canis familiaris human-like: Topics by WorldWideScience.org

Sample records for canis familiaris human-like

CanisOme--The protein signatures of Canis lupus familiaris diseases.

Science.gov (United States)

Fernandes, Mónica; Rosa, Nuno; Esteves, Eduardo; Correia, Maria José; Arrais, Joel; Ribeiro, Paulo; Vala, Helena; Barros, Marlene

2016-03-16

Although the applications of Proteomics in Human Biomedicine have been explored for some time now, in animal and veterinary research, the potential of this resource has just started to be explored, especially when companion animal health is considered. In the last years, knowledge on the Canis lupus familiaris proteome has been accumulating in the literature and a resource compiling all this information and critically reviewing it was lacking. This article presents such a resource for the first time. CanisOme is a database of all proteins identified in Canis lupus familiaris tissues, either in health or in disease, annotated with information on the proteins present on the sample and on the donors. This database reunites information on 549 proteins, associated with 63 dog diseases and 33 dog breeds. Examples of how this information may be used to produce new hypothesis on disease mechanisms is presented both through the functional analysis of the proteins quantified in canine cutaneous mast cell tumors and through the study of the interactome of C. lupus familiaris and Leishmania infantum. Therefore, the usefulness of CanisOme for researchers looking for protein biomarkers in dogs and interested in a comprehensive analysis of disease mechanisms is demonstrated. This paper presents CanisOme, a database of proteomic studies with relevant protein annotation, allowing the enlightenment of disease mechanisms and the discovery of novel disease biomarkers for C. lupus familiaris. This knowledge is important not only for the improvement of animal health but also for the use of dogs as models for human health studies. Copyright © 2016 Elsevier B.V. All rights reserved.
The role of oxytocin in the ability of domestic dogs (Canis familiaris) to use human social cues and bond with humans.

OpenAIRE

Oliva, Jessica Lee

2017-01-01

The domestic dog (Canis familiaris) demonstrates attachment/bonding behaviour towards humans, whilst wolves (Canis lupus) do not. Domestic dogs also use humans’ non-verbal social cues to solve problems better than wolves do, even wolves raised in the same manner as domestic dogs. The neuropeptide oxytocin has been implicated in mammalian bonding and non-verbal intelligence and therefore the oxytocinergic system may have evolved in the dog during domestication in such a manner as to enable the...
Communication between domestic dogs (Canis familiaris) and humans: dogs are good learners.

Science.gov (United States)

Elgier, Angel M; Jakovcevic, Adriana; Barrera, Gabriela; Mustaca, Alba E; Bentosela, Mariana

2009-07-01

Communication involves a wide range of behaviours that animals emit in their daily lives and can take place between different species, as is the case of domestic dogs (Canis familiaris) and humans. Dogs have shown to be successful at following human cues to solve the object choice task. The question is what are the mechanisms involved in these communicative abilities. This article presents a review of studies about the communicative capacities of domestic dogs emphasizing the ones that considered the effect of associative learning upon these skills. In addition, evidence about differences in dogs' performance in following physical or social cues is summarized and two studies where both signals compete are presented here. The obtained results suggest that the training of a colour cue reverses the dogs' preference for the social one. These results are discussed in light of the findings that gave importance to the learning effect, concluding that the dogs fundamentally follow those cues that allowed them to obtain reinforcers in their previous learning history.
Canis familiaris As a Model for Non-Invasive Comparative Neuroscience.

Science.gov (United States)

Bunford, Nóra; Andics, Attila; Kis, Anna; Miklósi, Ádám; Gácsi, Márta

2017-07-01

There is an ongoing need to improve animal models for investigating human behavior and its biological underpinnings. The domestic dog (Canis familiaris) is a promising model in cognitive neuroscience. However, before it can contribute to advances in this field in a comparative, reliable, and valid manner, several methodological issues warrant attention. We review recent non-invasive canine neuroscience studies, primarily focusing on (i) variability among dogs and between dogs and humans in cranial characteristics, and (ii) generalizability across dog and dog-human studies. We argue not for methodological uniformity but for functional comparability between methods, experimental designs, and neural responses. We conclude that the dog may become an innovative and unique model in comparative neuroscience, complementing more traditional models. Copyright © 2017 Elsevier Ltd. All rights reserved.
[Diphyllobothrium pacificum (Nybelin,1931) margolis, 1956 in Canis familiaris from Chincha city, Peru].

Science.gov (United States)

Cabrera, R; Tantaleán, M; Rojas, R

2001-01-01

In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast.
Diphyllobothrium pacificum (Nybelin, 1931) Margolis, 1956 en Canis familiaris de la ciudad de Chincha, Perú

OpenAIRE

Cabrera, Ch; Tantaleán V, Manuel; Rojas M, Ricardo

2001-01-01

In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast
Cross-sectional study of object permanence in domestic puppies (Canis familiaris).

Science.gov (United States)

Gagnon, S; Doré, F Y

1994-09-01

Visual accommodation and object permanence tests were administered to 70 puppies (Canis familiaris), aged 4 weeks to 9 months. The results showed that understanding of visible displacement problems emerged at the 5th weeks and developed rapidly until the 8th week. Although the search behaviors of older puppies were more flexible, no further significant development was observed between 8 weeks and 9 months. The results on invisible displacement tests suggest that understanding of invisible displacement problems appears around the 1st year in dogs' development.
Dogs' (Canis familiaris) attention to human perception: Influence of breed groups and life experiences.

Science.gov (United States)

Heberlein, Marianne T E; Turner, Dennis C; Manser, Marta B

2017-02-01

Attending to the perception of others may help individuals gaining information from conspecifics, or help in competitive situations. Dogs (Canis familiaris) are attentive to humans' signals and their attentional state. We investigated whether dogs of different breed groups differ in their ability to pay attention to human's perception, first according to the genetic relatedness between dog breeds, and second according to working style differences. Once dogs had learned to leave forbidden food on the floor, they were confronted with 2 food items to which only they had unrestricted visual access. The owners saw either none or 1 food item through a transparent barrier. Our results showed that dogs pay attention to the perception of humans, whereby differences between breed groups became obvious. Within different genetic groups, ancient and hunting type dogs performed similarly, they were more attentive to their owners' perception than shepherd and the mastiff type dogs. When comparing dogs classified according to their working style, independent workers and family dogs were attentive to the owner's perception, while cooperative workers seemed not. The dogs' choice could not be explained by a general or training induced preference for eating behind an opaque screen, or by an influence of the owner's possible intention to prevent the dog from taking the food item he could see. Our study confirms that dogs are attentive/sensitive to human's perception, but genetic and working style differences among the breeds, as well as dog sport experiences explain part of the variation seen in their performance. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands.

Science.gov (United States)

Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston

2014-03-01

Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history.
Life cycle of Hepatozoon canis (Apicomplexa: Adeleorina: Hepatozoidae) in the tick Rhipicephalus sanguineus and domestic dog (Canis familiaris).

Science.gov (United States)

Baneth, Gad; Samish, Michael; Shkap, Varda

2007-04-01

The life cycle of the apicomplexan protozoon Hepatozoon canis in its natural hosts Rhipicephalus sanguineus (tick) and Canis familiaris (domestic dog) was studied in an experimental infection. Tick nymphs were fed on a naturally infected dog, or they were infected by percutaneous injection of blood. Dogs were inoculated by ingestion of adult ticks containing mature oocysts. Gamonts were in syzygy 24 hr after percutaneous injection of ticks. Early oocysts were detected 96 hr after nymph repletion, and mature oocysts in adult ticks were infective to dogs 40 days postmolt. Merogony was detected in dog bone marrow from 13 days postinoculation (PI) and included meronts containing 20-30 micromerozoites, and a second type with 2-4 macromerozoites. Monozoic cysts were observed in the spleen in conjunction with merogony. Gamontogony with infection of leukocytes by micromerozoites occurred from 26 days PI, and gamont parasitemia, which completed the life cycle, was detected 28 days PI. The length of the life cycle from nymphal attachment to parasitemia in dogs was 81 days. Increased body temperatures were evident from 16 to 27 days PI and paralleled the time of intensive bone marrow merogony. Skeletal pain and recumbency were manifested in 2 dogs. This study further elucidates the life cycle of H. canis and provides a sequential morphologic description of H. canis merogony, gamontogony, and sporogony.
Search behavior in various breeds of adult dogs (Canis familiaris): object permanence and olfactory cues.

Science.gov (United States)

Gagnon, S; Doré, F Y

1992-03-01

Human analog tests of object permanence were administered to various breeds of adult dogs (Canis familiaris). Experiment 1 showed that the performance of terriers, sporting, and working dogs did not differ. Dogs succeeded in solving invisible displacement problems, but performance was lower than in visible displacement tests. Familiarity with the task had some influence because invisible displacement tests were more successful if they were preceded by visible displacement tests. In Experiment 2, odor cues from the target object and the hiding screens were available or were masked. Results confirmed that success was lower in invisible than in visible displacement tests and that these problems were solved on the basis of representation of visual information rather than on the basis of olfactory cues or of local rule learning. Dogs are compared with other species that display Stage 6 object permanence.
The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

Science.gov (United States)

Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

2016-05-01

Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills.
Length of time domestic dogs (Canis familiaris) spend smelling urine of gonadectomised and intact conspecifics.

