsular Malaysia. (United States)

    Pakeer, O; Jeffery, J; Mohamed, A M; Ahmad, F; Baharudin, O


    Four cases of pediculosis, two in adults and two in children, caused by the crab-louse, Pthirus pubis Linnaeus, 1758 (Diptera: Anoplura) is reported from peninsular Malaysia. This is the second report of the problem to be documented from the country. Although P. pubis is closely associated with genital hairs, it is, however, also found to occur on the eyelashes, eyebrows, hairs of the body, head and axilla. The few reported cases of pthiriasis probably do not reflect the true situation. PMID:18209717

  19. Prevalencia y factores que favorecen la presentación de toxocara canis y ancylostoma caninum en canes de compañía (Prevalence and factors that favor of presentation of toxocara canis and ancylostoma caninum in companion dogs).


    Castillo Cuenca. Julio César; Morales Morales. Alcides; Molina Leyva. Eulises Alexander; Cepero Rodríguez. Omelio; Gutierrez Aguiar. Digna Ibis; Fernández Pérez. Julieta Zonia


    RESUMENEl presente trabajo tiene como objetivo determinar la prevalencia de Toxocara canis y Ancylostoma caninum y algunos factores que pudieran favorecer una mayor tasa de infestación por estos nematodos zoonóticosen canes de compañía en los consejos populares Universidad y Camilo Cienfuegos.SUMMARYThe present research aims at determining Toxocara canis and Ancylostoma caninum prevalence and some factors that may favor higher values of infestation in companion dogs from these zoonotic nemath...

  20. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India

    Directory of Open Access Journals (Sweden)

    Sushma Chhabra


    Conclusions: The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration.

  1. A study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test. (United States)

    Oliveira, Trícia Maria F de Sousa; Furuta, Patrícia I; de Carvalho, Débora; Machado, Rosangela Z


    To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT) and Enzyme-linked immunosorbent assay (ELISA). All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis by IFAT. None of the serum samples from non-endemic areas were positive for Leishmania sp., by IFAT, but 67% were positive for B. canis and 78% for E. canis using the same test. When tested by ELISA for Leishmania sp., four samples from non-endemic area were positive. These dogs were then located and no clinical signs, parasites or antibody was detected in new tests for a six month period. Only one of these 4 samples was positive for B. canis by IFAT and ELISA and three for E. canis by IFAT. The results of the work suggest a co-infection in the endemic area and no serological cross-reaction among these parasites by IFAT and ELISA. PMID:18554433

  2. Zur intraspezifischen Lautkommunikation des Russischen Desmans Desmana moschata (Linnaeus, 1758) (Insectivora: Talpidae: Desmaninae) nebst einigen Angaben zu seinem Sozialverhalten

    NARCIS (Netherlands)

    Romanow, Peter; Poduschka, Walter; Deutsch, Werner


    The Russian Desman Desmana moschata (Linnaeus, 1758) is a highly endangered semiaquatic mammal, confined to disjunct areas. Between 1983 and 1992 several specimens were kept and investigated, firstly in the zoological garden of Moscow (4 ♀ ♀, 1 ♂), and afterwards in the field station of the former S



    R. J. DA SILVA; R.R. Rodrigues; M. F. B. Stein; G. P. M. SIPOLI; R. PINHÃO; C. A. M. LOPES


    Two hundred and fifty-two specimens of Ochetosoma heterocoelium (Travassos, 1921) (Trematoda: Digenea: Ochetosomatidae) were detected in the mouth and esophagus of the snake Chironius exoletus (Linnaeus, 1758) (Ophidia: Colubridae) at the serpentarium of the Center for the Study of Venoms and Venomous Animals (CEVAP) of São Paulo State University (UNESP) in Botucatu, State of São Paulo, Brazil.

  4. Metabolic costs of avian flight in relation to flight velocity : a study in Rose Coloured Starlings (Sturnus roseus, Linnaeus)

    NARCIS (Netherlands)

    Engel, S; Biebach, H; Visser, GH


    The metabolic costs of flight at a natural range of speeds were investigated in Rose Coloured Starlings (Sturnus roseus, Linnaeus) using doubly labelled water. Eight birds flew repeatedly and unrestrained for bouts of 6 h at speeds from 9 to 14 m s(-1) in a low-turbulence wind tunnel, corresponding

  5. The transmission of canine ehrlichiosis to the Wild Dog Lycaon pictus (Temminck) and Black-backed Jackal Canis mesomelas Schreber. (United States)

    van Heerden, J


    Canine ehrlichiosis was successfully transmitted from the domestic dog to three Wild Dogs Lycaon pictus and three Black-backed Jackals Canis mesomelas. Wild Dogs showed symptoms of anorexia and depression as well as anaemia, leucopaenia and mild thrombocytopaenia. Black-backed Jackals were asymptomatic. Morulae of Ehrlichicia canis were found in peripheral blood smears from all experimental animals. The disease was also successfully transmitted from Black-backed Jackal to the domestic dog. PMID:553960

  6. Study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test Estudo da reatividade cruzada em amostras de soro de cães positivos para Leishmania sp., Babesia canis e Ehrlichia canis, pelo ensaio imunoenzimático indireto e pela reação de imunofluorescência indireta


    Trícia Maria F. de Sousa Oliveira; Patrícia I. Furuta; Débora Carvalho; Rosangela Z. Machado


    To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT) and Enzyme-linked immunosorbent assay (ELISA). All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis ...

  7. The first detection of species of Babesia Starcovici, 1893 in moose, Alces alces (Linnaeus), in Norway. (United States)

    Puraite, Irma; Rosef, Olav; Radzijevskaja, Jana; Lipatova, Indre; Paulauskas, Algimantas


    Babesiosis is an emerging zoonotic disease and various wildlife species are reservoir hosts for zoonotic species of Babesia Starcovici, 1893. The objective of the present study was to investigate the presence and prevalence of Babesia spp. in moose Alces alces (Linnaeus) in two regions of Norway. A total of 99 spleen samples were collected from animals of various ages from an area with the occurrence of the tick Ixodes ricinus (Linnaeus, 1758), and from an area where the ticks are known to be absent. Infection was detected by the amplification of different regions of the 18S rRNA gene by using two different PCR primer sets specific of Babesia. Babesia spp. were found in the spleen samples of four moose. All Babesia-infected animals were from an area where ticks occur, with an infection rate of 6% (4 of 70). Babesia-positive samples were obtained from a five-month old moose calf and three adults. Two Babesia species, Babesia capreoli (Enigk et Friedhoff, 1962) and a B. odocoilei-like, were identified. Co-infection with Anaplasma phagocytophilum was obtained in two animals. This is the first report of the occurrence of B. capreoli and B. odocoilei-like species in moose. PMID:27188749

  8. Evidence of Sperm Storage in Nursehound (Scyliorhinus stellaris, Linnaeus 1758: Juveniles Husbandry and Tagging Program

    Directory of Open Access Journals (Sweden)

    Primo Micarelli


    Full Text Available Nursehound, Scyliorhinus stellaris (Linnaeus 1758, is a shark of the Scyliorhinidae family, close to the Scyliorhinus canicula (Linnaeus 1758, frequently hosted in public aquaria. Information on biology and ecology is deficiently available regarding this species of sharks. In the Mediterranean basin, they are occasional rare and vulnerable species (Serena, 2005. In 2003 a female specimen of Scyliorhinus stellaris, 90 cm long, fished in the Tyrrhenian Sea was transferred to Tuscany Argentario Mediterranean Aquarium and placed in a 20.000 L tank. The female laid 42 eggs and juveniles were born on 2004 and 2005. They were transferred to the aquarium laboratory in order to get standard protocol for correct juveniles husbandry. After a total of 18-month observations, some of them were tagged and let free on 2006. To collect data about nursehound shark needs in terms of feeding and growing in captivity, especially during the first life years, is a necessary and fundamental step in order to develop a Mediterranean program of tagging and study in the field of conservation policy proposal. Husbandry protocol for this species’ juveniles was developed in this study. This is the first reported case of a nursehound storing sperm for 2 years, in captivity (Pratt, 1993; Hamlett et al., 2002; Awruch, 2007.

  9. Carl Linnaeus, Erasmus Darwin and Anna Seward: Botanical Poetry and Female Education (United States)

    George, Sam


    This article will explore the intersection between `literature' and `science' in one key area, the botanical poem with scientific notes. It reveals significant aspects of the way knowledge was gendered in the Enlightenment, which is relevant to the present-day education of girls in science. It aims to illustrate how members of the Lichfield Botanical Society (headed by Erasmus Darwin) became implicated in debates around the education of women in Linnaean botany. The Society's translations from Linnaeus inspired a new genre of women's educational writing, the botanical poem with scientific notes, which emerged at this time. It focuses in particular on a poem by Anna Seward and argues that significant problems regarding the representation of the Linnaean sexual system of botany are found in such works and that women in the culture of botany struggled to give voice to a subject which was judged improper for female education. The story of this unique poem and the surrounding controversies can teach us much about how gender impacted upon women's scientific writing in eighteenth century Britain, and how it shaped the language and terminology of botany in works for female education. In particular, it demonstrates how the sexuality of plants uncovered by Linnaeus is a paradigmatic illustration of how societal forces can simultaneously both constrict and stimulate women's involvement in science. Despite the vast changes to women's access in scientific knowledge of the present day, this `fair sexing' of botany illustrates the struggle that women have undergone to give voice to their botanical knowledge.

  10. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago. (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto


    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. PMID:27177475

  11. Seroprevalence and Risk Factors of Ehrlichia canis Infection among Companion Dogs of Mashhad, North East of Iran, 2009–2010

    Directory of Open Access Journals (Sweden)

    Maneli Ansari-Mood


    Full Text Available Background: The aims of this study were to determine the seroprevalence of canine ehrlichiosis and risk factors of this disease in companion dogs’ population of Mashhad, North East of Iran. Canine Monocytic Ehrlichiosis (CME is a zoonotic disease transmitted by ticks, Rhipicephalus sanguineus, and caused by an obligate intracellular bacterium, Ehrlichia canis.Methods: During September 2009 until November 2010, 250 companion dogs from Mashhad, North-East of Iran, were examined for serum antibody detection against E. canis by means of immunofluorescence assay test (IFAT and factors associated with a positive antibody response.Results: There was a very low prevalence of anti-E. canis antibodies (0.8%, 2/250 among studied dogs. The antibody titers for two seropositive dogs were 1:80 and 1:160, respectively. One (0.4% of seropositive dogs was infested with, R. sanguineus. In blood smears from one of infested dogs (0.4%, typical morulae of E. canis was observed in lymphocytes. The results confirm that the lowest occurrence of reactive dogs indoors probably related to low tick infestion.Conclusion: This is the first report that describes serological evidences of canine monocytic ehrlichiosis in North- East of Iran. Results suggested that E. canis infection in owned pet dogs from North of Khorasan was not endemic from 2009 to 2010. Additional molecular studies are necessary to confirm E. canis infection and to identify the local strains of the organism.

  12. Serological survey for antibodies reactive with Ehrlichia canis and E. chaffeensis in dogs from the Bloemfontein area, South Africa

    Directory of Open Access Journals (Sweden)

    A-M Pretorius


    Full Text Available Sera from 161 dogs in the Bloemfontein area in South Africa were tested for the presence of antibodies reactive with Ehrlichia canis and E. chaffeensis by indirect fluorescent antibody testing. Overall, 68 (42 % of the dogs had significant antibody titres (>1/64 against E. canis and 61 (38 % had significant titres (>1/64 against E. chaffeensis. Seven (11 % dogs had higher titres to E. chaffeensis than E. canis (1/2048 and 1/1024 (2 dogs; 1/1024 and 1/512 (2 dogs; 1/2048 and 1/512; 1/512 and 1/256 and 1/512 and <1/64, respectively. The remaining seropositive dogs had equal (n=26; 42 % or 2- (n=17; 25 %, 3- (n=13; 2% or 4-fold (n= 5; 7 % higher titres against E. canis. Dogs from economically depressed, high-density suburbs (60/112; 48 % had significantly higher prevalences of antibodies against E. canis than those from more affluent, low-density suburbs (8/49; 14 % (c2 19.38, p < 0.001. Higher titres to E. chaffeensis than E. canis were found in dogs from affluent, low-density suburbs (3/49 and in dogs from economically depressed, high-density suburbs (4/112.

  13. A preliminary study to evaluate the immune responses induced by immunization of dogs with inactivated Ehrlichia canis organisms

    Directory of Open Access Journals (Sweden)

    Sunita Mahan


    Full Text Available Ehrlichia canis is an intracellular pathogen that causes canine monocytic ehrlichiosis. Although the role of antibody responses cannot be discounted, control of this intracellular pathogen is expected to be by cell mediated immune responses. The immune responses in dogs immunized with inactivated E. canis organisms in combination with Quil A were evaluated. Immunization provoked strong humoral and cellular immune responses, which were demonstrable by Western blotting and lymphocyte proliferation assays. By Western blotting antibodies to several immunodominant E. canis proteins were detected in serum from immunized dogs and antibody titres increased after each immunization. The complement of immunogenic proteins recognized by the antisera were similar to those recognized in serum from infected dogs. Upon challenge with live E. canis, rapid anamnestic humoral responses were detected in the serum of immunized dogs and primary antibody responses were detected in the serum from control dogs. Following immunization, a lymphocyte proliferative response (cellular immunity was detected in peripheral blood mononuclear cells (PBMNs of immunized dogs upon stimulation with E. canis antigens. These responses were absent from non-immunized control dogs until after infection with live E. canis, when antigen specific-lymphocyte proliferation responses were also detected in the PBMNs of the control dogs. It can be thus concluded that immunization against canine monocytic ehrlichiosis may be feasible. However, the immunization regimen needs to be optimized and a detailed investigation needs to be done to determine if this regimen can prevent development of acute and chronic disease.

  14. Presence of Leishmania and Brucella species in the golden jackal Canis aureus in Serbia. (United States)

    Cirović, Duško; Chochlakis, Dimosthenis; Tomanović, Snežana; Sukara, Ratko; Penezić, Aleksandra; Tselentis, Yannis; Psaroulaki, Anna


    The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010-02/2013) from 12 sites all over Serbia. Of the tissue samples collected, spleen was chosen as the tissue to proceed; all samples were tested for Leishmania species and Brucella species by real-time PCR. Of the 216 samples collected, 15 (6.9%) were positive for Leishmania species, while four (1.9%) were positive for B. canis. The potential epidemiologic role of the golden jackal in carrying and dispersing zoonotic diseases in Serbia should be taken under consideration when applying surveillance monitoring schemes. PMID:24967397

  15. Presence of Leishmania and Brucella Species in the Golden Jackal Canis aureus in Serbia

    Directory of Open Access Journals (Sweden)

    Duško Ćirović


    Full Text Available The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010–02/2013 from 12 sites all over Serbia. Of the tissue samples collected, spleen was chosen as the tissue to proceed; all samples were tested for Leishmania species and Brucella species by real-time PCR. Of the 216 samples collected, 15 (6.9% were positive for Leishmania species, while four (1.9% were positive for B. canis. The potential epidemiologic role of the golden jackal in carrying and dispersing zoonotic diseases in Serbia should be taken under consideration when applying surveillance monitoring schemes.

  16. Seroprevalence of Brucella abortus and B. canis in household dogs in southwestern Nigeria: a preliminary report

    Directory of Open Access Journals (Sweden)

    S. I. B. Cadmus


    Full Text Available A preliminary serological study of 366 household dogs in Lagos and Ibadan, southwestern Nigeria, was carried out to determine antibodies due to exposure to Brucella abortus and B. canis, using the rose bengal test (RBT and the rapid slide agglutination (RSA test, respectively. Results showed that 5.46 % (20/366 and 0.27 % (1/366 of the dogs screened were seropositive to B. abortus and B. canis, respectively.Of all dogs, 36 had a history of being fed foetuses from cows and 11 (30.6 % of these tested positive in the RBT. Our findings, although based on a limited sample size and a dearth of clinical details, revealed that dogs in Nigeria may be infected with Brucella spp. given the wide range of risk factors. Further studies are recommended to elucidate the epidemiology of brucellosis in dogs and its possible zoonotic consequences in the country.

  17. Skin impression with acetate tape in Demodex canis and Scarcoptes scabiei var. vulpes diagnosis

    Directory of Open Access Journals (Sweden)

    D.T. Pereira


    Full Text Available This study compares the efficacy of skin impression with acetate tape and the deep skin scraping test to find D. canis and S. scabiei in dogs. During six months, 134 samples were collected by both techniques from 115 dogs treated at the dermatology service of the Veterinary Hospital of the Federal University of Santa Maria (HVU-UFSM. Of these patients, 27 had demodicosis and 12 had scabies. The impression with acetate tape test (ITT was shown to be significantly superior to the deep skin scraping test (DSST in finding D. canis and S. scabiei mites (p = 0.007. Based on our results we could conclude that acetate tape impression is a reliable method for diagnosing and monitoring therapy of dermatopathies caused by mites and can be used to replace the traditional deep skin scraping method. In addition, since it is less traumatic for the dog, this method shows more acceptance by the owner.


    Directory of Open Access Journals (Sweden)



    Full Text Available Here we described the remains of Canis lupus from the bed 8 of Avetrana karst filling (Late Pleistocene; Taranto, Southern Italy. The studied specimens are larger than those collected from the early Late Pleistocene Apulian localities and those referred to the recent Italian wolf. Moreover, the remains from Avetrana are morphometrically close to Canis lupus maximus from France and to C. lupus collected from Central and Northern Italian localities, chronologically related to MIS 2 and MIS 3. Morphologically, the studied specimens slightly differ from both C. l. maximus and other Pleistocene Apulian wolves. The dimensional differences between the Avetrana wolves and those collected from the other early Late Pleistocene Apulian localities could be explained through a spread of a large-sized morphotype from the Northern Italy.

  19. RR Lyrae search and stellar populations study in Canis Major: Preliminary Results

    CERN Document Server

    Mateu, C E; Zinn, R; Miller, L; Mateu, Cecilia E.; Zinn, Robert; Miller, Lissa


    We present preliminary results of a RR Lyrae star search and stellar populations study performed in the Canis Major overdensity, spanning an area of 8.35sq deg. The observations were made in R and V bands, with the QUEST camera installed in the 1m Jurgen Stock Telescope, at the Venezuela National Observatory. The resulting Hess diagram shows a possible, but weak, red giant branch and no obvious horizontal branch, red clump or main sequence turnoff. After a multi--epoch photometric search, 6 RR Lyrae stars were confirmed with further observations obtained at the 1.0 and 1.3m telescopes of the SMARTS consortium at CTIO. Of these confirmed RR Lyrae stars, 5 have heliocentric distances between 5 and 7 kpc. Confirmation of their physsical association with the Canis Major system awaits for a study of their radial velocities.


    Directory of Open Access Journals (Sweden)

    Isis Regina Grenier CAPOCI


    Full Text Available Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus on 31 Microsporum canis isolates from animals and home environments. Susceptibility tests were performed based on document M38-A2 (2008 of the Clinical and Laboratory Standards Institute with modifications for natural products. Although susceptibility variation was observed between the fungus tested, the concentrations that inhibited the growth of 50 and 90% of the microorganisms were low (19.5 and 78 µg/mL, respectively. Thus, this citronella extract showed potent fungistatic and fungicide activities against M. canis isolated from animals and home environments. Therefore, it could be an alternative for dermatophytosis prophylaxis in the home environment.

  1. ANTIFUNGAL ACTIVITY OF Cymbopogon nardus (L.) Rendle (CITRONELLA) AGAINST Microsporum canis FROM ANIMALS AND HOME ENVIRONMENT. (United States)

    Capoci, Isis Regina Grenier; Cunha, Michele Milano da; Bonfim-Mendonça, Patricia de Souza; Ghiraldi-Lopes, Luciana Dias; Baeza, Lilian Cristiane; Kioshima, Erika Seki; Svidzinski, Terezinha Inez Estivalet


    Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus) on 31 Microsporum canis isolates from animals and home environments. Susceptibility tests were performed based on document M38-A2 (2008) of the Clinical and Laboratory Standards Institute with modifications for natural products. Although susceptibility variation was observed between the fungus tested, the concentrations that inhibited the growth of 50 and 90% of the microorganisms were low (19.5 and 78 µg/mL, respectively). Thus, this citronella extract showed potent fungistatic and fungicide activities against M. canis isolated from animals and home environments. Therefore, it could be an alternative for dermatophytosis prophylaxis in the home environment. PMID:27049705

  2. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie;


    ; 25 routine specimens from patients suspected of having dermatophytosis; 10 hair specimens from guinea pigs experimentally infected with M. canis; and two samples from un-infected control animals. DNA was prepared by a 10-min procedure from pure cultures as previously described. The 302 bp PCR product...... results. Finally, the Microsporum PCR was positive for 10/10 guinea pig specimens from infected animals but for 0/2 of the control animal samples. The evaluation of the two PCR tests indicated excellent sensitivity and specificity.......Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples...

  3. First record of a golden jackal (Canis aureus) in the Savinja Valley (NorthernSlovenia)


    Potočnik, Hubert; Krofel, Miha


    The article presents the record of an adult female golden jackal (Canis aureus) accidentally shot in 2005 near Gornji Grad in the Upper Savinja Valley, Northern Slovenia (UTM VM82, 980 m a.s.l.). Although this individual was most likely a vagrant, it indicates that golden jackals may soon, or perhaps already have, established permanent territories in Slovenia. Further studies are necessary to determine the status and distribution of this protected species in Slovenia, as well as public awaren...

  4. Dietary Habits of the Golden Jackal (Canis aureus L.) in the Eastern Croatia


    Ivica Bošković; Marcela Šperanda; Tihomir Florijančić; Nikica Šprem; Siniša Ozimec; Dražen Degmečić; Dinko Jelkić


    In the past fifteen years, a considerable increase in size of the golden jackal (Canis aureus) population has been recorded in the eastern part of Croatia. Dietary habits have been determined in the period 2008-2011 by analysing the content of 238 stomachs. Golden jackal is typical omnivorous and opportunistic forager which consumes easiest accessible food, according to season and habitat, primary animal food, such as carcasses, rodents and meat waste. Parts of big game animals were found con...

  5. Occurence of Streptococcus canis, Staphylococcus aureus and intermedius in dog breeding in Berlin and surround areas


    Mellert, Simone


    Staphylococcus intermedius, Staphylococcus aureus and Streptococcus canis are suspected as the most important bacterial pathogens for puppies losses. In the presented study the occurrence of these bacterial species was investigated in newborn puppies, their bitches and in the environment of these animals. Fourteen bitches and their litters were included in the study. The animals were sampled at a number of sites using swabs. Further environmental samples were collected. The bitches were s...

  6. Role of golden jackals (Canis aureus) as natural reservoirs of Dirofilaria spp. in Romania


    Ionică, Angela Monica; Matei, Ioana Adriana; D’Amico, Gianluca; Daskalaki, Aikaterini Alexandra; Juránková, Jana; Ionescu, Dan Traian; Mihalca, Andrei Daniel; Modrý, David; Gherman, Călin Mircea


    Background Dirofilaria immitis and Dirofilaria repens are mosquito-transmitted zoonotic nematodes, causing heartworm disease and skin lesions, respectively, in carnivores. In Europe, the domestic dog is apparently the main definitive host, but patent infections occur also in other species of carnivores. The rapid spread of the golden jackals (Canis aureus) throughout Europe opens a question of involvement of this species in the sylvatic cycle of pathogens in the colonised territories, includi...

  7. Seroprevalence of Ehrlichia canis, Ehrlichia chaffeensis and Ehrlichia ewingii in dogs in North America

    Directory of Open Access Journals (Sweden)

    Beall Melissa J


    Full Text Available Abstract Background This study evaluated the exposure of dogs to three different Ehrlichia spp. in the south and central regions of the United States where vector-borne disease prevalence has been previously difficult to ascertain, particularly beyond the metropolitan areas. Methods Dog blood samples (n = 8,662 were submitted from 14 veterinary colleges, 6 private veterinary practices and 4 diagnostic laboratories across this region. Samples were tested for E. canis, E. chaffeensis and E. ewingii specific antibodies using peptide microtiter ELISAs. Results Overall, E. canis, E. chaffeensis and E. ewingii seroprevalence was 0.8%, 2.8%, and 5.1%, respectively. The highest E. canis seroprevalence (2.3% was found in a region encompassing Arkansas, Louisiana, Oklahoma, Tennessee and Texas. E. chaffeensis seroreactivity was 6.6% in the central region (Arkansas, Kansas, Missouri, and Oklahoma and 4.6% in the southeast region (Georgia, Maryland, North Carolina, South Carolina, Tennessee and Virginia. Seroreactivity to E. ewingii was also highest in the central region (14.6% followed by the southeast region (5.9%. The geospatial pattern derived from E. chaffeensis and E. ewingii seropositive samples was similar to previous reports based on E. chaffeensis seroreactivity in white-tailed deer and the distribution of human monocytic ehrlichiosis (HME cases reported by the CDC. Conclusions The results of this study provide the first large scale regional documentation of exposure to E. canis, E. chaffeensis and E. ewingii in pet dogs, highlighting regional differences in seroprevalence and providing the basis for heightened awareness of these emerging vector-borne pathogens by veterinarians and public health agencies.