Science.gov (United States)

Riach, Anna C; Asquith, Rachel; Fallon, Melissa L D

2017-09-01

Domestic dogs (Canis familiaris) use urine to communicate among themselves, however, it is unknown whether the gonadectomy (neutering or spaying) of a dog affects this communication in anyway. Urine samples from 10 intact and 10 gonadectomised, unfamiliar dogs were presented to 12 tester dogs to sniff under controlled conditions in a pilot study. The amount of time the tester dogs spent sniffing each sample was recorded. Overall, tester dogs were recorded smelling the urine of gonadectomised individuals for a longer time. In addition to the type of urine sample, the result is likely to have been influenced by the sex and status (gonadectomised or intact) of the tester dogs. The observed increase in the length of time spent sniffing urine from gonadectomised individuals could be explained by the tester dogs experiencing more difficulty in gaining information from the urine or facing more confusion while analysing the urine compared to the intact urine they have evolved to smell. Copyright © 2017 Elsevier B.V. All rights reserved.
"Wolves (Canis lupus) and dogs (Canis familiaris) differ in following human gaze into distant space but respond similar to their packmates' gaze": Correction to Werhahn et al. (2016).

Science.gov (United States)

2017-02-01

Reports an error in "Wolves ( Canis lupus ) and dogs ( Canis familiaris ) differ in following human gaze into distant space but respond similar to their packmates' gaze" by Geraldine Werhahn, Zsófia Virányi, Gabriela Barrera, Andrea Sommese and Friederike Range ( Journal of Comparative Psychology , 2016[Aug], Vol 130[3], 288-298). In the article, the affiliations for the second and fifth authors should be Wolf Science Center, Ernstbrunn, Austria, and Comparative Cognition, Messerli Research Institute, University of Veterinary Medicine Vienna/ Medical University of Vienna/University of Vienna. The online version of this article has been corrected. (The following abstract of the original article appeared in record 2016-26311-001.) Gaze following into distant space is defined as visual co-orientation with another individual's head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills
Production, crystallization and preliminary X-ray diffraction analysis of the allergen Can f 2 from Canis familiaris

International Nuclear Information System (INIS)

Madhurantakam, Chaithanya; Nilsson, Ola B.; Jönsson, Klas; Grönlund, Hans; Achour, Adnane

2009-01-01

The recombinant form of the allergen Can f 2 from C. familiaris was produced, isolated and crystallized in two different forms. Preliminary X-ray diffraction analyses are reported for the two crystal forms of Can f 2. The allergen Can f 2 from dog (Canis familiaris) present in saliva, dander and fur is an important cause of allergic sensitization worldwide. Here, the production, isolation, crystallization and preliminary X-ray diffraction analysis of two crystal forms of recombinant Can f 2 are reported. The first crystal form belonged to space group C222, with unit-cell parameters a = 68.7, b = 77.3, c = 65.1 Å, and diffracted to 1.55 Å resolution, while the second crystal form belonged to space group C2, with unit-cell parameters a = 75.7, b = 48.3, c = 68.7 Å, β = 126.5°, and diffracted to 2.1 Å resolution. Preliminary data analysis indicated the presence of a single molecule in the asymmetric unit for both crystal forms
Hyperhidrosis in naïve purpose-bred beagle dogs (Canis familiaris).

Science.gov (United States)

Carrier, Catherine A; Seeman, Jennifer L; Hoffmann, Guenther

2011-05-01

This case study details the unusual clinical findings in a unique paw-pad disorder that recently emerged among 2 male and 1 female naïve purpose-bred beagle dogs (Canis familiaris) newly received into our facility. During acclimation period physical examinations, the affected dogs demonstrated constantly moist, soft paw pads on all 4 feet. No information was available regarding the epidemiology and pathogenesis of this pad condition in beagle dogs. Here, we report the results of physical examination, clinical chemistry analysis, hematology, histopathology, detailed observations, and novel testing techniques performed during the acclimation period. Histopathology of several sections of affected footpads was compared with that of an age-matched dog with clinically normal paw pads. We describe the morphologic features of a distinctive cutaneous canine footpad condition and discuss the possible differential diagnoses. The histologic and clinical features were most consistent with those of hyperhidrosis; to our knowledge, this report is the first description of hyperhidrosis as a distinct condition in purpose-bred beagle dogs.
Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

Directory of Open Access Journals (Sweden)

Dorey, Nicole R.

2013-07-01

Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.
[Dog (Canis familiaris) infectivity to Lutzomyia youngi in Trujillo, Venezuela].

Science.gov (United States)

Hernández, Dalila; Rojas, Elina; Scorza, José Vicente; Jorquera, Alicia

2006-10-01

In Trujillo, Venezuela the prevalence for American tegumentary leishmaniasis (ATL) is 38 per 100,000 inhabitants. In a periurban, rural settlement of the capital city Trujillo, we studied the potential capability of the domestic dog (Canis familiaris) as a source of infection for Lutzomyia youngi, a phlebotomine sand fly species abundant in the study area and whose domestic vectorial activity has been proven. Dogs with dermal lesions suggestive of ATL and parasitological confirmation of infection, were selected for xenodiagnosis by allowing sylvatic phlebotomines from a ATL free area, to feed ad libitum over each animal's entire body surface. The insects' intestinal tracts were dissected 5 days after the blood meal in order to look for flagellate forms. When these were found, parasitological identification was performed by the multiplex-PCR technique. Four hundred and fifty five sand flies engorged over two dogs in three different assays; promastigotes were found in 4 (0.88%) of the specimens on only one occasion. PCR identified DNA of the Leishmania Viannia subgenus. The household dog has the potential of being a domestic risk factor in the ATL transmission cycle.
Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

DEFF Research Database (Denmark)

Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette

2014-01-01

This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six...
Comparison between lamellar keratoplasties produced by conjunctival pedicle and free corneal autografts. Experimental study in the dog (Canis familiaris - LINNAEUS, 1758

Directory of Open Access Journals (Sweden)

José Luiz Laus

1996-03-01

Full Text Available A comparative study of conjunctival pedicle and corneal autografts, for experimental healing of superficial keratectomies in dogs (Canis familiaris was performed. It was carried out by using 24 animals, and the technical procedures were analysed according to clinical, histologic and scanning electron microscopy parameters, in early and late postoperative periods. The obtained results are believed to represent feasible methods of proteresis, applied to the healing ophthalmic surgery. There were few, irrelevant differences between the two tested techniques.

Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

Science.gov (United States)

Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

2015-10-01

This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.
Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

Directory of Open Access Journals (Sweden)

Llanos Mariana

2010-10-01

Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.
The status of Demodex cornei: description of the species and developmental stages, and data on demodecid mites in the domestic dog Canis lupus familiaris.

Science.gov (United States)

Izdebska, J N; Rolbiecki, L

2018-03-30

Demodecosis canina is one of the most important dog parasitoses, but its aetiology is still not well known. There are currently two known species of demodecid mite specific to the domestic dog Canis lupus familiaris Linnaeus, 1758 (Carnivora: Canidae). These are Demodex canis Leydig, 1859 (Acariformes: Demodecidae) and Demodex injai Desch & Hillier, 2003. There have also been many reports of the so-called 'short form', considered to be a separate species functioning under the name Demodex cornei nomen nudum, for which, however, no formal valid description has been documented. Taxonomic analysis of short forms of dog demodecid mites, associated with the stratum corneum, was performed, in line with the taxonomic criteria of Demodecidae systematics. This form was found to be a distinct species with features that differ from those of the other known species of this family. The species, including the adult and immature stages, is described. It is likely that different Demodex species parasitizing the domestic dog may be responsible for differentiated symptoms and different courses of demodecosis. However, the basis for clarifying this issue should be the correct, unambiguous identification of the species causing parasitosis. © 2018 The Royal Entomological Society.
Practice makes perfect: familiarity of task determines success in solvable tasks for free-ranging dogs (Canis lupus familiaris).

Science.gov (United States)

Bhattacharjee, Debottam; Dasgupta, Sandipan; Biswas, Arpita; Deheria, Jayshree; Gupta, Shreya; Nikhil Dev, N; Udell, Monique; Bhadra, Anindita

2017-07-01

Domestic dogs' (Canis lupus familiaris) socio-cognitive faculties have made them highly sensitive to human social cues. While dogs often excel at understanding human communicative gestures, they perform comparatively poorly in problem-solving and physical reasoning tasks. This difference in their behaviour could be due to the lifestyle and intense socialization, where problem solving and physical cognition are less important than social cognition. Free-ranging dogs live in human-dominated environments, not under human supervision and are less socialized. Being scavengers, they often encounter challenges where problem solving is required in order to get access to food. We tested Indian street dogs in familiar and unfamiliar independent solvable tasks and quantified their persistence and dependence on a novel human experimenter, in addition to their success in solving a task. Our results indicate that free-ranging dogs succeeded and persisted more in the familiar task as compared to the unfamiliar one. They showed negligible amount of human dependence in the familiar task, but showed prolonged gazing and considerable begging behaviour to the human experimenter in the context of the unfamiliar task. Cognitive abilities of free-ranging dogs thus play a pivotal role in determining task-associated behaviours based on familiarity. In addition to that, these dogs inherently tend to socialize with and depend on humans, even if they are strangers. Our results also illustrate free-ranging dogs' low competence at physical cognitive tasks.
Association, inhibition, and object permanence in dogs' (Canis familiaris) spatial search.

Science.gov (United States)

Ashton, Rebecca L; De Lillo, Carlo

2011-05-01

The relative role of associative processes and the use of explicit cues about object location in search behavior in dogs (Canis familiaris) was assessed by using a spatial binary discrimination reversal paradigm in which reversal conditions featured: (1) a previously rewarded location and a novel location, (2) a previously nonrewarded location and a novel location, or (3) a previously rewarded location and a previously nonrewarded location. Rule mediated learning predicts a similar performance in these different reversal conditions whereas associative learning predicts the worst performance in Condition 3. Evidence for an associative control of search emerged when no explicit cues about food location were provided (Experiment 1) but also when dogs witnessed the hiding of food in the reversal trials (Experiment 2) and when they did so in both the prereversal and the reversal trials (Experiment 3). Nevertheless, dogs performed better in the prereversal phase of Experiment 3 indicating that their search could be informed by the knowledge of the food location. Experiment 4 confirmed the results of Experiments 1 and 2, under a different arrangement of search locations. We conclude that knowledge about object location guides search behavior in dogs but it cannot override associative processes. 2011 APA, all rights reserved
Pathogenic strains of Yersinia enterocolitica isolated from domestic dogs (Canis familiaris) belonging to farmers are of the same subtype as pathogenic Y. enterocolitica strains isolated from humans and may be a source of human infection in Jiangsu Province, China.

Science.gov (United States)

Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

2010-05-01

We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections.
Pathogenic Strains of Yersinia enterocolitica Isolated from Domestic Dogs (Canis familiaris) Belonging to Farmers Are of the Same Subtype as Pathogenic Y. enterocolitica Strains Isolated from Humans and May Be a Source of Human Infection in Jiangsu Province, China ▿ ‡

Science.gov (United States)

Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

2010-01-01

We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections. PMID:20181899
Infectividad del perro (Canis familiaris para Lutzomyia youngi en Trujillo, Venezuela

Directory of Open Access Journals (Sweden)

Dalila Hernández

2006-10-01

Full Text Available Introducción. En Trujillo, Venezuela, la prevalencia de leishmaniasis tegumentaria americana (LTA es de 38 por 100.000 habitantes. Objetivo. En una localidad periurbana, rural, de la ciudad capital, estudiamos a los perros caseros (Canis familiaris para investigar mediante la técnica de xenodiagnóstico la eventual capacidad para infectar a Lutzomyia youngi, especie flebotomina con actividad vectorial intradomiciliaria comprobada y abundante en el área de estudio. Materiales y métodos. Los perros con lesiones sugestivas de LTA, parasitológicamente diagnosticados, fueron seleccionados para el xenodiagnóstico permitiendo a flebótomos silvestres de una zona libre de LTA alimentarse ad libitum sobre toda la superficie corporal de cada animal, y evidenciar, en disecciones efectuadas a los 5 días post-ingesta, la posible presencia de flagelados en sus tractos digestivos, en cuyo caso, fueron evaluados por la técnica PCR-Multiplex para determinar la identidad del parásito. Resultados. Un total de 455 flebótomos se ingurgitaron sobre dos perros en tres evaluaciones distintas; en una única ocasión, se observaron promastigotes en 4 (0,88% insectos, cuya identificación molecular reveló pertenecían al subgénero Viannia. Conclusión. El perro casero constituye un potencial factor de riesgo intradomiciliario en el ciclo de la LTA.
Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus)

Science.gov (United States)

Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...
Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

Science.gov (United States)

Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

2016-01-01

Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.
Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris?

Directory of Open Access Journals (Sweden)

Sara C Owczarczak-Garstecka

Full Text Available Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts. There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as 'relaxed' across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect.
Diphyllobothrium sp. in Canis familiaris from the subtropical area of Argentina (Puerto Iguazú, Misiones).

Science.gov (United States)

Rivero, María R; Motta, Carlos E; Salas, Martín M; Chiaretta, Alicia; Salomón, Oscar D

2015-01-01

This paper reports the first finding of Diphyllobothrium sp. eggs in Canis familiaris (domestic dog) from Puerto Iguazú, a subtropical city of Misiones province, Argentina. In 2013, two positive cases of Diphyllobothrium sp. eggs were detected during an annual parasitological survey of dogs. Dog feces were collected in vials containing 10% formalin and processed using Telemann's sedimentation and Sheather's flotation techniques. The two cases were detected in rural areas of the municipality. Since Misiones is not a part of the endemic area of diphyllobothriasis and given the fact that it is located in the three-border area of Argentina, Brazil and Paraguay, we consider this finding of great importance to public health. We stress the need for updating the current knowledge about the life cycle of these parasites considering the range of intermediate and definitive hosts, their zoonotic potential, and the epidemiological situation in non-endemic areas. Copyright © 2015 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Molecular structure, bioinformatics analysis, expression and bioactivity of BAFF (TNF13B) in dog (Canis familiaris).

Science.gov (United States)

Shen, Yuefen; Wang, Shule; Ai, Hongxin; Min, Cui; Chen, Yuqing; Zhang, Shuangquan

2011-07-15

B cell activating factor (BAFF), belonging to the tumor necrosis factor (TNF) family, plays an important role in B cell survival, proliferation and differentiation. In the present study, we amplified the cDNA of dog (Canis familiaris) BAFF (designated doBAFF) from spleen by reverse transcription-PCR (RT-PCR) and rapid amplification of cDNA ends (RACE) strategies. The open reading frame (ORF) of doBAFF covers 879 bp encoding 292 amino acids, with a 152-aa mature peptide. The soluble mature part of doBAFF (dosBAFF) shares 91.5%, 72.1%, 96.7%, 94.0% and 91.5% identity with the human, mouse, cattle, pig and rabbit counterparts, respectively. The predicted three-dimensional (3D) structural analysis of dosBAFF analyzed by "comparative protein modeling" revealed that it was very similar to its human counterpart. Real-time quantitative PCR analysis revealed that doBAFF was mainly expressed in spleen. Two fusion proteins SUMO-dosBAFF and GFP/dosBAFF were efficiently expressed in Escherichia coli BL21 (DE3) and purified using metal chelate affinity chromatography (Ni-NTA). Laser scanning confocal microscopy analysis showed that GFP/dosBAFF could bind to the mouse splenic B-cell. In vitro, SUMO-dosBAFF and GFP/dosBAFF were able to promote the survival/proliferation of dog lymphocytes or mouse splenic B cells with/without anti-IgM. Therefore, BAFF may be a potential immunologic factor for enhancing immunological efficacy in dog. Copyright © 2011 Elsevier B.V. All rights reserved.
Quantity discrimination in wolves (Canis lupus

Directory of Open Access Journals (Sweden)

Ewelina eUtrata

2012-11-01

Full Text Available Quantity discrimination has been studied extensively in different non-human animal species. In the current study, we tested eleven hand-raised wolves (Canis lupus in a two-way choice task. We placed a number of food items (one to four sequentially into two opaque cans and asked the wolves to choose the larger amount. Moreover, we conducted two additional control conditions to rule out non-numerical properties of the presentation that the animals might have used to make the correct choice. Our results showed that wolves are able to make quantitative judgments at the group, but also at the individual level even when alternative strategies such as paying attention to the surface area or time and total amount are ruled out. In contrast to previous canine studies on dogs (Canis familiaris and coyotes (Canis latrans, our wolves’ performance did not improve with decreasing ratio, referred to as Weber’s law. However, further studies using larger quantities than we used in the current setup are still needed to determine whether and when wolves’ quantity discrimination conforms to Weber’s law.
Evidence of morphine like substance and μ-opioid receptor expression in Toxacara canis (Nematoda: Ascaridae).

Science.gov (United States)

Golabi, Mostafa; Naem, Soraya; Imani, Mehdi; Dalirezh, Nowruz

2016-01-01

Toxocara canis (Nematoda: Ascaridae) is an intestinal nematode parasite of dogs, which can also cause disease in humans. Transmission to humans usually occurs because of direct contact with T. canis eggs present in soil contaminated with the feces of infected dogs. This nematode has extraordinary abilities to survive for many years in different tissues of vertebrates, and develop to maturity in the intestinal tract of its definitive host. Survival of parasitic nematodes within a host requires immune evasion using complicated pathways. Morphine-like substance, as well as opioids, which are known as down regulating agents, can modulate both innate and acquired immune responses, and let the parasite survives in their hosts. In the present study, we aimed to find evidences of morphine-like substance and µ-opiate receptor expression in T. canis , using high performance liquid chromatography (HPLC) and reverse transcription polymerase chain reaction (RT-PCR). The results indicated that T. canis produced morphine-like substances at the level of 2.31± 0.26 ng g -1 wet weight, and expressed µ-opiate receptor as in expected size of 441 bp. According to our findings, it was concluded that T. canis , benefits using morphine-like substance to modulate host immunity.
Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

DEFF Research Database (Denmark)

Kirkegaard, M.; Sonne, C.; Jakobsen, Jette

2010-01-01

The aim of this study was to examine the plasma, liver, and kidney status of vitamin A (retinol) and vitamin E (-tocopherol) in two groups of Greenland sled dogs (Canis familiaris), with a total number of 16 bitches and 8 pups. The dogs were fed either minke whale (Balaenoptera acuterostrata...... polychlorinated biphenyls [PCB]). Retinol was approximately 18% and -tocopherol 22% higher in the diet of the exposed dogs compared to controls. In adipose tissue, mean of sigma OHC was 92 ng/g lipid weight (lw) and 5005 ng/g lw for all control (n = 12) and exposed dogs (n = 10), respectively. Hepatic retinol...... correlated negatively with sigma-dichlorodiphenyldichloroethane (sigma DDT) and and sigma-polybrominated diphenyl ethers (sigma PBDE) for all exposed animals. A negative correlation between kidney -tocopherol and sigma PCB concentrations was observed, whereas two positive significant correlations were...
Taxonomy Icon Data: dog [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available dog Canis lupus familiaris Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Canis_lupus..._familiaris_L.png Canis_lupus_familiaris_NL.png Canis_lupus_familiaris_S.png Canis_lupus_familiari...s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp.../taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/tax...onomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...
Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species

DEFF Research Database (Denmark)

Sonne, Christian; Gustavson, Kim; Eulaers, Igor

2016-01-01

The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First...... quotients (RQDD: DD/CDD; RQBR: BR/CBR; ≥1 indicates risk). The results showed that risk quotients for reproductive, immunotoxic and liver histopathological effects were significantly lowest in the control group (p... on body residues (RQBR) (all preproductive and immunotoxic effects while those for liver histopathological effects ranged from 0.7-3.0. PCBs (polychlorinated biphenyls) and chlordanes were the dominant driver behind high immune and reproductive RQs...
Genome-wide identification and analysis of basic helix-loop-helix domains in dog, Canis lupus familiaris.