  8. Parasite species of the endangered Iberian wolf (Canis lupus signatus) and a sympatric widespread carnivore


    Figueiredo, Ana; Oliveira, Lucia; Madeira de Carvalho, Luís; Fonseca, Carlos; Torres, Rita Tinoco


    Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus) and the widespread red fox (Vulpes vulpes), in central Portugal. From November 2014 to July 2015, fresh fecal samples from bo...

  9. Space Use and Habitat Selection by Resident and Transient Coyotes (Canis latrans)


    Joseph W. Hinton; van Manen, Frank T; Chamberlain, Michael J.


    Little information exists on coyote (Canis latrans) space use and habitat selection in the southeastern United States and most studies conducted in the Southeast have been carried out within small study areas (e.g., ≤1,000 km2). Therefore, studying the placement, size, and habitat composition of coyote home ranges over broad geographic areas could provide relevant insights regarding how coyote populations adjust to regionally varying ecological conditions. Despite an increasing number of stud...

  10. Restricted evaluation of Trichodectes canis (Phthiraptera: Trichodectidae detection methods in Alaska gray wolves

    Directory of Open Access Journals (Sweden)

    Theresa M. Woldstad


    Full Text Available Trichodectes canis (Phthiraptera: Trichodectidae was first documented on Alaska (USA gray wolves (Canis lupus on the Kenai Peninsula in 1981. In subsequent years, numerous wolves exhibited visually apparent, moderate to severe infestations. Currently, the Alaska Department of Fish and Game utilizes visual inspection, histopathology, and potassium hydroxide (KOH hide digestion for T. canis detection. Our objective was to determine optimal sampling locations for T. canis detection. Wolf hides were subjected to lice enumeration using KOH hide digestion. Thirty nine of the 120 wolves examined had lice. Of these 39, total louse burdens ranged from 14 to an extrapolated 80,000. The hides of 12 infested animals were divided into 10 cm by 10 cm subsections and the lice enumerated on a subsection from each of four regions: neck; shoulder; groin; and rump. Combining the data from these 12 wolves, the highest mean proportions of the total louse burdens on individual wolves were found on the rump and differed significantly from the lowest mean proportion on the neck. However, examination of the four subsections failed to detect all infested wolves. Hides from 16 of the 39 infested animals were cut into left and right sides, and each side then cut into four, approximately equal sections: neck and shoulder; chest; abdomen; and rump. Half hides were totally digested from 11 wolves, and whole hides from 5. For these 21 half hides, the highest mean proportions of total louse burdens were found on the rump, and this section had the highest sensitivity for louse detection, regardless of burden. However, removal of this large section from a hide would likely be opposed by hunters and trappers.

  11. Antigenisitas, Sensitivitas, dan Spesifisitas Protein Toxocara canis pada Pemeriksaan Antibodi Serum Mencit dengan Indirect-ELISA


    Sri Subekti Bendryman; Kusnoto .; Tutik Juniastuti


    The aim of this research were to determine antigenicity, sensitivity, and specificity of Toxocara canisprotein used as antigen in indirect-ELISA for the detection antibody against the worm in the infected hostin order to proper diagnose kit. The design used was true experimental, with Post-test Only ControlGroups Design. Mouse was immunized with various worm homogenates used to antigenicity, sensitivityand specificity tests of T. canis protein with indirect-ELISA technique. The independence v...

  12. Playing at bullying: The postmodern ethic of Bully (Canis Canem Edit)


    Clare Bradford


    This essay discusses Bully (Canis Canem Edit), considering the game’s antecedents (narratives involving young people in school settings) and the features which set it apart from other teen texts. It discusses the controversy surrounding the game and comes to the conclusion that the principal reason for unease on the part of parents and educational authorities is that Bully’s postmodernist ethic evades the binaries of liberal humanism and calls into question the foundations on which convention...

  13. Hypoxia Adaptations in the Grey Wolf (Canis lupus chanco) from Qinghai-Tibet Plateau


    Zhang, Wenping; Fan, Zhenxin; Han, Eunjung; Hou, Rong; Zhang, Liang; Galaverni, Marco; Huang, Jie; Liu, Hong; Silva, Pedro; Li, Peng; Pollinger, John P.; Du, Lianming; Zhang, XiuyYue; Yue, Bisong; Wayne, Robert K.


    The Tibetan grey wolf (Canis lupus chanco) occupies habitats on the Qinghai-Tibet Plateau, a high altitude (>3000 m) environment where low oxygen tension exerts unique selection pressure on individuals to adapt to hypoxic conditions. To identify genes involved in hypoxia adaptation, we generated complete genome sequences of nine Chinese wolves from high and low altitude populations at an average coverage of 25× coverage. We found that, beginning about 55,000 years ago, the highland Tibetan gr...

  14. Recombinant Major Antigenic Protein 2 of Ehrlichia canis: a Potential Diagnostic Tool


    Alleman, A. Rick; McSherry, Leo J.; Barbet, Anthony F.; Breitschwerdt, Edward B.; Sorenson, Heather L.; Bowie, Michael V.; Bélanger, Myriam


    The major antigenic protein 2 (MAP2) of Ehrlichia canis was cloned and expressed. The recombinant protein was characterized and tested in an enzyme-linked immunosorbent assay (ELISA) format for potential application in the serodiagnosis of canine monocytic ehrlichiosis. The recombinant protein, which contained a C-terminal polyhistidine tag, had a molecular mass of approximately 26 kDa. The antigen was clearly identified by Western immunoblotting using antihistidine antibody and immune serum ...



    Capoci, Isis Regina Grenier; Michele Milano da CUNHA; BONFIM-MENDONÇA, Patricia de Souza; GHIRALDI-LOPES, Luciana Dias; Baeza, Lilian Cristiane; KIOSHIMA, Erika Seki; Terezinha Inez Estivalet SVIDZINSKI


    Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus) on 31 Microsporum canis isolates from animals and home environments. Su...

  16. Evaluation of an attenuated strain of Ehrlichia canis as a vaccine for canine monocytic ehrlichiosis. (United States)

    Rudoler, Nir; Baneth, Gad; Eyal, Osnat; van Straten, Michael; Harrus, Shimon


    Canine monocytic ehrlichiosis is an important tick-borne disease worldwide. No commercial vaccine for the disease is currently available and tick control is the main preventive measure against the disease. The aim of this study was to evaluate the potential of a multi-passaged attenuated strain of Ehrlichia canis to serve as a vaccine for canine monocytic ehrlichiosis, and to assess the use of azithromycin in the treatment of acute ehrlichiosis. Twelve beagle dogs were divided into 3 groups of 4 dogs. Groups 1 and 2 were inoculated (vaccinated) with an attenuated strain of E. canis (#611A) twice or once, respectively. The third group consisted of naïve dogs which served as controls. All 3 groups were challenged with a wild virulent strain of E. canis by administering infected dog-blood intravenously. Transient thrombocytopenia was the only hematological abnormality observed following inoculation of dogs with the attenuated strain. Challenge with the virulent strain resulted in severe disease in all 4 control dogs while only 3 of 8 vaccinated dogs presented mild transient fever. Furthermore, the mean blood rickettsial load was significantly higher in the control group (27-92-folds higher during days 14-19 post challenge with the wild the strain) as compared to the vaccinated dogs. The use of azithromycin was assessed as a therapeutic agent for the acute disease. Four days treatment resulted in further deterioration of the clinical condition of the dogs. Molecular comparison of 4 genes known to express immunoreactive proteins and virulence factors (p30, gp19, VirB4 and VirB9) between the attenuated strain and the challenge wild strain revealed no genetic differences between the strains. The results of this study indicate that the attenuated E. canis strain may serve as an effective and secure future vaccine for canine ehrlichiosis. PMID:23072894

  17. The Effects of Social Status and Learning on Captive Coyote (Canis latrans) Behavior


    Gilbert-Norton, Lynne Barbara


    Many canids live within hierarchical social systems that could promote differences in learning or in behavior between ranked individuals. Differences in foraging and territorial behavior have been observed between ranked coyotes (Canis latrans), yet effects of learning and social status on coyote behavior are not thoroughly understood. I explored a) coyote response to an artificial scent boundary and whether response differed by status, b) how foraging coyotes tracked temporal resource change...

  18. Ecological Changes in Coyotes (Canis latrans) in Response to the Ice Age Megafaunal Extinctions


    Meachen, Julie A.; Adrianna C Janowicz; Jori E Avery; Rudyard W Sadleir


    Coyotes (Canis latrans) are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these chang...

  19. Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea) in soil and fecal samples


    Durant Jean-Francois; Irenge Leonid M; Fogt-Wyrwas Renata; Dumont Catherine; Doucet Jean-Pierre; Mignon Bernard; Losson Bertrand; Gala Jean-Luc


    Abstract Background Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis) and/or Toxocara cati (T. cati), two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. Methods A duplex qua...

  20. Diagnostic PCR tests for Microsporum audouinii, M. canis and Trichophyton infections

    DEFF Research Database (Denmark)

    Brillowska-Dabrowska, Anna; Swierkowska, Aleksandra; Lindhardt Saunte, Ditte Marie;


    Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control sample...... results. Finally, the Microsporum PCR was positive for 10/10 guinea pig specimens from infected animals but for 0/2 of the control animal samples. The evaluation of the two PCR tests indicated excellent sensitivity and specificity.......Since traditional diagnosis of dermatophyte infections is slow, we present a rapid new PCR test for detection of Trichophyton spp., Microsporum canis and M. audouinii infections. The performance of the test was evaluated with: 58 dermatophyte isolates; 10 yeast, mould and human DNA control samples......; 25 routine specimens from patients suspected of having dermatophytosis; 10 hair specimens from guinea pigs experimentally infected with M. canis; and two samples from un-infected control animals. DNA was prepared by a 10-min procedure from pure cultures as previously described. The 302 bp PCR product...

  1. Use of cranial characters in taxonomy of the Minnesota wolf (Canis sp.) (United States)

    Mech, L. David; Nowak, Ronald M.; Weisberg, Sanford


    Minnesota wolves (Canis sp.) sometimes are reported to have affinity to a small, narrow-skulled eastern form (Canis lupus lycaon Schreber, 1775) and sometimes to a larger, broader western form (Canis lupus nubilus Say, 1823). We found that pre-1950 Minnesota wolf skulls were similar in size to those of wolves from southeastern Ontario and smaller than those of western wolves. However, Minnesota wolf skulls during 1970–1976 showed a shift to the larger, western form. Although Minnesota skull measurements after 1976 were unavailable, rostral ratios from 1969 through 1999 were consistent with hybridization between the smaller eastern wolf and the western form. Our findings help resolve the different taxonomic interpretations of Minnesota skull morphology and are consistent with molecular evidence of recent hybridization or intergradation of the two forms of wolves in Minnesota. Together these data indicate that eastern- and western-type wolves historically mixed and hybridized in Minnesota and continue to do so. Our findings are relevant to a recent government proposal to delist wolves from the endangered species list in Minnesota and surrounding states.

  2. Molecular detection of Theileria annae and Hepatozoon canis in foxes (Vulpes vulpes) in Croatia. (United States)

    Dezdek, Danko; Vojta, Lea; Curković, Snjezana; Lipej, Zoran; Mihaljević, Zeljko; Cvetnić, Zeljko; Beck, Relja


    An epizootiological field study on tick-borne protozoan infections in foxes (Vulpes vulpes) was carried out in different parts of Croatia. Spleen samples of 191 carcasses of red foxes killed in sanitary hunting, were examined for the presence of hematozoa by polymerase chain reaction (PCR) and subsequent sequencing. The investigation revealed four species of hematozoa in 57 foxes (30%), namely Theileria annae, Theileria sp. 3182/05 and Hepatozoon canis. T. annae was found in 10 foxes (5%), Theileria sp. 3182/05 in a single animal (1%), H. canis in 44 (23%) and Hepatozoon sp. was detected in two foxes (1%). T. annae and H. canis were distributed through all the studied regions, while Theileria sp. 3182/05 and Hepatozoon sp. were restricted to the Zagreb and Zagorje, and Istria regions, respectively. Detection of T. annae in all regions of Croatia indicates the presence of the natural cycle of the parasite and raises the possibility of other vectors other than the proposed Ixodes hexagonus. PMID:20646832

  3. Epidemiological Survey of Brucella canis Infection in Different Breeds of Dogs in Fars Province, Iran

    Directory of Open Access Journals (Sweden)

    Mohammad Amin Behzadi and Asghar Mogheiseh1*


    Full Text Available This study was conducted to determine the prevalence of Brucella canis antibodies in different breeds, sex and ages of dogs in southern of Iran. A total of 113 whole blood samples were taken from different breeds based on exotic or native sources. The samples were examined with immunochromatography assay for detection of B. canis antibodies. Twelve dogs were serologically positive (10.62%. There was significant differences in ratio of infected dogs between breeds (exotic or native, ages (less, equal or more than 2 years old and the history of vaccination (against rabies, leptospirosis, parvovirus, adenovirus type 2, canine distemper, parainfluenza (P<0.001. However, the results were not significant statistically, among both sex (P=0.058 and the history of clinical signs (P=0.456 in seropositive dogs. Based on this study and the other investigation in companion dogs from southwest of Iran, it seems that the mixed and spray (native breeds are not infected with B. canis, yet. Conversely, the exotic breeds would be the source of bacterium in Iran. Therefore, preventive and control measures are strongly recommended.

  4. Strong monovalent electrolyte imbalances in serum of dogs infected with Babesia canis. (United States)

    Zygner, Wojciech; Gójska-Zygner, Olga; Wędrychowicz, Halina


    Canine babesiosis is a systemic tick-borne protozoan disease caused by infection with parasites of the genus Babesia. Acid-base disorders and ion imbalances have been described in dogs infected with Babesia rossi in South Africa. In this paper, the authors describe changes to monovalent ion concentrations and calculated parameters of monovalent ions in 70 dogs naturally infected with B. canis, a species occurring in Europe. Hyponatraemia, hypokalaemia, hyperchloraemia, decrease of chloride gap, strong ion gap, difference between sodium and chloride concentrations, and an increase of chloride-to-sodium and sodium-to-potassium ratios were the most prevalent changes. Hyponatraemia, hypokalaemia and hyperchloraemia were detected less frequently than in dogs infected with B. rossi, but the severity of these changes were similar. Comparison of monovalent ion concentrations in azotaemic and non-azotaemic, and anaemic and non-anaemic dogs infected with B. canis showed that azotaemic dogs had significantly lower sodium concentrations. The results of this study indicate a possible development of hyperchloraemic acidosis and the probable contribution of aldosterone in the development of hypokalaemia. However, further study on blood gas, aldosterone, and antidiuretic hormone in dogs infected with B. canis is needed. PMID:22463923

  5. Study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test Estudo da reatividade cruzada em amostras de soro de cães positivos para Leishmania sp., Babesia canis e Ehrlichia canis, pelo ensaio imunoenzimático indireto e pela reação de imunofluorescência indireta

    Directory of Open Access Journals (Sweden)

    Trícia Maria F. de Sousa Oliveira


    Full Text Available To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT and Enzyme-linked immunosorbent assay (ELISA. All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis by IFAT. None of the serum samples from non-endemic areas were positive for Leishmania sp., by IFAT, but 67% were positive for B. canis and 78% for E. canis using the same test. When tested by ELISA for Leishmania sp., four samples from non-endemic area were positive. These dogs were then located and no clinical signs, parasites or antibody was detected in new tests for a six month period. Only one of these 4 samples was positive for B. canis by IFAT and ELISA and three for E. canis by IFAT. The results of the work suggest a co-infection in the endemic area and no serological cross-reaction among these parasites by IFAT and ELISA.Para verificar a existência de reação cruzada entre leishmaniose visceral, erliquiose e babesiose, nos testes sorológicos utilizados em programas de controle da leishmaniose visceral humana, amostras de soro canino provenientes de áreas endêmicas e não endêmicas para essa enfermidade, foram testadas pela Reação de Imunofluorescência (RIFI e Ensaio imunoenzimático (ELISA. Todos os soros provenientes de área endêmica foram positivos para Leishmania sp pelo ELISA e RIFI, 51% para Babesia canis e 43% para Ehrlichia canis pela RIFI. Pela RIFI, nenhum dos soros provenientes de área não endêmica foi positivo para Leishmania sp, sendo 67% positivos para B. canis e 78% para E. canis pelo mesmo teste. Quando testados pelo ELISA para Leishmania sp., quatro soros da área não endêmica foram positivos. Os cães foram localizados

  6. Descripción de características reproductivas en tres perros seropositivos a Brucella canis Description of reproductive characteristics of three Brucella canis seropositive dogs

    Directory of Open Access Journals (Sweden)

    C. BORIE


    Full Text Available Se describen las características reproductivas a nivel histológico y seminal en tres perros seropositivos a Brucella canis. A nivel seminal se observaron alteraciones en volumen y en la morfología espermática, encontrándose en un perro ausencia total de espermatozoides. Esta situación concordó con los estudios histológicos, donde se encontró alteración de la línea espermatogénica, además de infiltración eritrocitaria tubular indicativo de alteración de la barrera hematotesticular. Los resultados confirman el impacto negativo de esta bacteria sobre la funcionalidad reproductiva, alterando seriamente la fertilidadSeminal and histological reproductive characteristics in three Brucella canis seropositive dogs are described. Seminal volume and sperm morphology were altered and no sperm was seen in one dog. This agrees with histological findings where spermatozoid development was altered and eritrocites inside tubular lumen were seen indicating hemo-testicular barrier failure. These results confirm the negative impact of the disease on reproductive performance with subsequent infertility

  7. Isolasi dan Identifikasi Microsporum canis dari Anjing Penderita Dermatofitosis di Yogyakarta (ISOLATION AND IDENTIFICATION OF Microsporum Canis FROM DERMATOPHYTOSIS DOGS IN YOGYAKARTA

    Directory of Open Access Journals (Sweden)

    Soedarmanto Indarjulianto


    Full Text Available Dermatophytosis in dogs can be caused by one species of dermatophytes group called Microsporumcanis. This study aims to isolation and identification of M. canis in dogs suspected dermatophytosis inYogyakarta. Skin scrapings from 50 dogs that clinically showed lesions such as combination of alopecia,erythema, papules, pustules, scaly and crusty used in this study. Samples of skin scraping were culturedin the Sabouraud’s dextrose agar media for fungi identification macroscopically and microscopically. Theresults showed that 17 of 50 samples (34% grown on SDA medium from 2 to 18 days after cultivation. Thecolony grew with flat topography and slightly reflexed, the surface of the colony looks like a thick fur, whitein the middle and surrounded by brownish yellow color and the edges were colorless. The opposite surfaceof the colony looks flat and slightly reflexed and orange to brown and the edges were colorless. Observationmicroscopically, the fungi showed a large macroconidia with a thick cell wall and contains 6-12 cells andoval microconidia with a small size and found in few along the hyphae. Based on the research it can beconcluded that 17 of 50 (34% samples of dogs with dermatophytosis are Microsporum canis.

  8. Molecular analysis of the rRNA genes of Babesia spp and Ehrlichia canis detected in dogs from RibeirÃo Preto, Brazil


    de Oliveira, L. P.; Cardozo, G.P.; E.V. Santos; Mansur, M.A.B.; I.A.N. Donini; Zissou, V.G.; P.G. Roberto; M. Marins


    The partial DNA sequences of the 18S rRNA gene of Babesia canis and the 16S rRNA gene of Ehrlichia canis detected in dogs from Ribeirão Preto, Brazil, were compared to sequences from other strains deposited in GenBank. The E. canis strain circulating in Ribeirão Preto is identical to other strains previously detected in the region, whereas the subspecies Babesia canis vogeli is the main Babesia strain circulating in dogs from Ribeirão Preto.As sequências parciais dos genes RNAr 18S de Babesia...

  9. NCBI nr-aa BLAST: CBRC-VPAC-01-1534 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1534 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-126 75% ...

  10. NCBI nr-aa BLAST: CBRC-TSYR-01-0801 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0801 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 79% ...

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-0906 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0906 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-122 76% ...

  12. NCBI nr-aa BLAST: CBRC-LAFR-01-3219 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3219 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...

  14. NCBI nr-aa BLAST: CBRC-MLUC-01-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0057 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 3e-50 57% ...

  15. NCBI nr-aa BLAST: CBRC-MMUR-01-0982 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0982 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-159 86% ...

  16. NCBI nr-aa BLAST: CBRC-MMUR-01-0468 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0468 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-51 49% ...

  17. NCBI nr-aa BLAST: CBRC-MMUS-07-0511 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0511 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 77% ...

  18. NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0131 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 3e-69 47% ...

  19. NCBI nr-aa BLAST: CBRC-PCAP-01-0158 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0158 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-69 61% ...

  20. NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...

  1. NCBI nr-aa BLAST: CBRC-OGAR-01-1197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-162 85% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-1061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1061 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-61 44% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  4. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  6. NCBI nr-aa BLAST: CBRC-MDOM-03-0298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0298 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-154 76% ...

  7. NCBI nr-aa BLAST: CBRC-GGOR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0009 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 77% ...

  8. NCBI nr-aa BLAST: CBRC-OLAT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0032 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-61 41% ...

  9. NCBI nr-aa BLAST: CBRC-MMUR-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0910 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 90% ...

  10. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-51 44% ...

  11. NCBI nr-aa BLAST: CBRC-DRER-11-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-11-0014 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-93 52% ...

  12. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  13. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  14. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  16. NCBI nr-aa BLAST: CBRC-MMUS-03-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0082 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 87% ...

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0028 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-149 89% ...

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0017 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-37 39% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-08-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0127 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 5e-77 45% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 2e-30 37% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  3. NCBI nr-aa BLAST: CBRC-RNOR-23-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-23-0122 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  4. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  5. NCBI nr-aa BLAST: CBRC-OPRI-01-1433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1433 ref|NP_001041572.1| G protein-coupled receptor 44 [Canis lupus fa...miliaris] emb|CAJ77887.1| G-protein coupled receptor [Canis lupus familiaris] NP_001041572.1 1e-133 66% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1930 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-69 59% ...

  7. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-72 48% ...

  8. NCBI nr-aa BLAST: CBRC-CPOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1448 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-141 93% ...

  9. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-78 59% ...

  10. NCBI nr-aa BLAST: CBRC-MEUG-01-1021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1021 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-62 43% ...

  11. NCBI nr-aa BLAST: CBRC-LAFR-01-2049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2049 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-113 78% ...

  12. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  13. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  14. NCBI nr-aa BLAST: CBRC-PCAP-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0105 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-97 62% ...

  15. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-101 64% ...

  16. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  18. NCBI nr-aa BLAST: CBRC-MLUC-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0118 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-64 52% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  20. NCBI nr-aa BLAST: CBRC-ACAR-01-1017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1017 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-80 48% ...

  1. NCBI nr-aa BLAST: CBRC-RMAC-14-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0161 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 9e-90 72% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  3. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  4. NCBI nr-aa BLAST: CBRC-TSYR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1175 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 73% ...

  5. NCBI nr-aa BLAST: CBRC-PVAM-01-0863 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0863 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-124 73% ...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-3354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3354 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 9e-94 49% ...

  7. NCBI nr-aa BLAST: CBRC-LAFR-01-3130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3130 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 91% ...

  8. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-0599 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0599 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 65% ...

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-3056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3056 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-38 86% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-71 48% ...

  13. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  15. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  16. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  17. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  18. NCBI nr-aa BLAST: CBRC-TTRU-01-0899 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0899 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  19. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  20. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-102 62% ...

  2. NCBI nr-aa BLAST: CBRC-PVAM-01-1222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1222 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 92% ...

  3. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  4. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-1975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1975 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 0.0 78% ...

  7. NCBI nr-aa BLAST: CBRC-VPAC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0140 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 4e-68 57% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1732 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-178 83% ...

  9. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  10. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  11. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-1272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1272 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-119 88% ...

  14. NCBI nr-aa BLAST: CBRC-OGAR-01-0872 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0872 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-171 89% ...

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-2271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2271 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-144 78% ...

  16. NCBI nr-aa BLAST: CBRC-PABE-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0060 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  17. NCBI nr-aa BLAST: CBRC-HSAP-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0078 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  18. NCBI nr-aa BLAST: CBRC-MMUR-01-1296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1296 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  19. NCBI nr-aa BLAST: CBRC-RMAC-04-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0054 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  1. NCBI nr-aa BLAST: CBRC-TSYR-01-1188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1188 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-145 89% ...