Science.gov (United States)

Wang, Xu-Hua; Wang, Yong; Liu, A-Ke; Liu, Xiao-Ting; Zhou, Yang; Yao, Qin; Chen, Ke-Ping

2015-04-01

The basic helix-loop-helix (bHLH) domain is a highly conserved amino acid motif that defines a group of DNA-binding transcription factors. bHLH proteins play essential regulatory roles in a variety of biological processes in animal, plant, and fungus. The domestic dog, Canis lupus familiaris, is a good model organism for genetic, physiological, and behavioral studies. In this study, we identified 115 putative bHLH genes in the dog genome. Based on a phylogenetic analysis, 51, 26, 14, 4, 12, and 4 dog bHLH genes were assigned to six separate groups (A-F); four bHLH genes were categorized as ''orphans''. Within-group evolutionary relationships inferred from the phylogenetic analysis were consistent with positional conservation, other conserved domains flanking the bHLH motif, and highly conserved intron/exon patterns in other vertebrates. Our analytical results confirmed the GenBank annotations of 89 dog bHLH proteins and provided information that could be used to update the annotations of the remaining 26 dog bHLH proteins. These data will provide good references for further studies on the structures and regulatory functions of bHLH proteins in the growth and development of dogs, which may help in understanding the mechanisms that underlie the physical and behavioral differences between dogs and wolves.
NCBI nr-aa BLAST: CBRC-PVAM-01-1620 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1620 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 0.0 82% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-0830 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0830 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 1e-105 76% ...
Differential sensitivity to human communication in dogs, wolves, and human infants.

Science.gov (United States)

Topál, József; Gergely, György; Erdohegyi, Agnes; Csibra, Gergely; Miklósi, Adám

2009-09-04

Ten-month-old infants persistently search for a hidden object at its initial hiding place even after observing it being hidden at another location. Recent evidence suggests that communicative cues from the experimenter contribute to the emergence of this perseverative search error. We replicated these results with dogs (Canis familiaris), who also commit more search errors in ostensive-communicative (in 75% of the total trials) than in noncommunicative (39%) or nonsocial (17%) hiding contexts. However, comparative investigations suggest that communicative signals serve different functions for dogs and infants, whereas human-reared wolves (Canis lupus) do not show doglike context-dependent differences of search errors. We propose that shared sensitivity to human communicative signals stems from convergent social evolution of the Homo and the Canis genera.
NCBI nr-aa BLAST: CBRC-CFAM-21-0168 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0168 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1669 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-1669 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 82% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1462 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1462 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-156 91% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-0139 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-0139 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...
NCBI nr-aa BLAST: CBRC-CFAM-21-0167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0167 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 81% ...
NCBI nr-aa BLAST: CBRC-TBEL-01-1358 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1358 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 4e-78 82% ...
NCBI nr-aa BLAST: CBRC-FCAT-01-0606 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0606 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-169 90% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
NCBI nr-aa BLAST: CBRC-PABE-12-0119 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-12-0119 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-151 81% ...
NCBI nr-aa BLAST: CBRC-MMUS-07-0511 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-07-0511 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 77% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0982 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-159 86% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1299 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1299 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-OGAR-01-1197 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-1197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-162 85% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-0947 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-0947 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-3219 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-3219 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0801 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0801 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 79% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0106 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-142 80% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-2138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2138 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-121 68% ...
NCBI nr-aa BLAST: CBRC-CFAM-21-0169 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0169 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-170 91% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2590 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2590 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 3e-44 56% ...
NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0191 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0191 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 2e-87 75% ...
Aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus- PI e região metropolitana do Recife- PE, Brasil.

OpenAIRE

Jamile Prado dos Santos

2010-01-01

A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania infantum a qual é relatada em várias regiões. O objetivo desta pesquisafoi verificar aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus PI e Região Metropolitana de Recife - PE, Brasil. Cães do município de Bom Jesus, Piauí, e do bairro de Muribeca, município de Jaboatão dos Guararapes, Pernambuco...
Dogs catch human yawns

OpenAIRE

Joly-Mascheroni, Ramiro M; Senju, Atsushi; Shepherd, Alex J

2008-01-01

This study is the first to demonstrate that human yawns are possibly contagious to domestic dogs (Canis familiaris). Twenty-nine dogs observed a human yawning or making control mouth movements. Twenty-one dogs yawned when they observed a human yawning, but control mouth movements did not elicit yawning from any of them. The presence of contagious yawning in dogs suggests that this phenomenon is not specific to primate species and may indicate that dogs possess the capacity for a rudimentary f...
SCM, a novel M-like protein from Streptococcus canis, binds (mini)-plasminogen with high affinity and facilitates bacterial transmigration.

Science.gov (United States)

Fulde, Marcus; Rohde, Manfred; Hitzmann, Angela; Preissner, Klaus T; Nitsche-Schmitz, D Patric; Nerlich, Andreas; Chhatwal, Gursharan Singh; Bergmann, Simone

2011-03-15

Streptococcus canis is an important zoonotic pathogen capable of causing serious invasive diseases in domestic animals and humans. In the present paper we report the binding of human plasminogen to S. canis and the recruitment of proteolytically active plasmin on its surface. The binding receptor for plasminogen was identified as a novel M-like protein designated SCM (S. canis M-like protein). SPR (surface plasmon resonance) analyses, radioactive dot-blot analyses and heterologous expression on the surface of Streptococcus gordonii confirmed the plasminogen-binding capability of SCM. The binding domain was located within the N-terminus of SCM, which specifically bound to the C-terminal part of plasminogen (mini-plasminogen) comprising kringle domain 5 and the catalytic domain. In the presence of urokinase, SCM mediated plasminogen activation on the bacterial surface that was inhibited by serine protease inhibitors and lysine amino acid analogues. Surface-bound plasmin effectively degraded purified fibrinogen as well as fibrin clots, resulting in the dissolution of fibrin thrombi. Electron microscopic illustration and time-lapse imaging demonstrated bacterial transmigration through fibrinous thrombi. The present study has led, for the first time, to the identification of SCM as a novel receptor for (mini)-plasminogen mediating the fibrinolytic activity of S. canis.
NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
A Review of Domestic Dogs' ("Canis Familiaris") Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs

Science.gov (United States)

Udell, Monique A. R.; Wynne, C. D. L.

2008-01-01

Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are…
Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

Directory of Open Access Journals (Sweden)

Héctor Rubén Ávila Adarme

2016-06-01

Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la
NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1025 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 95% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...
MLVA and LPS Characteristics of Brucella canis Isolated from Humans and Dogs in Zhejiang, China

Directory of Open Access Journals (Sweden)

Dongri Piao

2017-12-01

Full Text Available BackgroundBrucella canis is a pathogenic bacterium that causes brucellosis in dogs, and its zoonotic potential has been increasing in recent years. B. canis is a rare source of human brucellosis in China, where Brucella melitensis has been the major pathogen associated with human brucellosis outbreaks. In late 2011, a case of a B. canis infection was detected in a human patient in Zhejiang Province, China. To compare the genotypes between strains of B. canis isolated from the patient and from dogs, a multiple-locus variable-number tandem-repeat analysis (MLVA-16 was performed. In addition, the lipopolysaccharide-synthesis-related genes were analyzed with the B. canis reference strain RM6/66.Results32 B. canis strains were divided into 26 genotypes using MLVA-16 [Hunter-Gaston Diversity Index (HGDI = 0.976]. The HGDI indexes for various loci ranged between 0.000 and 0.865. All four Hangzhou isolates were indistinguishable using panel 1 (genotype 3 and panel 2A (genotype 28. However, these strains were distinctly different from other isolates from Beijing, Jiangsu, Liaoning, and Inner Mongolia at Bruce 09. The emergence of a human B. canis infection was limited to an area. Comparative analysis indicated B. canis from canines and humans have no differences in lipopolysaccharide-synthesis locus.ConclusionThe comprehensive approaches have been used to analyze human and canine B. canis isolates, including molecular epidemiological and LPS genetic characteristics. Further detailed analysis of the whole genomic sequencing will contribute to understanding of the pathogenicity of B. canis in humans.
Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris)

Science.gov (United States)

Dubey, J. P.; Sykes, J. E.; Shelton, G. D.; Sharp, N.; Verma, S. K.; Calero-Bernal, R.; Viviano, J.; Sundar, N.; Khan, A.; Grigg, M. E.

2014-01-01

There are several reports of Sarcocystis sarcocysts in muscles of dogs but these species have not been named. Additionally, there are 2 reports of Sarcocystis neurona in dogs. Here, we propose 2 new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in 4 domestic dogs (Canis familiaris), 1 each from Montana and Colorado in the USA, and 2 from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy, and PCR. Based on collective results 2 new species, Sarcocystis caninum and Sarcocystis svanai were designated. Sarcocystis caninum and Sarcocystis svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By transmission electron microscopy (TEM), the sarcocyst wall “type 9”, 1–2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7–9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were “type 1”, thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multi-locus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to S. canis or S. arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica
[Genetic analysis and estimation of genetic diversity in east-European breeds of swift hounds (Canis familiaris L.) based on the data of genomic studies using RAPD markers].

Science.gov (United States)

Semenova, S K; Illarionova, N A; Vasil'ev, V A; Shubkina, A V; Ryskov, A P

2002-06-01

The method of polymerase chain reaction with a set of arbitrary primers (RAPD-PCR) was used to describe genetic variation and to estimate genetic diversity in East-European swift hounds, Russian Psovyi and Hortyi Borzois. For comparison, swift hounds of two West-European breeds (Whippet and Greyhound) and single dogs of other breed groups (shepherd, terriers, mastiffs, and bird dogs) were examined. For all dog groups, their closest related species, the wolf Canis lupus, was used as an outgroup. Variation of RAPD markers was studied at several hierarchic levels: intra- and interfamily (for individual families of Russian Psovyi and Hortyi Borzois), intra- and interbreed (for ten dog breeds), and interspecific (C. familiaris-C. lupus). In total, 57 dogs and 4 wolfs were studied. Using RAPD-PCR with three primers, 93 DNA fragments with a length of 150-1500 bp were detected in several Borzoi families with known filiation. These fragments were found to be inherited as dominant markers and to be applicable for estimation of genetic differences between parents and their offspring and for comparison of individuals and families with different level of inbreeding. A high level of intra- and interbreed variation was found in Russian Psovyi and Hortyi Borzois. In these dog groups, genetic similarity indices varied in a range of 72.2 to 93.4% (parents-offspring) and 68.0 to 94.5 (sibs). Based on the patterns of RAPD markers obtained using six primers, a dendrogram of genetic similarity between the wolf and different dog breeds was constructed, and indices of intragroup diversity were calculated. All studied breeds were found to fall into two clusters, swift hounds (Borzoi-like dogs) and other dogs. Russian Borzois represent a very heterogeneous group, in which the Russian Psovyi Borzoi is closer to Greyhound than the Russian Hortyi Borzoi. All studied wolfs constituted a separate cluster. Significant differences were found between the wolf and dogs by the number of RAPD markers
Characterization of rabies virus from a human case in Nepal.

Science.gov (United States)

Pant, G R; Horton, D L; Dahal, M; Rai, J N; Ide, S; Leech, S; Marston, D A; McElhinney, L M; Fooks, A R

2011-04-01

Rabies is endemic throughout most of Asia, with the majority of human cases transmitted by domestic dogs (Canis familiaris). Here, we report a case of rabies in a 12-year-old girl in the Lalitpur district of Nepal that might have been prevented by better public awareness and timely post-exposure prophylaxis. Molecular characterization of the virus showed 100% identity over a partial nucleoprotein gene sequence to previous isolates from Nepal belonging to the 'arctic-like' lineage of rabies virus. Sequence analysis of both partial nucleoprotein and glycoprotein genes showed differences in consensus sequence after passage in vitro but not after passage in vivo.
Physiological, physical and behavioural changes in dogs (Canis familiaris) when kennelled: testing the validity of stress parameters.

Science.gov (United States)

Part, C E; Kiddie, J L; Hayes, W A; Mills, D S; Neville, R F; Morton, D B; Collins, L M

2014-06-22

Domestic dogs (Canis familiaris) housed in kennelling establishments are considered at risk of suffering poor welfare. Previous research supporting this hypothesis has typically used cortisol:creatinine ratios (C/Cr) to measure acute and chronic stress in kennelled dogs. However, the value of C/Cr as a welfare indicator has been questioned. This study aimed to test the validity of a range of physiological, physical and behavioural welfare indicators and to establish baseline values reflecting good dog welfare. Measurements were taken from 29 privately-owned dogs (14 males, 15 females), ranging in age and breed, in their own home and in a boarding kennel environment, following a within-subjects, counterbalanced design. Pairwise comparisons revealed that C/Cr and vanillylmandelic acid:creatinine ratios (VMA/Cr) were higher in the kennel than home environment (P=0.003; P=0.01, respectively) and were not associated with differences in movement/exercise between environments. Dogs' surface temperature was lower in kennels (P=0.001) and was not associated with ambient temperature. No association with age, or effects of kennel establishment, kennelling experience, sex or source were found. Dogs were generally more active in kennels, but showed considerable individual variability. C/Cr and 5-HIAA:creatinine ratios (5-HIAA/Cr) were negatively correlated with lip licking in kennels. Baseline values for each parameter are presented. The emotional valence of responses was ambiguous and no definitive evidence was found to suggest that dogs were negatively stressed by kennelling. It was concluded that C/Cr and, particularly, VMA/Cr and surface temperature provide robust indicators of psychological arousal in dogs, while spontaneous behaviour might be better used to facilitate interpretation of physiological and physical data on an individual level. Copyright © 2014 Elsevier Inc. All rights reserved.
NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...
Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

Science.gov (United States)

Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

2017-04-01

Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
First molecular identification of Echinococcus vogeli and Echinococcus granulosus (sensu stricto) G1 revealed in feces of domestic dogs (Canis familiaris) from Acre, Brazil.

Science.gov (United States)

das Neves, Leandro Batista; Teixeira, Paulo Eduardo Ferlini; Silva, Sidnei; de Oliveira, Fernanda Bittencourt; Garcia, Daniel Daipert; de Almeida, Fernanda Barbosa; Rodrigues-Silva, Rosângela; Machado-Silva, José Roberto

2017-01-14

Echinococcus granulosus (sensu lato) (s.l.) and Echinococcus vogeli are causative agents of chronic zoonotic diseases such as cystic and polycystic echinococcosis, respectively. In Brazil, polycystic echinococcosis has a restricted geographical distribution in the North Region, while cystic echinococcosis is observed in the South Region. Domestic dogs (Canis familiaris) fed with raw viscera represent a risk factor for E. granulosus (s.l.) infection in the South Region. Although this practice is frequent, it remains unclear whether domestic dogs are infected with E. vogeli in the state of Acre, located in the Amazon basin in the North Region of Brazil. The aim of this study was to investigate this gap in the polycystic echinococcosis epidemiology. Sixty-five fecal samples were collected from the ground in five municipalities (Sena Madureira, n = 14; Rio Branco, n = 06; Bujari, n = 06; Xapuri, n = 30; and Epitaciolândia, n = 09) located in the state of Acre, northern Brazil. The samples were screened for parasites by copro-PCR using the cox1 gene associated with automated sequencing. Echinococcus vogeli was molecularly confirmed in a sample from Sena Madureira and E. granulosus (sensu stricto) (s.s.) (G1) in a sample from Rio Branco. These findings indicate that molecular assays are useful in typing Echinococcus taxa from fecal samples of dogs in northern Brazil. The present study is the first molecular record of E. vogeli in domestic dogs found in the state of Acre, reinforcing their role as a source of infection for humans. Because E. granulosus (s.s.) (G1) was detected for the first time in the North Region, from the epidemiological standpoint this finding is highly relevant, because it expands the known geographical distribution, which was previously restricted to the South Region of Brazil.
NCBI nr-aa BLAST: CBRC-BTAU-01-1644 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1644 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-89 51% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0057 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 3e-50 57% ...
NCBI nr-aa BLAST: CBRC-GACU-23-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-23-0003 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 5e-27 29% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0195 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PMAR-01-0195 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-82 63% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1330 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1330 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-11 37% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0849 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0849 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1207 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1207 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2527 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2527 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 1e-165 73% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1250 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1250 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-119 80% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...
Epidemiological aspects and spatial distribution of human and canine visceral leishmaniasis in an endemic area in northeastern Brazil

OpenAIRE

Roseane Campos; Márcio Santos; Gabriel Tunon; Luana Cunha; Lucas Magalhães; Juliana Moraes; Danielle Ramalho; Sanmy Lima; José Antônio Pacheco; Michael Lipscomb; Amélia Ribeiro de Jesus; Roque Pacheco de Almeida

2017-01-01

Visceral leishmaniasis (VL) is a systemic disease endemic in tropical countries and transmitted through sand flies. In particular, Canis familiaris (or domesticated dogs) are believed to be a major urban reservoir for the parasite causing the disease Leishmania. The average number of human VL cases was 58 per year in the state of Sergipe. The city of Aracaju, capital of Sergipe in Northeastern Brazil, had 159 cases of VL in humans. Correlatively, the percentage of serologically positive dogs ...
NCBI nr-aa BLAST: CBRC-MLUC-01-1145 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1145 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0341 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0341 ref|NP_001121658.1| zinc finger protein, multitype 2 [Canis lupus... familiaris] gb|ACD67898.1| zinc finger multitype protein 2 [Canis lupus familiaris] NP_001121658.1 1.8 24% ...
NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0484 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0484 ref|NP_001003250.1| fucosidase, alpha-L-1, tissue [Canis lupus fa...miliaris] gb|AAB17403.1| alpha-L-fucosidase [Canis lupus familiaris] NP_001003250.1 2e-52 67% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0152 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0152 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2639 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2639 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 2e-99 60% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1218 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1218 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-126 70% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0643 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0643 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-131 95% ...
NCBI nr-aa BLAST: CBRC-FCAT-01-0019 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0019 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-121 96% ...
NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0147 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0228 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0228 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 7e-79 54% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0391 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-79 50% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2734 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-164 80% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0046 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0046 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 5e-46 41% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1165 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1165 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-101 60% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0554 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-117 67% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0608 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0608 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 7e-64 52% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0278 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 8e-55 51% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0170 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0170 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 3e-78 54% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0328 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0328 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-129 75% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1055 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1055 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 74% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1382 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1382 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-137 80% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0684 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0684 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-170 84% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0131 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 3e-69 47% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2581 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2581 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-156 78% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0130 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-66 45% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1474 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 0.0 96% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0718 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0718 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 3e-76 59% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-1451 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1451 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-109 62% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1789 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1789 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-48 36% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0058 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-118 75% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0126 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0126 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-64 45% ...
NCBI nr-aa BLAST: CBRC-STRI-01-1421 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1421 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 6e-85 54% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0135 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 2e-80 52% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1389 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1389 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-125 71% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0578 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0578 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-85 53% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0391 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-83 50% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0158 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0158 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-69 61% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1534 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1534 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-126 75% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0278 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-77 66% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1154 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1154 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-151 85% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0152 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0152 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 4e-57 49% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2514 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2514 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 6e-61 42% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1005 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-104 64% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0468 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0468 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-51 49% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0025 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 3e-72 67% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0943 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0943 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-92 59% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1669 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1669 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-70 48% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0906 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0906 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-122 76% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1197 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1197 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-48 50% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0048 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0048 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-136 85% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0806 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0806 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-175 99% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1301 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1301 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-180 92% ...
XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris).