  2. NCBI nr-aa BLAST: CBRC-CFAM-12-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0019 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 0.0 99% ...

  3. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  4. NCBI nr-aa BLAST: CBRC-DRER-16-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-16-0068 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-119 65% ...

  5. NCBI nr-aa BLAST: CBRC-TBEL-01-2041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2041 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-123 91% ...

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0081 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-172 90% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  8. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  9. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  10. NCBI nr-aa BLAST: CBRC-LAFR-01-3535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3535 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-109 74% ...

  11. NCBI nr-aa BLAST: CBRC-PTRO-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0072 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [ lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  12. NCBI nr-aa BLAST: CBRC-MLUC-01-0701 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0701 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-157 74% ...

  13. NCBI nr-aa BLAST: CBRC-FCAT-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1055 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 4e-61 46% ...

  14. NCBI nr-aa BLAST: CBRC-PVAM-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1133 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 2e-61 92% ...

  15. NCBI nr-aa BLAST: CBRC-LAFR-01-3197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-149 81% ...

  16. NCBI nr-aa BLAST: CBRC-DNOV-01-3181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3181 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-153 94% ...

  17. NCBI nr-aa BLAST: CBRC-MMUR-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0421 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 7e-75 50% ...

  18. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-64 44% ...

  19. NCBI nr-aa BLAST: CBRC-TSYR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0145 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 4e-82 61% ...

  20. NCBI nr-aa BLAST: CBRC-PCAP-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1445 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-164 87% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1165 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-76 41% ...

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1411 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-31 37% ...

  3. NCBI nr-aa BLAST: CBRC-PHAM-01-0220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0220 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-153 89% ...

  4. NCBI nr-aa BLAST: CBRC-MDOM-08-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0128 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 8e-62 45% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-1134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1134 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-137 77% ...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-1851 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1851 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-147 73% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-1082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1082 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 88% ...

  8. NCBI nr-aa BLAST: CBRC-STRI-01-2923 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2923 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-157 86% ...

  9. NCBI nr-aa BLAST: CBRC-OGAR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1050 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 93% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-0681 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0681 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-134 91% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-138 67% ...

  12. Inhibiting Effects of S.acus Linnaeus Extracts on GLT-82 Tumor Cell Lines

    Institute of Scientific and Technical Information of China (English)


    Hailong S.acus Linnaeus was chosen as the experimental material in the experiments and changes of cell morphology, forming rate of clone and changes of division index were conducted to identify the inhibiting effects of Hailong extract on human tumor cell lines (GLT-82). Four days after medication, most of the cells changed their normal morphology of tumor cells and became round, broken and even broke into pieces. The inhibiting rates could reach 75.1% on the fourth day. The division index reduced strongly and the clone could not form or the forming rate was very low. With the extract concentration increasing and the time prolonging, the inhibiting effect increased. These results indicate that Hailong has striking anti-tumor effects and will have a perfect future in the fields of treatment and prevention of cancer.

  13. An outbreak of Portuguese man-of-war (Physalia physalis - Linnaeus, 1758 envenoming in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Vidal Haddad Junior


    Full Text Available Introduction Portuguese man-of-war, Physalia physalis (Linnaeus, 1758, are cnidarians capable of discharging intracellular organelles filled with venom, resulting in severe envenomation in humans. Methods We report the clinical and therapeutic aspects of 331 accidents involving Portuguese man-of-war in an outbreak on the coast of the State of São Paulo, Brazil. Results The clinical manifestations of envenomation were rare and mild and mostly local, systemic reactions; there was a low rate of late complications. Conclusions The consequences of envenomation were of moderate severity, and first aid measures were effective in controlling the pain. Outbreaks of accidents involving Portuguese man-of-war occur periodically in the area without a clear explanation.


    Institute of Scientific and Technical Information of China (English)

    ShefaliSrivastava; Dmkar


    Influence of temperature on certain biological attributes of an aphidophagous ladybeetle, Coccinella septempunctata Linnaeus, feeding on mustard aphid, Lipaphis erysimi (Kaltenbach), at five different temperatures, viz. 20, 25, 27, 30 and 35℃ was investigated. Its developmental period was shortest (11.7±0.09days) at 35℃ and longest (20.6±0.35 days) at 20℃. Developmental rate increased with increase in temperature. Hatching percent, larval survival, adult emergence and growth index were maximum at 30℃ and minimumat 20℃. Oviposition period and fecundity were highest at 30℃ and lowest at 20℃. A positive linear relationship exists between temperature and developmental rate and negative correlation between the duration of immature life stages and temperature. The proportion of developmental period allocated to each immature stage was found to be similar at each temperature regime. Thus, 30℃ was found as the most suitable for C. septempunctata amongst the five temperatures tested.

  15. The complete mitogenome of blue swimming crab Portunus pelagicus Linnaeus, 1766 (Crustacea: Decapoda: Portunidae). (United States)

    Meng, Xian-Liang; Jia, Fu-Long; Liu, Ping; Li, Jian


    The complete mitochondrial genome (mitogenome) of the blue swimming crab Portunus pelagicus Linnaeus, 1766 (Crustacea: Decapoda: Portunidae) was determined in this study. The full length mitogenome is 16 157 bp in size, and consists of 13 protein-coding genes, 22 tRNA genes, two rRNA genes, and a non-coding control region, with the base composition of 33.70% for A, 18.99% for C, 12.22% for G, and 35.09% for T. The gene order of P. pelagicus mainly retains as the pancrustacean ground pattern, except for a single translocation of tRNA(His) gene. The mitogenome data provide a basis for further studies on population genetics and phylogenetics. PMID:26171873

  16. Distribution of blue swimming crab (Portunus pelagicus Linnaeus, 1758 in Trang Province

    Directory of Open Access Journals (Sweden)

    Buncha Somboonsuke


    Full Text Available The fishery of the blue swimming crab (Portunus pelagicus Linnaeus, 1758 is very important to the economy of small-scale fishermen. Greater knowledge about its distribution could lead to more efficient management. This study was conducted in Trang Province from October 2006 to August 2007 using collapsible crab traps. To reveal the spatial distribution of the species, we analyzed the data using geostatistical methods. The standard interpolate procedure was applied to model the crab distribution. There were clear spatial distribution differences among the small crabs, large crabs and ovigerous females in study area. The mapping showed that small crabs (carapace width 10 cm were farther offshore. Ovigerous females peaked in abundance during 2 periods: March – April and August – September. This information can be used to support decision making concerning the designation of fishing zones and the optimization of the blue swimming crab fishery in the study area.

  17. Solid state characterization of {alpha}-chitin from Vanessa cardui Linnaeus wings

    Energy Technology Data Exchange (ETDEWEB)

    Schiffman, Jessica D. [Department of Materials Science and Engineering, Drexel University, Philadelphia, PA (United States); Schauer, Caroline L., E-mail: [Department of Materials Science and Engineering, Drexel University, Philadelphia, PA (United States)


    Material properties of the painted lady butterfly, Vanessa cardui Linnaeus were investigated using typical material science techniques. The examined butterflies were raised and hatched from the larvae stage and their chemical and crystalline structure evaluated and compared to that of crab shell ({alpha}-chitin) and squid pens from Notodarus sloanii and Loligo pealei ({beta}-chitin). Fourier transmission infrared spectroscopy (FTIR) and X-ray diffraction (XRD) revealed that the painted lady butterflies are composed of {alpha}-chitin. Additionally, macro- and microstructure characterization of the chitins was conducted utilizing digital photography and field emission scanning electron microscopy (FESEM). This work demonstrates that common characterization techniques combined with simple sample preparation of biological materials can yield successful material characterization, which could aide the fabrication of biomimetic materials.

  18. Cardiac markers: profile in rats experimentally infected with Toxocara canis Marcadores cardíacos: perfil em ratos infectados experimentalmente com Toxocara canis

    Directory of Open Access Journals (Sweden)

    Cecília Braga Laposy


    Full Text Available The aim of this study was to evaluate the profile of the enzymes creatine kinase (CK, creatine kinase MB (CK-MB and lactate dehydrogenase (LDH in Wistar rats infected with 250 (GI, n = 24 or 1000 (GII, n = 24 Toxocara canis eggs. Animals were evaluated on days 7, 15, 30, 60, 120 and 180 post-infection (DPI. Only the GI rats showed an increase in CK and CK-MB, at 15 and 30 DPI, respectively. Anti-Toxocara spp. antibodies were detected by ELISA in infected animals. Despite of the presence of eosinophilic infiltrate in the heart of three infected animals, none larva was recovered from the organ neither by acid digestion nor by Baermann procedure. Eosinophilia was observed in both groups but there was no significant difference in the eosinophil counts between GI and GII (p = 0.2239. It is possible to consider that cardiac lesion is an eventual finding in murine model for toxocariasis.O objetivo do presente estudo foi avaliar o perfil das enzimas creatinoquinase (CK, creatinoquinase-MB (CK-MB e lactato desidrogenase (LDH em ratos Wistar infectados com 250 (GI, n = 24 ou 1000 (GII, n = 24 ovos de Toxocara canis. Os animais foram avaliados nos dias 7, 15, 30, 60, 120 e 180 pós-infecção (DPI. Observou-se que apenas os animais do GI apresentaram aumento da atividade de CK e CK-MB aos 15 e 30 DPI, respectivamente. Anticorpos anti-T. canis foram detectados por ELISA nos animais infectados. Apesar da presença de infiltrado eosinofílico em três animais infectados, nenhuma larva foi recuperada do coração pela digestão ácida ou pela técnica de Baermann. Eosinofilia foi observada em todos os momentos em GI e GII, sem diferença significativa entre os grupos (p = 0,2239. Pode-se considerar que as lesões cardíacas foram um achado eventual no modelo murino para toxocaríase.

  19. Antibiotic resistence of Aeromonas hydrophila isolated from Piaractus mesopotamicus (Holmberg, 1887) and Oreochromis niloticus (Linnaeus, 1758) Resistência de Aeromonas hydrophila isolada de Piaractus mesopotamicus (Holmberg, 1887) e Oreochromis niloticus (Linnaeus, 1758) a antibióticos


    Andréa Belém-Costa; José Eurico Possebon Cyrino


    One of the most important problems involving treatments with antibiotics against Aeromonas hydrophila isolated from fishes is that antibiotic resistance develops readily. The antimicrobial activity of chemotherapeutants in isolates from pacu Piaractus mesopotamicus (Holmberg, 1887) and tilapia Oreochromis niloticus (Linnaeus, 1758) was tested by the Kirby-Bauer disk method, over Mueller-Hinton surface agar previously inoculated with 100 µL of bacterial suspensions. After regular incubation, i...

  20. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India

    Institute of Scientific and Technical Information of China (English)

    Sushma Chhabra; Sanjeev Kumar Uppal; Lachhman Das Singla


    To evaluate clinical and hematological aspects of dogs naturally infected withHepatozoon canis (H. canis) presented at the Small Animal Clinics of Guru Angad Dev Veterinary and Animal Sciences University, Ludhiana. Methods: Blood films of 34 naturally infected dogs were examined for haematological alterations and parasitaemia. Signalment and clinical signs were recorded from the animals. Clinical histories were filled out during the consultation. Results: Of the 34 positive dogs by Giemsa stained peripheral blood films, 88.23% presented parasitaemia by H. canis only, while 11.77% had the combination ofH. canis, Babesia sp. and Ehrlichia sp. Young male dogs less than one-year-old, of non-descript breed, were the most commonly affected. And 26.47% were presented with anorexia/inappetence as the only clinical symptom. Other clinical symptoms were mild to moderate fever, pale mucosae and lethargy; a few were also showing the signs of vomiting and diarrhoea. Haematological alterations showed mainly normochromic-normocytic anaemia, leukocytosis and neutrophilia. Conclusions: The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration.