Science.gov (United States)

Meyers-Wallen, Vicki N; Boyko, Adam R; Danko, Charles G; Grenier, Jennifer K; Mezey, Jason G; Hayward, Jessica J; Shannon, Laura M; Gao, Chuan; Shafquat, Afrah; Rice, Edward J; Pujar, Shashikant; Eggers, Stefanie; Ohnesorg, Thomas; Sinclair, Andrew H

2017-01-01

Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD) remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens) and dogs (C. familiaris). Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1) a variant associated with XX DSD in the canine model and 2) gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS) and whole genome sequencing (WGS), we identified a variant on C. familiaris autosome 9 (CFA9) that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq) in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.
XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris.

Directory of Open Access Journals (Sweden)

Vicki N Meyers-Wallen

Full Text Available Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens and dogs (C. familiaris. Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1 a variant associated with XX DSD in the canine model and 2 gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS and whole genome sequencing (WGS, we identified a variant on C. familiaris autosome 9 (CFA9 that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.
Helminths parasites of stray dogs (Canis lupus familiaris from Cuiabá, Midwestern of Brazil

Directory of Open Access Journals (Sweden)

Dirceu Guilherme de Souza Ramos

2015-04-01

Full Text Available Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest region of Brazil. A total of 100 animals, from the Center for Zoonosis Control of Cuiabá were euthanized and necropsied for helminth searching. Overall 8,217 helminths were found in 85 animals identified in six species: Ancylostoma caninum, Ancylostoma. braziliense, Trichuris vulpis, Toxocara canis, Dirofilaria immitis and Dipylidium caninum. It was evidenced the wide distribution of helminths pathogenic to domestic dogs and especially with zoonotic potential as A. caninum, T. canis, D. caninum and D. immitis. The presence of D. immitis is an important finding, since it is a potentially zoonotic agent, however, this finding is considered sporadic.
NCBI nr-aa BLAST: CBRC-ETEL-01-0405 [SEVENS

Lifescience Database Archive (English)

Full Text Available ters), member 2 [Canis lupus familiaris] gb|ABV32554.1| solute carrier family 23 member 2 [Canis lupus familiaris] NP_001103426.1 1e-177 91% ... ...CBRC-ETEL-01-0405 ref|NP_001103426.1| solute carrier family 23 (nucleobase transpor
FIRST CASE OF AUTOCHTHONOUS HUMAN VISCERAL LEISHMANIASIS IN THE URBAN CENTER OF RIO DE JANEIRO: CASE REPORT

OpenAIRE

Silva, Guilherme Almeida Rosa da; Boechat, Thiago de Oliveira; Ferry, Fernando Raphael de Almeida; Pinto, Jorge Francisco da Cunha; Azevedo, Marcelo Costa Velho Mendes de; Carvalho, Ricardo de Souza; Motta, Rogerio Neves; Veras, Mariana Ferreira

2014-01-01

Visceral leishmaniasis is an anthropozoonosis that is caused by protozoa of the genus Leishmania, especially Leishmania (Leishmania) infantum, and is transmitted to humans by the bite of sandflies of the genus Lutzomyia, such as Lutzomyia longipalpis. There are many reservoirs, including Canis familiaris. It is a chronic infectious disease with systemic involvement that is characterized by three phases: the initial period, the state period and the final period. The main symptoms are fever, ma...
Man's underground best friend: domestic ferrets, unlike the wild forms, show evidence of dog-like social-cognitive skills.

Science.gov (United States)

Hernádi, Anna; Kis, Anna; Turcsán, Borbála; Topál, József

2012-01-01

Recent research has shown that dogs' possess surprisingly sophisticated human-like social communication skills compared to wolves or chimpanzees. The effects of domestication on the emergence of socio-cognitive skills, however, are still highly debated. One way to investigate this is to compare socialized individuals from closely related domestic and wild species. In the present study we tested domestic ferrets (Mustela furo) and compared their performance to a group of wild Mustela hybrids and to domestic dogs (Canis familiaris). We found that, in contrast to wild Mustela hybrids, both domestic ferrets and dogs tolerated eye-contact for a longer time when facing their owners versus the experimenter and they showed a preference in a two-way choice task towards their owners. Furthermore, domestic ferrets, unlike the wild hybrids, were able to follow human directional gestures (sustained touching; momentary pointing) and could reach the success rate of dogs. Our study provides the first evidence that domestic ferrets, in a certain sense, are more dog-like than their wild counterparts. These findings support the hypothesis that domestic species may share basic socio-cognitive skills that enable them to engage in effectively orchestrated social interactions with humans.
Man's underground best friend: domestic ferrets, unlike the wild forms, show evidence of dog-like social-cognitive skills.

Directory of Open Access Journals (Sweden)

Anna Hernádi

Full Text Available Recent research has shown that dogs' possess surprisingly sophisticated human-like social communication skills compared to wolves or chimpanzees. The effects of domestication on the emergence of socio-cognitive skills, however, are still highly debated. One way to investigate this is to compare socialized individuals from closely related domestic and wild species. In the present study we tested domestic ferrets (Mustela furo and compared their performance to a group of wild Mustela hybrids and to domestic dogs (Canis familiaris. We found that, in contrast to wild Mustela hybrids, both domestic ferrets and dogs tolerated eye-contact for a longer time when facing their owners versus the experimenter and they showed a preference in a two-way choice task towards their owners. Furthermore, domestic ferrets, unlike the wild hybrids, were able to follow human directional gestures (sustained touching; momentary pointing and could reach the success rate of dogs. Our study provides the first evidence that domestic ferrets, in a certain sense, are more dog-like than their wild counterparts. These findings support the hypothesis that domestic species may share basic socio-cognitive skills that enable them to engage in effectively orchestrated social interactions with humans.
Image collection: 19 [Togo Picture Gallery[Archive

Lifescience Database Archive (English)

Full Text Available 19 Canis_lupus_familiaris_NL.png イエイヌ Domestic dogs Canis lupus familiaris 9615 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,ネコ目
NCBI nr-aa BLAST: CBRC-DNOV-01-2463 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2463 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-163 76% ...
NCBI nr-aa BLAST: CBRC-CFAM-32-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-32-0002 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-129 69% ...
An analysis of osteological material from the late Funnel Beaker culture settlement in Brozany, northwestern Bohemia

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2013-01-01

Roč. 65, č. 3 (2013), s. 504-534 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : archaeozoology * Eneolithic * puppies (Canis familiaris) * human newborns * fox * bird * fish * Apodemus * Unio * bone artefacts Subject RIV: AC - Archeology, Anthropology, Ethnology
Novel genotype of Ehrlichia canis detected in samples of human blood bank donors in Costa Rica.

Science.gov (United States)

Bouza-Mora, Laura; Dolz, Gaby; Solórzano-Morales, Antony; Romero-Zuñiga, Juan José; Salazar-Sánchez, Lizbeth; Labruna, Marcelo B; Aguiar, Daniel M

2017-01-01

This study focuses on the detection and identification of DNA and antibodies to Ehrlichia spp. in samples of blood bank donors in Costa Rica using molecular and serological techniques. Presence of Ehrlichia canis was determined in 10 (3.6%) out of 280 blood samples using polymerase chain reaction (PCR) targeting the ehrlichial dsb conserved gene. Analysis of the ehrlichial trp36 polymorphic gene in these 10 samples revealed substantial polymorphism among the E. canis genotypes, including divergent tandem repeat sequences. Nucleotide sequences of dsb and trp36 amplicons revealed a novel genotype of E. canis in blood bank donors from Costa Rica. Indirect immunofluorescence assay (IFA) detected antibodies in 35 (35%) of 100 serum samples evaluated. Thirty samples showed low endpoint titers (64-256) to E. canis, whereas five sera yielded high endpoint titers (1024-8192); these five samples were also E. canis-PCR positive. These findings represent the first report of the presence of E. canis in humans in Central America. Copyright Â© 2016 Elsevier GmbH. All rights reserved.
Word generalization by a dog (Canis familiaris: is shape important?

Directory of Open Access Journals (Sweden)

Emile van der Zee

Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.
Word Generalization by a Dog (Canis familiaris): Is Shape Important?

Science.gov (United States)

van der Zee, Emile; Zulch, Helen; Mills, Daniel

2012-01-01

We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

Seeing with ears: Sightless humans' perception of dog bark provides a test for structural rules in vocal communication.

Science.gov (United States)

Molnár, Csaba; Pongrácz, Péter; Miklósi, Adám

2010-05-01

Prerecorded family dog (Canis familiaris) barks were played back to groups of congenitally sightless, sightless with prior visual experience, and sighted people (none of whom had ever owned a dog). We found that blind people without any previous canine visual experiences can categorize accurately various dog barks recorded in different contexts, and their results are very close to those of sighted people in characterizing the emotional content of barks. These findings suggest that humans can recognize some of the most important motivational states reflecting, for example, fear or aggression in a dog's bark without any visual experience. It is very likely that this result can be generalized to other mammalian species--that is, no visual experience of another individual is needed for recognizing some of the most important motivational states of the caller.
Human case of bacteremia caused by Streptococcus canis sequence type 9 harboring the scm gene.

Science.gov (United States)

Taniyama, Daisuke; Abe, Yoshihiko; Sakai, Tetsuya; Kikuchi, Takahide; Takahashi, Takashi

2017-01-01

Streptococcus canis (Sc) is a zoonotic pathogen that is transferred mainly from companion animals to humans. One of the major virulence factors in Sc is the M-like protein encoded by the scm gene, which is involved in anti-phagocytic activities, as well as the recruitment of plasminogen to the bacterial surface in cooperation with enolase, and the consequent enhancement of bacterial transmigration and survival. This is the first reported human case of uncomplicated bacteremia following a dog bite, caused by Streptococcus canis harboring the scm gene. The similarity of the 16S rRNA from the infecting species to that of the Sc type strain, as well as the amplification of the species-specific cfg gene, encoding a co-hemolysin, was used to confirm the species identity. Furthermore, the isolate was confirmed as sequence type 9. The partial scm gene sequence harbored by the isolate was closely related to those of other two Sc strains. While this isolate did not possess the erm (A), erm (B), or mef (A), macrolide/lincosamide resistance genes, it was not susceptible to azithromycin: its susceptibility was intermediate. Even though human Sc bacteremia is rare, clinicians should be aware of this microorganism, as well as Pasteurella sp., Prevotella sp., and Capnocytophaga sp., when examining and treating patients with fever who maintain close contact with companion animals.
Molecular detection of Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli in stray dogs in Mahasarakham province, Thailand.

Science.gov (United States)

Piratae, Supawadee; Pimpjong, Kiattisak; Vaisusuk, Kotchaphon; Chatan, Wasupon

2015-01-01

Canine tick borne diseases showing distribution worldwide have caused morbidity and mortality in dogs. This study observed the mainly tick borne pathogens described for dogs in Thailand, Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli. From May to July 2014, blood samples were collected from 79 stray dogs from 7 districts of Mahasarakham province to molecular surveyed for 16s rRNA gene of E. canis and 18s rRNA gene of H. canis and B. canis vogeli. Twenty eight (35.44%) of stray dogs showed the infection with tick borne pathogens. The prevalence of E. canis infection was the highest with 21.5% (17/79). DNA of H. canis and B. canis vogeli were detected at the prevalence of 10.1% (8/79) and 6.3% (5/79), respectively. Co-infection between E. canis and B. canis vogeli were identified in 2 (2.5%) dogs. The results indicated that a wide range of tick borne pathogens are circulation in the canine population in Mahasarakham province. This study is the first report on prevalence of E. canis, H. canis and B. canis vogeli in stray dogs in Mahasarakham, a province in northern part of Thailand. This data providing is important to understand the prevalence of E. canis, H. canis and B. canis vogeli infection in stray dogs in this region, which will assist in the management of these blood parasite.
The effect of oxytocin on human-directed social behaviour in dogs (Canis familiaris).

Science.gov (United States)

Kis, Anna; Ciobica, Alin; Topál, József

2017-08-01

The oxytocin system has recently received increasing attention due to its effect on complex human behaviours. In parallel to this, over the past couple of decades, the human-analogue social behaviour of dogs has been intensively studied. Combining these two lines of research (e.g. studying the relationship between dog social behaviour and the oxytocin system) is a promising new research area. The present paper reviews the existing literature on how oxytocin is related to different aspects of human-directed social behaviour in dogs. Copyright © 2017 Elsevier Inc. All rights reserved.
Evaluation of a rapid immunochromatographic dipstick test for detection of antibodies to Trypanosoma cruzi in dogs experimentally infected with isolates obtained from opossums (Didelphis virginiana), armadillos (Dasypus novemcinctus), and dogs (Canis familiaris) from the United States.

Science.gov (United States)

Rosypal, Alexa C; Hill, Roderick; Lewis, Samantha; Barr, Stephen C; Valadas, Samantha; Gennari, Solange Maria; Lindsay, David S

2011-02-01

Dogs are reservoir hosts for Trypanosoma cruzi , the causative agent of American trypanosomiasis. A rapid immunochromatographic dipstick test (ICT) is available commercially for canine serological testing. The ICT was developed with the use of sera from South American dogs, but it is not routinely used in the United States. We evaluated the utility of the ICT in detecting anti-T. cruzi antibodies in dogs from the United States. Dogs (N = 64) were experimentally infected with United States' isolates of T. cruzi from an opossum (Didelphis virginiana), an armadillo (Dasypus novemcinctus), and a domestic dog (Canis familiaris), and were tested after experimental infection. Sera from uninfected United States dogs (n = 79; hemaculture negative) were used as negative controls. In a blind study, sera were tested by the ICT and compared to the indirect immunofluorescent antibody test with the use of Brazil-strain epimastigotes as antigen. The sensitivity of the ICT was 91% and the specificity was 98% in dogs experimentally infected with United States isolates. Our study indicates that the ICT could be a useful screening tool for serological surveillance of canine T. cruzi exposure in the United States.
A village dog is not a stray : human-dog interactions in coastal Mexico

NARCIS (Netherlands)

Ruiz Izaguirre, E.

2013-01-01

Dogs (Canis familiaris) are considered one of the most numerous carnivores worldwide. Although in the Global North dogs are popular companions, that live inside homes, about 80% of the dogs in the world are village dogs. Village dogs are typically free-roaming, scavenge refuse around
Do domestic dogs (Canis lupus familiaris) perceive the Delboeuf illusion?

Science.gov (United States)

Miletto Petrazzini, Maria Elena; Bisazza, Angelo; Agrillo, Christian

2017-05-01

In the last decade, visual illusions have been repeatedly used as a tool to compare visual perception among species. Several studies have investigated whether non-human primates perceive visual illusions in a human-like fashion, but little attention has been paid to other mammals, and sensitivity to visual illusions has been never investigated in the dog. Here, we studied whether domestic dogs perceive the Delboeuf illusion. In human and non-human primates, this illusion creates a misperception of item size as a function of its surrounding context. To examine this effect in dogs, we adapted the spontaneous preference paradigm recently used with chimpanzees. Subjects were presented with two plates containing food. In control trials, two different amounts of food were presented in two identical plates. In this circumstance, dogs were expected to select the larger amount. In test trials, equal food portion sizes were presented in two plates differing in size: if dogs perceived the illusion as primates do, they were expected to select the amount of food presented in the smaller plate. Dogs significantly discriminated the two alternatives in control trials, whereas their performance did not differ from chance in test trials with the illusory pattern. The fact that dogs do not seem to be susceptible to the Delboeuf illusion suggests a potential discontinuity in the perceptual biases affecting size judgments between primates and dogs.
Screening of bat faeces for arthropod-borne apicomplexan protozoa: Babesia canis and Besnoitia besnoiti-like sequences from Chiroptera.

Science.gov (United States)

Hornok, Sándor; Estók, Péter; Kováts, Dávid; Flaisz, Barbara; Takács, Nóra; Szőke, Krisztina; Krawczyk, Aleksandra; Kontschán, Jenő; Gyuranecz, Miklós; Fedák, András; Farkas, Róbert; Haarsma, Anne-Jifke; Sprong, Hein

2015-08-28

Bats are among the most eco-epidemiologically important mammals, owing to their presence in human settlements and animal keeping facilities. Roosting of bats in buildings may bring pathogens of veterinary-medical importance into the environment of domestic animals and humans. In this context bats have long been studied as carriers of various pathogen groups. However, despite their close association with arthropods (both in their food and as their ectoparasites), only a few molecular surveys have been published on their role as carriers of vector-borne protozoa. The aim of the present study was to compensate for this scarcity of information. Altogether 221 (mostly individual) bat faecal samples were collected in Hungary and the Netherlands. The DNA was extracted, and analysed with PCR and sequencing for the presence of arthropod-borne apicomplexan protozoa. Babesia canis canis (with 99-100% homology) was identified in five samples, all from Hungary. Because it was excluded with an Ixodidae-specific PCR that the relevant bats consumed ticks, these sequences derive either from insect carriers of Ba. canis, or from the infection of bats. In one bat faecal sample from the Netherlands a sequence having the highest (99%) homology to Besnoitia besnoiti was amplified. These findings suggest that some aspects of the epidemiology of canine babesiosis are underestimated or unknown, i.e. the potential role of insect-borne mechanical transmission and/or the susceptibility of bats to Ba. canis. In addition, bats need to be added to future studies in the quest for the final host of Be. besnoiti.
Memory-Based Quantity Discrimination in Coyotes (Canis latrans

Directory of Open Access Journals (Sweden)

Salif Mahamane

2014-08-01

Full Text Available Previous research has shown that the ratio between competing quantities of food significantly mediates coyotes‘ (Canis latrans ability to choose the larger of two food options. These previous findings are consistent with predictions made by Weber‘s Law and indicate that coyotes possess quantity discrimination abilities that are similar to other species. Importantly, coyotes‘ discrimination abilities are similar to domestic dogs (Canis lupus familiaris, indicating that quantitative discrimination may remain stable throughout certain species‘ evolution. However, while previously shown in two domestic dogs, it is unknown whether coyotes possess the ability to discriminate visual quantities from memory. Here, we address this question by displaying different ratios of food quantities to 14 coyotes before placing the choices out of sight. The coyotes were then allowed to select one of either non-visible food quantities. Coyotes‘ discrimination of quantity from memory does not follow Weber‘s Law in this particular task. These results suggest that working memory in coyotes may not be adapted to maintain information regarding quantity as well as in domestic dogs. The likelihood of a coyote‘s choosing the large option increased when it was presented with difficult ratios of food options first, before it was later presented with trials using more easily discriminable ratios, and when the large option was placed on one particular side. This suggests that learning or motivation increased across trials when coyotes experienced difficult ratios first, and that location of food may have been more salient in working memory than quantity of food.
Isolation of Aureimonas altamirensis, a Brucella canis-like bacterium, from an edematous canine testicle.