  1. Fecal shedding of Toxocara canis and other parasites in foxes and coyotes on Prince Edward Island, Canada. (United States)

    Wapenaar, Wendela; Barkema, Herman W; O'Handley, Ryan


    Knowledge of parasites shed by wild canids can assist in recognizing risk to human and domestic animal health. Our aim was to estimate the prevalence of patent infections with Toxocara canis and other parasites in foxes (Vulpes vulpes) and coyotes (Canis latrans) in Prince Edward Island, Canada. Identification of parasite species was based on microscopic examination of feces, with the use of a sucrose fecal flotation method. Sample collection was performed in winter on carcasses of 271 and 185 hunted or trapped foxes and coyotes, respectively. One or more parasite species were observed in 242 (89%) foxes and 128 (69%) coyotes. Toxocara canis, Uncinaria stenocephala, Capillaria spp., Mesocestoides, Taenidd spp., Alaria spp., Cryptocotyle lingua, Sarcocystis spp., Neospora caninum-like coccidia, and other coccidia were identified. A third of juvenile foxes were shedding T. canis and had a high prevalence of Capillaria spp., especially in juvenile foxes (69%). Taenidd eggs, Alaria spp. and Sarcocystis spp. were more common in coyotes (24, 18, and 9%, respectively) than foxes (8, 11, and 1%, respectively). Despite the limitations of fecal flotation to identify parasite species, the high prevalence of T. canis warrants the attention of public health professionals. PMID:23568915

  2. Contribution to the butterfly species of Belasitsa Mountain (SW Bulgaria and second record of Gonepteryx cleopatra (Linnaeus, 1767 from Bulgaria

    Directory of Open Access Journals (Sweden)

    Liuben Domozetski


    Full Text Available At present, according to the literature data for Belasitsa Mountain are published 139 butterfly species. This article contributes to the knowleage of the butterfly fauna of the mountain by adding five more species. With this supplement the number of the butterflies’ fauna of Belasitsa Mountain increase to 144 species. This article also presents information about the second record of Gonepteryx cleopatra (Linnaeus, 1767 in Bulgaria.

  3. Contribution to the butterfly species of Belasitsa Mountain (SW Bulgaria) and second record of Gonepteryx cleopatra (Linnaeus, 1767) from Bulgaria


    Liuben Domozetski


    At present, according to the literature data for Belasitsa Mountain are published 139 butterfly species. This article contributes to the knowleage of the butterfly fauna of the mountain by adding five more species. With this supplement the number of the butterflies’ fauna of Belasitsa Mountain increase to 144 species. This article also presents information about the second record of Gonepteryx cleopatra (Linnaeus, 1767) in Bulgaria.

  4. Spatial distribution and esterase activity in populations of Aedes (Stegomyia) aegypti (Linnaeus) (Diptera: Culicidae) resistant to temephos


    Wanessa Porto Tito Gambarra; Walter Fabrício Silva Martins; Maurício Lilioso de Lucena Filho; Ingredy Meneses Cavalcanti de Albuquerque; Otávia Karla dos Santos Apolinário; Eduardo Barbosa Beserra


    INTRODUCTION: The need for studies that describe the resistance patterns in populations of Aedes aegypti (Linnaeus) in function of their region of origin justified this research, which aimed to characterize the resistance to temephos and to obtain information on esterase activity in populations of Aedes aegypti collected in municipalities of the State of Paraíba. METHODS: Resistance to temephos was evaluated and characterized from the diagnostic dose of 0.352mg i.a...

  5. Infracommunities of intestinal helminths of the Red Fox Vulpes vulpes (Linnaeus, 1758) from Italian Alps


    Anna Rita Di Cerbo; M.T. Manfredi; F. Pirinesi; K. Trevisiol; Bregoli, M; N. Ferro Milone; R. Orusa; C. Banchi


    Vulpes vulpes (Linnaeus, 1758) is one of the most common carnivore in Italy and its spread includes almost the whole national territory. The species shows an high ecological plasticity and a variable diet composition connected in part to human sources. This high adaptability permits the red foxes to colonize different habitats like the suburbs of large cities as well as the small villages located in mountain areas. On the other hand, the tourism pressure seems to assume a...

  6. Upstream migration, reproduction and fishery of sea lamprey (Petromyzon marinus Linnaeus, 1758) in the River Ulla (NW Spain)


    Sergio Silva; Sandra Barca; María José Servia


    After a juvenile haematophagous stage developed mainly at sea, the sea lamprey Petromyzon marinus Linnaeus, 1758 stop feeding and return to the river to spawn. One of the main pressures in this stage is the presence of obstacles that reduce the accessible habitat, the mobility of individuals within this section and the energy resources available for gonad development and spawning. In addition, in the River Ulla, adults are targeted in a commercial fishery, using fyke-nets in the upper estuary...

  7. Prevalencia y factores que favorecen la presentación de toxocara canis y ancylostoma caninum en canes de compañía (Prevalence and factors that favor of presentation of toxocara canis and ancylostoma caninum in companion dogs.

    Directory of Open Access Journals (Sweden)

    Castillo Cuenca. Julio César


    Full Text Available RESUMENEl presente trabajo tiene como objetivo determinar la prevalencia de Toxocara canis y Ancylostoma caninum y algunos factores que pudieran favorecer una mayor tasa de infestación por estos nematodos zoonóticosen canes de compañía en los consejos populares Universidad y Camilo Cienfuegos.SUMMARYThe present research aims at determining Toxocara canis and Ancylostoma caninum prevalence and some factors that may favor higher values of infestation in companion dogs from these zoonotic nemathods in the University and Camilo Cienfuegos county.

  8. Ontogenia do fruto em desenvolvimento de Alternanthera tenella Colla e Amaranthus blitum Linnaeus (Amaranthaceae Ontogeny of fruits of Alternanthera tenella Colla and Amaranthus blitum Linnaeus (Amaranthaceae

    Directory of Open Access Journals (Sweden)

    Vanessa de Carvalho Harthman


    Full Text Available Alternanthera tenella Colla e Amaranthus blitum Linnaeus são espécies invasoras que ocorrem em culturas e terrenos baldios na região de Maringá, Paraná. O trabalho teve por objetivo a análise morfoanatômica dos frutos em desenvolvimento e estruturas não pericárpicas dessas duas espécies, com a finalidade de contribuir com informações estruturais para identificação das espécies, classificação dos frutos e investigações ecológicas. Flores e frutos foram coletados no campus da Universidade Estadual de Maringá, fixados em Glutaraldeído, secionados em micrótomo de rotação e corados com a azul de Toluidina. As bractéolas e perigônio são persistentes nos frutos e têm estrutura diferente nas duas espécies. O aquênio de Alternanthera tenella mantém o mesmo número de estratos celulares que o ovário, que sofrem colapso na fase madura, exceto o mesocarpo interno que se mantém com espessamento parietal em U e cristais. O utrículo de Amaranthus blitum é semelhante ao ovário em número de camadas celulares e apresenta aerênquima quando maduro. As sementes maduras são exotestais, com mesotesta e endotesta colapsadas, e embrião curvo. Nesse estudo, foram registrados alguns caracteres estruturais dos perigônios e dos frutos que são potencialmente significativos para caracterização e separação das espécies, ao contrário das sementes que são muito semelhantes.Alternanthera tenella Colla and Amaranthus blitum Linnaeus are weeds that occur in crops and uncultivated areas in the Maringá region of Paraná. In this study, a morphoanatomical analysis of fruit development and the pericarp of A. tenella and A. blitum was made in order to contribute structural information for species identification, fruit classification, and ecological investigations. Flowers and fruits were collected at the campus of the State University of Maringá, Paraná, fixed in glutaraldehyde, sectioned with a rotary microtome and stained with

  9. Reprodução de Nycticorax nycticorax (Linnaeus no litoral de Santa Catarina, Brasil Reproduction of the Nycticorax nycticorax (Linnaeus in the Santa Catarina's coast, Brazil

    Directory of Open Access Journals (Sweden)

    Joaquim O. Branco


    Full Text Available O savacu Nycticorax nycticorax (Linnaeus, 1758 é uma espécie de hábitos crepusculares e noturnos, com ampla distribuição geográfica. Sua biologia reprodutiva tem sido intensivamente estudada nos países de ocorrência, entretanto, no Brasil, é comumente citada nos levantamentos de ornitólogos, mas não existem informações disponíveis sobre seu ciclo de vida. Esse trabalho objetiva contribuir para o conhecimento da biologia reprodutiva dessa espécie no litoral catarinense. As amostragens foram realizadas nos anos de 2000 a 2002 na Ilha dos Pássaros e de 2002 na Ilha dos Lobos, Santa Catarina. As maiores abundâncias de exemplares e ninhos com ovos ocorreram em outubro, sendo que o comprimento médio dos ovos variou entre 5,02 ± 0,23 a 5,07 ± 0,21 cm e o volume 31,71 ± 2,64 a 35,92 ± 3,47 cm³ e as maiores freqüências de filhotes em novembro, culminando o abandono da colônia em meados de janeiro. Foram identificados sete itens nos regurgitos dos filhotes, sendo que os peixes marinhos representaram 44,4% da massa total. O principal predador na colônia foi o urubu-comum, que atuou sobre os ovos no início da temporada e os filhotes no final.The black-crowned night heron N. nycticorax (Linnaeus, 1758 is a aquatic bird with twilight and night habits, with wide geographical distribution. His reproductive biology has been studied intensively at the occurrence countries, however, in Brazil, it is mentioned commonly in the ornithologists' risings, but available information don't exist on his life cycle. This work aims to contribute for the knowledge of the reproductive biology of that species in the Santa Catarina coast. The samplings were accomplished in the years from 2000 to 2002 in the Ilha dos Pássaros and of 2002 in the Ilha dos Lobos, Santa Catarina. The largest abundances of individuals and nests with eggs happened in October, and the medium length of the eggs varied between 5.02 ± 0.23 to 5.07 ± 0.21 cm and the volume 31

  10. Genetic blueprint of the zoonotic pathogen Toxocara canis

    DEFF Research Database (Denmark)

    Zhu, Xing-Quan; Korhonen, Pasi K.; Cai, Huimin; Young, Neil D.; Nejsum, Peter; von Samson-Himmelstjerna, Georg; Boag, Peter R.; Tan, Patrick; Li, Qiye; Min, Jiumeng; Yang, Yulan; Wang, Xiuhua; Fang, Xiaodong; Hall, Ross S.; Hofmann, Andreas; Sternberg, Paul W.; Jex, Aaron R.; Gasser, Robin B.


    Toxocara canis is a zoonotic parasite of major socioeconomic importance worldwide. In humans, this nematode causes disease (toxocariasis) mainly in the under-privileged communities in developed and developing countries. Although relatively well studied from clinical and epidemiological perspectives...... content of 13.5% and encodes at least 18,596 protein-coding genes. We study transcription in a larval, as well as adult female and male stages, characterize the parasite's gene-silencing machinery, explore molecules involved in development or host-parasite interactions and predict intervention targets...

  11. Presence of Leishmania and Brucella Species in the Golden Jackal Canis aureus in Serbia


    Duško Ćirović; Dimosthenis Chochlakis; Snežana Tomanović; Ratko Sukara; Aleksandra Penezić; Yannis Tselentis; Anna Psaroulaki


    The golden jackal Canis aureus occurs in south-eastern Europe, Asia, the Middle East, the Caucasus, and Africa. In Serbia, jackals neared extinction; however, during the last 30 years, the species started to spread quickly and to increase in number. Few studies in the past have revealed their potential role as carriers of zoonotic diseases. Animal samples were collected over a three-year period (01/2010–02/2013) from 12 sites all over Serbia. Of the tissue samples collected, spleen was ch...

  12. Population Genetic Structure of Golden Jackal, Canis aureus in Gujarat, India


    Tripti Negi; Y.V. Jhala


    Genetic diversity of Golden Jackal, Canis aureus was estimated to understand the role of Rann of Kachchh in their movement between Kachchh region and the mainland of Gujarat, a western state in India. A total of 30 samples were collected and genotyped with 10 polymorphic microsatellite loci. The analysis was done within and between the Golden Jackal populations in Bhal and Kachchh region of the state. Altogether, 78 distinct alleles were found with mean allelic number of 8.8 (±2.33)....

  13. Serodetection of Ehrlichia canis amongst dogs in central Namibia


    Rutendo Manyarara; Ulf Tubbesing; Minty Soni; Noden, Bruce H.


    Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories). The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to...

  14. Predação oportunista de Artibeus planirostris (Spix, 1823 e Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae por marsupiais e anuro na APA do Rio Curiaú, Amapá, Brasil Opportunistic predation of Artibeus planirostris (Spix, 1823 and Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae by marsupials and anuran in the APA do Rio Curiaú, Amapá State, Brazil

    Directory of Open Access Journals (Sweden)

    Isai Jorge de Castro


    Full Text Available Durante estudos com morcegos em floresta de várzea na APA do Rio Curiaú, Amapá, Brasil, observamos três casos de predações oportunistas de morcegos frugívoros capturados em redes de neblina. Duas destas predações ocorreram por marsupiais e uma por anuro. Artibeus planirostris (Spix, 1823 (Chiroptera, Phyllostomidae foi predado por Didelphis marsupialis Linnaeus, 1758 e Philander opossum (Linnaeus, 1758 (Didelphimorphia, Didelphidae. Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae foi predado por Leptodactylus pentadactylus (Laurenti, 1768 (Anura, Leptodactylidae. A vocalização dos morcegos provavelmente atraiu os marsupiais para a rede, onde estes os predaram aproveitando que estavam presos. Este tipo de interação pode ocorrer naturalmente, no entanto, com maior dificuldade de registro.We observed three occasional predations of bats captured in mist nets by marsupials and a frog during studies in a várzea forest in the Amapá state. Artibeus planirostris (Spix, 1823 (Chiroptera, Phyllostomidae was preyed upon by Didelphis marsupialis Linnaeus, 1758 and Philander opossum (Linnaeus, 1758 (Didelphimorphia, Didelphidae. Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae was preyed on by Leptodactylus pentadactylus (Laurenti, 1768 (Anura, Leptodactylidae. The bats vocalizations probably attracted the marsupials and a frog to the mist nets where they preyed. This interaction form can occur naturally, however, are more difficult to observed.

  15. The Dog Mite, Demodex canis: Prevalence, Fungal Co-Infection, Reactions to Light, and Hair Follicle Apoptosis


    Tsai, Yu-Jen; Chung, Wen-Cheng; Wang, Lian-Chen; Ju, Yu-Ten; Hong, Chin-Lin; Tsai, Yu-Yang; Li, Yi-Hung; Wu, Ying-Ling


    Infection rate, reaction to light, and hair follicle apoptosis are examined in the dogmite, Demodex canis Leydig (Prostigmata: Demodicidae), in dogs from the northern area of Taiwan. An analysis of relevant samples revealed 7.2% (73/1013) prevalence of D. canis infection. Infection during the investigation peaked each winter, with an average prevalence of 12.5% (32/255). The infection rates significantly varied in accordance with month, sex, age, and breed (p < 0.05). Most of the lesions were...

  16. Entwicklung und Evaluierung von Real-time PCR-Verfahren zum Nachweis von Ehrlichia canis und Anaplasma phagocytophilum (Anaplasmataceae)


    Messerer, Sandra


    In der vorliegenden Arbeit wurden Real-time PCR-basierte Nachweisverfahren für E. canis und A. phagocytophilum entwickelt, validiert und im Anschluss für die Untersuchung von Patientenproben eingesetzt. Für E. canis wurden für zwei Tests Primer und Sonden des Typs „Molecular Beacon“ konstruiert, die auf unterschiedliche Zielgene gerichtet waren, die Reaktionsbedingungen optimiert und die Leistungsfähigkeit beider Tests verglichen. Die PCR EC-16S hatte hierbei die 16S rDNA als Zielgen, während...


    Directory of Open Access Journals (Sweden)



    Full Text Available Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubated at 37 °C in 5% CO2 tension for 48 hours. In the 2 mg/mL concentration, four phenazines, lapachol and three of its derivatives presented a larvicide/larvistatic activity of 100%. Then, the minimum larvicide/larvistatic concentration (MLC test was conducted. The compounds that presented the best results were nor-lapachol (MLC, 1 mg/mL, lapachol (MLC 0.5 mg/mL, β-lapachone, and β-C-allyl-lawsone (MLC, 0.25 mg/mL. The larvae exposed to the compounds, at best MLC with 100% in vitro activity larvicide, were inoculated into healthy BALB/c mice and were not capable of causing infection, confirming the larvicide potential in vitro of these compounds.

  18. Ecological changes in Coyotes (Canis latrans in response to the ice age megafaunal extinctions.

    Directory of Open Access Journals (Sweden)

    Julie A Meachen

    Full Text Available Coyotes (Canis latrans are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these changes. We examined the mandibles of three coyote populations: Pleistocene Rancho La Brean (13-29 Ka, earliest Holocene Rancho La Brean (8-10 Ka, and Recent from North America, using 2D geometric morphometrics to determine the morphological differences among them. Our results show that these three populations were morphologically distinct. The Pleistocene coyotes had an overall robust mandible with an increased shearing arcade and a decreased grinding arcade, adapted for carnivory and killing larger prey; whereas the modern populations show a gracile morphology with a tendency toward omnivory or grinding. The earliest Holocene populations are intermediate in morphology and smallest in size. These findings indicate that a niche shift occurred in coyotes at the Pleistocene/Holocene boundary - from a hunter of large prey to a small prey/more omnivorous animal. Species interactions between Canis were the most likely cause of this transition. This study shows that the Pleistocene extinction event affected species that did not go extinct as well as those that did.

  19. Ecological changes in Coyotes (Canis latrans) in response to the ice age megafaunal extinctions. (United States)

    Meachen, Julie A; Janowicz, Adrianna C; Avery, Jori E; Sadleir, Rudyard W


    Coyotes (Canis latrans) are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these changes. We examined the mandibles of three coyote populations: Pleistocene Rancho La Brean (13-29 Ka), earliest Holocene Rancho La Brean (8-10 Ka), and Recent from North America, using 2D geometric morphometrics to determine the morphological differences among them. Our results show that these three populations were morphologically distinct. The Pleistocene coyotes had an overall robust mandible with an increased shearing arcade and a decreased grinding arcade, adapted for carnivory and killing larger prey; whereas the modern populations show a gracile morphology with a tendency toward omnivory or grinding. The earliest Holocene populations are intermediate in morphology and smallest in size. These findings indicate that a niche shift occurred in coyotes at the Pleistocene/Holocene boundary - from a hunter of large prey to a small prey/more omnivorous animal. Species interactions between Canis were the most likely cause of this transition. This study shows that the Pleistocene extinction event affected species that did not go extinct as well as those that did. PMID:25551387

  20. Case report of canine co-infection with Leishmania infantum and Ehrlichia canis

    Directory of Open Access Journals (Sweden)

    Stefanovska Jovana


    Full Text Available Canine leishmaniasis (CanL due to Leishmania infantum and canine monocytic ehrilichiosis (CME due to Ehrlichia canis are common diseases with zoonotic potential in the Mediterranean area. Their prevalence in R. Macedonia as a neighboring Mediterranean county is expected. In both diseases similar clinical symptoms can be manifested in dogs such as: lethargy, anorexia, weight loss, epistaxis, fever, pale mucous membranes, enlarged lymph nodes, splenomegaly, ocular signs. This case report present an atypical case of 11 year old female Samoyed with starting single clinical symptom epistaxys. Initial diagnostic procedures revealed the presence only of CanL, which was diagnosed using indirect immunofluorescence method and ELISA. First laboratory findings showed normal hematological and renal profiles. Dog was put on a treatment with Allopurinol (20mg/kg, p/o for at least 9 months. Termination of the therapy after 6 months brought a numerous clinical symptoms involving weakness, dehydration, pale mucous membranes lost pupilar reflex, uremic breath and biochemical parameters revealed a renal failure. Using a commercial ELISA kit Ehrlichia canis as a co infection was diagnosed. Most probably the second infectious agent was induced in the past 6 months, causing more severe pathological effects than CanL infection alone.

  1. Detection of Ehrlichia canis in domestic cats in the central-western region of Brazil

    Directory of Open Access Journals (Sweden)

    Ísis Assis Braga


    Full Text Available Ehrlichiosis is a worldwide distributed disease caused by different bacteria of the Ehrlichia genus that are transmitted by arthropod vectors. Its occurrence in dogs is considered endemic in several regions of Brazil. Regarding cats, however, few studies have been done and, consequently, there is not enough data available. In order to detect Ehrlichia spp. in cats from the central-western region of Brazil, blood and serum samples were collected from a regional population of 212 individuals originated from the cities of Cuiabá and Várzea Grande. These animals were tested by the Immunofluorescence Assay (IFA and the Polymerase Chain Reaction (PCR designed to amplify a 409 bp fragment of the dsb gene. The results obtained show that 88 (41.5% cats were seropositive by IFA and 20 (9.4% cats were positive by PCR. The partial DNA sequence obtained from PCR products yielded twenty samples that were found to match perfectly the Ehrlichia canis sequences deposited on GenBank. The natural transmission of Ehrlichia in cats has not been fully established. Furthermore, tick infestation was not observed in the evaluated cats and was not observed any association between age, gender and positivity of cats in both tests. The present study reports the first serological and molecular detection of E. canis in domestic cats located in the endemic area previously mentioned.

  2. Colorimetric Detection of Ehrlichia Canis via Nucleic Acid Hybridization in Gold Nano-Colloids

    Directory of Open Access Journals (Sweden)

    Ajima Muangchuen


    Full Text Available Canine monocytic ehrlichiosis (CME is a major thick-bone disease of dog caused by Ehrlichia canis. Detection of this causal agent outside the laboratory using conventional methods is not effective enough. Thus an assay for E. canis detection based on the p30 outer membrane protein gene was developed. It was based on the p30 gene amplification using loop-mediated isothermal DNA amplification (LAMP. The primer set specific to six areas within the target gene were designed and tested for their sensitivity and specificity. Detection of DNA signals was based on modulation of gold nanoparticles’ surface properties and performing DNA/DNA hybridization using an oligonucleotide probe. Presence of target DNA affected the gold colloid nanoparticles in terms of particle aggregation with a plasmonic color change of the gold colloids from ruby red to purple, visible by the naked eye. All the assay steps were completed within 90 min including DNA extraction without relying on standard laboratory facilities. This method was very specific to target bacteria. Its sensitivity with probe hybridization was sufficient to detect 50 copies of target DNA. This method should provide an alternative choice for point of care control and management of the disease.

  3. The genome of obligately intracellular Ehrlichia canis revealsthemes of complex membrane structure and immune evasion strategies

    Energy Technology Data Exchange (ETDEWEB)

    Mavromatis, K.; Kuyler Doyle, C.; Lykidis, A.; Ivanova, N.; Francino, P.; Chain, P.; Shin, M.; Malfatti, S.; Larimer, F.; Copeland,A.; Detter, J.C.; Land, M.; Richardson, P.M.; Yu, X.J.; Walker, D.H.; McBride, J.W.; Kyrpides, N.C.


    Ehrlichia canis, a small obligately intracellular, tick-transmitted, gram-negative, a-proteobacterium is the primary etiologic agent of globally distributed canine monocytic ehrlichiosis. Complete genome sequencing revealed that the E. canis genome consists of a single circular chromosome of 1,315,030 bp predicted to encode 925 proteins, 40 stable RNA species, and 17 putative pseudogenes, and a substantial proportion of non-coding sequence (27 percent). Interesting genome features include a large set of proteins with transmembrane helices and/or signal sequences, and a unique serine-threonine bias associated with the potential for O-glycosylation that was prominent in proteins associated with pathogen-host interactions. Furthermore, two paralogous protein families associated with immune evasion were identified, one of which contains poly G:C tracts, suggesting that they may play a role in phase variation and facilitation of persistent infections. Proteins associated with pathogen-host interactions were identified including a small group of proteins (12) with tandem repeats and another with eukaryotic-like ankyrin domains (7).

  4. Parasite species of the endangered Iberian wolf (Canis lupus signatus) and a sympatric widespread carnivore. (United States)

    Figueiredo, Ana; Oliveira, Lucia; Madeira de Carvalho, Luís; Fonseca, Carlos; Torres, Rita Tinoco


    Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus) and the widespread red fox (Vulpes vulpes), in central Portugal. From November 2014 to July 2015, fresh fecal samples from both species were collected monthly in several transects distributed throughout the study area. All samples were submitted to several coprological techniques. In total, 6 helminth parasites (Crenosoma vulpis, Angiostrongylus vasorum, Toxocara canis, Trichuris vulpis, Ancylostomatidae, Toxascaris leonina), and a protozoa (Balantidium coli) were identified based on size and morphology. The red fox was infected by seven different parasites while the Iberian wolf was infected by four. All parasites present in wolf were also present in the red fox. C. vulpis had the higher prevalence in red fox, while Ancylostomatidae were the most prevalent parasites in wolf. To our knowledge, this is the first study in this isolated subpopulation of the Iberian wolf. Our results show that both carnivores carry parasites that are of concern as they are pathogenic to humans and other wild and domestic animals. We suggest that surveillance programs must also include monitoring protocols of wildlife; particularly endangered species. PMID:27358768

  5. Parasite species of the endangered Iberian wolf (Canis lupus signatus and a sympatric widespread carnivore

    Directory of Open Access Journals (Sweden)

    Ana Figueiredo


    Full Text Available Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus and the widespread red fox (Vulpes vulpes, in central Portugal. From November 2014 to July 2015, fresh fecal samples from both species were collected monthly in several transects distributed throughout the study area. All samples were submitted to several coprological techniques. In total, 6 helminth parasites (Crenosoma vulpis, Angiostrongylus vasorum, Toxocara canis, Trichuris vulpis, Ancylostomatidae, Toxascaris leonina, and a protozoa (Balantidium coli were identified based on size and morphology. The red fox was infected by seven different parasites while the Iberian wolf was infected by four. All parasites present in wolf were also present in the red fox. C. vulpis had the higher prevalence in red fox, while Ancylostomatidae were the most prevalent parasites in wolf. To our knowledge, this is the first study in this isolated subpopulation of the Iberian wolf. Our results show that both carnivores carry parasites that are of concern as they are pathogenic to humans and other wild and domestic animals. We suggest that surveillance programs must also include monitoring protocols of wildlife; particularly endangered species.

  6. Multiorgan fungal infection caused by Microsporum canis in a green iguana (Iguana iguana). (United States)

    Chung, Tae-Ho; Kim, Eun-Ju; Choi, Ul Soo


    Multiple organ invasion by keratinophilic fungi in the green iguana (Iguana iguana) has not been previously reported. In this case, a 1-yr-old female green iguana presented with a nodular, darkly discolored skin lesion surrounded by necrosis in the right ventral abdominal region. A cytologic examination of the fine needle aspiration of the lesion revealed an exuberant proliferation of fibroblasts, macrophages, and multinucleated cells along with frequent filamentous structures consistent with hyphal elements. The necropsy revealed diffuse infiltration of the liver, lung, and cardiac apex with white nodules. A histopathologic examination of the lesions also confirmed a fungal infection associated with granulomatous inflammation. Rapid polymerase chain reaction (PCR) analysis of the chitin synthase 1 gene was conducted for rapid direct detection, and inter-simple sequence repeat fingerprinting was conducted to classify the infectious origin. The PCR analysis definitively demonstrated representative Microsporum canis fungus. The present report is the first case of disseminated M. canis infection with multiorgan involvement in a green iguana. PMID:25000705

  7. A faecal analysis of helminth infections in wild and captive wolves, Canis lupus L., in Poland. (United States)

    Szafrańska, E; Wasielewski, O; Bereszyński, A


    One hundred and three samples of faeces of reared grey wolves from four locations (Stobnica Park and Zoological Gardens in Bydgoszcz, Wrocław and Cracow) and twenty-six samples of faeces from two free-roaming packs of grey wolf (Canis lupus L.) in Piła (Forest Divisions: Borne Sulinowo, Czarnobór, Jastrowo) and Zielona Góra (Forest Divisions: Torzym, Krosno Odrzańskie) were collected between 2005 and 2007. Helminth eggs were detected in 78.6% of faecal samples of reared grey wolves and in 88.4% of those of free-roaming wolves. The trematode Alaria alata (80.1%) and nematodes Eucoleus aerophilus (23.1%) and Spirocerca lupi (11.5%) were only detected from wild packs of wolves and the nematodes Ancylostoma caninum (35.9%), Trichuris vulpis (15.5%) and Toxocara canis (3.9%) were only detected from reared wolves. Differences were observed in the prevalence and composition of helminth fauna between reared and wild grey wolves and our results are compared with those from studies within Poland and elsewhere in Europe. PMID:20236557

  8. Ancient Himalayan wolf (Canis lupus chanco) lineage in Upper Mustang of the Annapurna Conservation Area, Nepal. (United States)

    Chetri, Madhu; Jhala, Yadvendradev V; Jnawali, Shant R; Subedi, Naresh; Dhakal, Maheshwar; Yumnam, Bibek


    The taxonomic status of the wolf (Canis lupus) in Nepal's Trans-Himalaya is poorly understood. Recent genetic studies have revealed the existence of three lineages of wolves in the Indian sub-continent. Of these, the Himalayan wolf, Canis lupus chanco, has been reported to be the most ancient lineage historically distributed within the Nepal Himalaya. These wolves residing in the Trans-Himalayan region have been suggested to be smaller and very different from the European wolf. During October 2011, six fecal samples suspected to have originated from wolves were collected from Upper Mustang in the Annapurna Conservation Area of Nepal. DNA extraction and amplification of the mitochondrial (mt) control region (CR) locus yielded sequences from five out of six samples. One sample matched domestic dog sequences in GenBank, while the remaining four samples were aligned within the monophyletic and ancient Himalayan wolf clade. These four sequences which matched each other, were new and represented a novel Himalayan wolf haplotype. This result confirms that the endangered ancient Himalayan wolf is extant in Nepal. Detailed genomic study covering Nepal's entire Himalayan landscape is recommended in order to understand their distribution, taxonomy and, genetic relatedness with other wolves potentially sharing the same landscape. PMID:27199590

  9. Isolation of Aureimonas altamirensis, a Brucella canis-like bacterium, from an edematous canine testicle. (United States)

    Reilly, Thomas J; Calcutt, Michael J; Wennerdahl, Laura A; Williams, Fred; Evans, Tim J; Ganjam, Irene K; Bowman, Jesse W; Fales, William H


    Microbiological and histological analysis of a sample from a swollen testicle of a 2-year-old Border Collie dog revealed a mixed infection of the fungus Blastomyces dermatitidis and the Gram-negative bacterium Aureimonas altamirensis. When subjected to an automated microbial identification system, the latter isolate was provisionally identified as Psychrobacter phenylpyruvicus, but the organism shared several biochemical features with Brucella canis and exhibited agglutination, albeit weakly, with anti-B. canis antiserum. Unequivocal identification of the organism was only achieved by 16S ribosomal RNA gene sequencing, ultimately establishing the identity as A. altamirensis. Since its first description in 2006, this organism has been isolated infrequently from human clinical samples, but, to the authors' knowledge, has not been reported from a veterinary clinical sample. While of unknown clinical significance with respect to the pathology observed for the polymicrobial infection described herein, it highlights the critical importance to unambiguously identify the microbe for diagnostic, epidemiological, infection control, and public health purposes. PMID:25292192

  10. Loop-mediated isothermal amplification assay for the detection of Ehrlichia canis DNA in blood samples from dogs

    Directory of Open Access Journals (Sweden)

    SA Faggion


    Full Text Available The rickettsial bacterium Ehrlichia canis is the etiological agent of canine monocytic ehrlichiosis, one of the most important canine tick-borne diseases in the world. In this study, a loop-mediated isothermal amplification (LAMP assay was developed for detection of E. canis DNA using LAMP primers targeting the groESL operon. Reactions were performed at 60°C for 60 min and the results were visualized by gel electrophoresis. Successful amplification was obtained using plasmid DNA containing a fragment of the groESL operon and DNA extracted from blood samples that tested positive for E. canis by real-time PCR. The specificity of amplification was confirmed by EcoRI restriction of internal sites in the LAMP primers and no cross-reactivity with blood samples positive for Babesia spp., another common tick-borne pathogen, was observed. The high cost of nucleic acid tests (NAT is one of the disadvantages for their large-scale use as routine diagnostic tests. The E. canis LAMP assay developed here is an interesting alternative to PCR since it does not require a thermocycler, thus reducing costs for the veterinary clinical laboratory.

  11. Killing and caching of an adult White-tailed deer, Odocoileus virginianus, by a single Gray Wolf, Canis lupus (United States)

    Nelson, Michael E.


    A single Gray Wolf (Canis lupus) killed an adult male White-tailed Deer (Odocoileus virginianus) and cached the intact carcass in 76 cm of snow. The carcass was revisited and entirely consumed between four and seven days later. This is the first recorded observation of a Gray Wolf caching an entire adult deer.

  12. In vitro culture and structural differences in the major immunoreactive protein gp36 of geographically distant Ehrlichia canis isolates

    Czech Academy of Sciences Publication Activity Database

    Zweygarth, E.; Cabezas Cruz, Alejandro; Josemans, A.I.; Oosthuizen, M.C.; Matjila, P.T.; Lis, K.; Broniszewska, M.; Schöl, H.; Ferrolho, J.; Grubhoffer, Libor; Passos, L.M.F.


    Roč. 5, č. 4 (2014), s. 423-431. ISSN 1877-959X Institutional support: RVO:60077344 Keywords : Ehrlichia canis * In vitro culture * IDE8 tick cells * DH82 * 16S rRNA * gp36 Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 2.718, year: 2014

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-0921 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 6e-65 50% ... ...CBRC-XTRO-01-0921 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  14. NCBI nr-aa BLAST: CBRC-CFAM-09-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-180 100% ... ...CBRC-CFAM-09-0025 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-147 83% ... ...CBRC-OPRI-01-0031 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  16. NCBI nr-aa BLAST: CBRC-XTRO-01-0525 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 3e-64 41% ... ...CBRC-XTRO-01-0525 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  17. NCBI nr-aa BLAST: CBRC-CPOR-01-1760 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-142 81% ... ...CBRC-CPOR-01-1760 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  18. NCBI nr-aa BLAST: CBRC-CFAM-09-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 2e-45 74% ... ...CBRC-CFAM-09-0031 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  19. NCBI nr-aa BLAST: CBRC-TSYR-01-0539 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-158 88% ... ...CBRC-TSYR-01-0539 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  20. NCBI nr-aa BLAST: CBRC-CJAC-01-0513 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-106 76% ... ...CBRC-CJAC-01-0513 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  1. NCBI nr-aa BLAST: CBRC-MMUS-11-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-157 85% ... ...CBRC-MMUS-11-0111 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-2829 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 7e-42 41% ... ...CBRC-XTRO-01-2829 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  3. NCBI nr-aa BLAST: CBRC-OCUN-01-0425 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-114 85% ... ...CBRC-OCUN-01-0425 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  4. NCBI nr-aa BLAST: CBRC-EEUR-01-0300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 3e-42 61% ... ...CBRC-EEUR-01-0300 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  5. NCBI nr-aa BLAST: CBRC-PABE-18-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-154 86% ... ...CBRC-PABE-18-0004 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  6. NCBI nr-aa BLAST: CBRC-PCAP-01-1028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 5e-52 70% ... ...CBRC-PCAP-01-1028 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  7. NCBI nr-aa BLAST: CBRC-MDOM-09-0069 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-110 64% ... ...CBRC-MDOM-09-0069 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  8. NCBI nr-aa BLAST: CBRC-OGAR-01-0628 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-127 87% ... ...CBRC-OGAR-01-0628 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  9. NCBI nr-aa BLAST: CBRC-RMAC-16-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-150 84% ... ...CBRC-RMAC-16-0003 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  10. NCBI nr-aa BLAST: CBRC-RNOR-10-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-157 85% ... ...CBRC-RNOR-10-0211 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  11. NCBI nr-aa BLAST: CBRC-MMUR-01-1394 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 7e-38 90% ... ...CBRC-MMUR-01-1394 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  12. NCBI nr-aa BLAST: CBRC-ETEL-01-0352 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-133 91% ... ...CBRC-ETEL-01-0352 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  13. NCBI nr-aa BLAST: CBRC-PTRO-18-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-140 80% ... ...CBRC-PTRO-18-0006 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  14. NCBI nr-aa BLAST: CBRC-FCAT-01-0354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 6e-58 86% ... ...CBRC-FCAT-01-0354 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-1724 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-155 87% ... ...CBRC-BTAU-01-1724 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  16. NCBI nr-aa BLAST: CBRC-LAFR-01-0683 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 9e-49 90% ... ...CBRC-LAFR-01-0683 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  17. NCBI nr-aa BLAST: CBRC-MMUS-11-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-153 83% ... ...CBRC-MMUS-11-0109 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  18. NCBI nr-aa BLAST: CBRC-MMUR-01-0292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 9e-92 83% ... ...CBRC-MMUR-01-0292 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  19. NCBI nr-aa BLAST: CBRC-CJAC-01-1284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-148 83% ... ...CBRC-CJAC-01-1284 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil

  20. NCBI nr-aa BLAST: CBRC-RNOR-10-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available iaris] ref|XP_855617.1| PREDICTED: cOR1P2 olfactory receptor family 1 subfamily P-like [Canis familia...ris] gb|ABO36679.1| 1P2 olfactory receptor protein [Canis lupus familiaris] NP_001017518.1 1e-154 84% ... ...CBRC-RNOR-10-0210 ref|NP_001017518.1| cOR1P2 olfactory receptor family 1 subfamily P-like [Canis lupus famil