Science.gov (United States)

Reilly, Thomas J; Calcutt, Michael J; Wennerdahl, Laura A; Williams, Fred; Evans, Tim J; Ganjam, Irene K; Bowman, Jesse W; Fales, William H

2014-11-01

Microbiological and histological analysis of a sample from a swollen testicle of a 2-year-old Border Collie dog revealed a mixed infection of the fungus Blastomyces dermatitidis and the Gram-negative bacterium Aureimonas altamirensis. When subjected to an automated microbial identification system, the latter isolate was provisionally identified as Psychrobacter phenylpyruvicus, but the organism shared several biochemical features with Brucella canis and exhibited agglutination, albeit weakly, with anti-B. canis antiserum. Unequivocal identification of the organism was only achieved by 16S ribosomal RNA gene sequencing, ultimately establishing the identity as A. altamirensis. Since its first description in 2006, this organism has been isolated infrequently from human clinical samples, but, to the authors' knowledge, has not been reported from a veterinary clinical sample. While of unknown clinical significance with respect to the pathology observed for the polymicrobial infection described herein, it highlights the critical importance to unambiguously identify the microbe for diagnostic, epidemiological, infection control, and public health purposes. © 2014 The Author(s).
'Candidatus mycoplasma haemodidelphidis' sp. nov., 'Candidatus mycoplasma haemolamae' sp. nov. and Mycoplasma haemocanis comb. nov., haemotrophic parasites from a naturally infected opossum (Didelphis virginiana), alpaca (Lama pacos) and dog (Canis familiaris): phylogenetic and secondary structural relatedness of their 16S rRNA genes to other mycoplasmas.

Science.gov (United States)

Messick, Joanne B; Walker, Pamela G; Raphael, William; Berent, Linda; Shi, Xun

2002-05-01

The 16S rRNA sequence of newly characterized haemotrophic bacteria in an opossum (Didelphis virginiana) and alpaca (Lama pacos) was determined. In addition, the 16S rRNA sequence of a haemotrophic parasite in the dog (Canis familiaris) was determined. Sequence alignment and evolutionary analysis as well as secondary structural similarity and signature nucleotide sequence motifs of their 16S rRNA genes, positioned these organisms in the genus Mycoplasma. The highest scoring sequence similarities were 16S rRNA genes from haemotrophic mycoplasma species (Haemobartonella and Eperythrozoon spp.). However, the lack of several higher-order structural idiosyncrasies used to define the pneumoniae group, suggests that these organisms and related haemotrophic mycoplasmas represent a new group of mycoplasmas. It is recommended that the organisms be named 'Candidatus Mycoplasma haemodidelphidis', 'Candidatus Mycoplasma haemolamae' and Mycoplasma haemocanis comb. nov., to provide some indication of the target cell and host species of these parasites, and to reflect their phylogenetic affiliation.
Immunological inquiry for the epidemiology of leptospirosis in Canis familiaris in Salvador, Bahia, Brazil.

Science.gov (United States)

Caldas, E M; Doria, J D; Martins, M A

1977-12-01

A total of 430 dogs were immunologically examined in Salvador, Bahia, Brazil, and 21.6% of them were positive. The animals were selected through an aleatory pattern, according to the division of the City in 18 residential zones a division which had been established by the vaccination campaign against canis hydrophobia. The serotypes icterohemorrhagiae and canicola were the most frequently registered. Between the sexes, the male presented the highest index of positivity, though the difference wasn't statistically significant. The period of age ranging from 12 to 48 months comprised 67.7% of the investigations. Mestizo dogs presented a higher frequency of positivity than any other race and the areas of Nordeste de Amaralina, Liberdade and Quintas showed the greatest percentages of positive dogs.
An Attachment Perspective on the Child--Dog Bond: Interdisciplinary and International Research Findings

Science.gov (United States)

Jalongo, Mary Renck

2015-01-01

Understanding the process of attachment formation in young children has been a focal point in child development research for decades. However, young children's attachments are not only with human beings; they also form bonds with companion animals, particularly dogs ("Canis familiaris"). Given the number of dogs that are kept by families…
Investigating emotional contagion in dogs (Canis familiaris) to emotional sounds of humans and conspecifics.

Science.gov (United States)

Huber, Annika; Barber, Anjuli L A; Faragó, Tamás; Müller, Corsin A; Huber, Ludwig

2017-07-01

Emotional contagion, a basic component of empathy defined as emotional state-matching between individuals, has previously been shown in dogs even upon solely hearing negative emotional sounds of humans or conspecifics. The current investigation further sheds light on this phenomenon by directly contrasting emotional sounds of both species (humans and dogs) as well as opposed valences (positive and negative) to gain insights into intra- and interspecies empathy as well as differences between positively and negatively valenced sounds. Different types of sounds were played back to measure the influence of three dimensions on the dogs' behavioural response. We found that dogs behaved differently after hearing non-emotional sounds of their environment compared to emotional sounds of humans and conspecifics ("Emotionality" dimension), but the subjects responded similarly to human and conspecific sounds ("Species" dimension). However, dogs expressed more freezing behaviour after conspecific sounds, independent of the valence. Comparing positively with negatively valenced sounds of both species ("Valence" dimension), we found that, independent of the species from which the sound originated, dogs expressed more behavioural indicators for arousal and negatively valenced states after hearing negative emotional sounds. This response pattern indicates emotional state-matching or emotional contagion for negative sounds of humans and conspecifics. It furthermore indicates that dogs recognized the different valences of the emotional sounds, which is a promising finding for future studies on empathy for positive emotional states in dogs.
Endocarditis caused by Streptococcus canis: an emerging zoonosis?

Science.gov (United States)

Lacave, Guillaume; Coutard, Aymeric; Troché, Gilles; Augusto, Sandrine; Pons, Stéphanie; Zuber, Benjamin; Laurent, Virginie; Amara, Marlène; Couzon, Brigitte; Bédos, Jean-Pierre; Pangon, Béatrice; Grimaldi, David

2016-02-01

We report a human case of infective endocarditis caused by Streptococcus canis. Identification was carried out from positive blood culture using mass spectrometry and SodA gene sequencing. S. canis related zoonotic invasive infections may have been previously underdiagnosed due to inadequate identification of group G Streptococcus species.
The mitochondrial genome of Toxocara canis.

Science.gov (United States)

Jex, Aaron R; Waeschenbach, Andrea; Littlewood, D Timothy J; Hu, Min; Gasser, Robin B

2008-08-06

Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR) and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secementean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida). The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts.
The mitochondrial genome of Toxocara canis.

Directory of Open Access Journals (Sweden)

Aaron R Jex

2008-08-01

Full Text Available Toxocara canis (Ascaridida: Nematoda, which parasitizes (at the adult stage the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secementean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida. The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts.
The Mitochondrial Genome of Toxocara canis

Science.gov (United States)

Littlewood, D. Timothy J.; Hu, Min; Gasser, Robin B.

2008-01-01

Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR) and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secernentean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida). The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts. PMID:18682828
Why do adult dogs (Canis familiaris) commit the A-not-B search error?

Science.gov (United States)

Sümegi, Zsófia; Kis, Anna; Miklósi, Ádám; Topál, József

2014-02-01

It has been recently reported that adult domestic dogs, like human infants, tend to commit perseverative search errors; that is, they select the previously rewarded empty location in Piagetian A-not-B search task because of the experimenter's ostensive communicative cues. There is, however, an ongoing debate over whether these findings reveal that dogs can use the human ostensive referential communication as a source of information or the phenomenon can be accounted for by "more simple" explanations like insufficient attention and learning based on local enhancement. In 2 experiments the authors systematically manipulated the type of human cueing (communicative or noncommunicative) adjacent to the A hiding place during both the A and B trials. Results highlight 3 important aspects of the dogs' A-not-B error: (a) search errors are influenced to a certain extent by dogs' motivation to retrieve the toy object; (b) human communicative and noncommunicative signals have different error-inducing effects; and (3) communicative signals presented at the A hiding place during the B trials but not during the A trials play a crucial role in inducing the A-not-B error and it can be induced even without demonstrating repeated hiding events at location A. These findings further confirm the notion that perseverative search error, at least partially, reflects a "ready-to-obey" attitude in the dog rather than insufficient attention and/or working memory.
Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

Directory of Open Access Journals (Sweden)

Anna Kis

Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris).

Science.gov (United States)

Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő

2014-01-01

The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.
Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, em cães de Minas Gerais, Brasil Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, in dogs of Minas Gerais, Brasil

Directory of Open Access Journals (Sweden)

Walter dos Santos Lima

1985-06-01

Full Text Available Foi identificado Angiostrongylus vasorum (Baillet, 1866 colhido da artéria pulmonar de dois cães (Canis familiaris procedentes do município de Caratinga, Estado de Minas Gerais, Brasil. É apresentada a descrição morfológicas do parasita. Esta é a primeira referência desse parasita no Estado de Minas Gerais.For the first time Angiostrongylus vasorum in Canis familiaris in Minas Gerais State, Brazil, is described. The description and measurements of three males and ten females are presented together with a diagram of the parasite.
Spatially-explicit modelling model for assessing wild dog control strategies in Western Australia

Science.gov (United States)

Large predators can significantly impact livestock industries. In Australia, wild dogs (Canis lupus familiaris, Canis lupus dingo, and hybrids) cause economic losses of more than AUD $40M annually. Landscape-scale exclusion fencing coupled with lethal techniques is a widely pract...
A golden jackal (Canis aureus) from Austria bearing Hepatozoon canis--import due to immigration into a non-endemic area?

Science.gov (United States)

Duscher, Georg Gerhard; Kübber-Heiss, Anna; Richter, Barbara; Suchentrunk, Franz

2013-02-01

The protozoan Hepatozoon canis, which is transmitted via ingestion of infected ticks by canine hosts, is not endemic to mid-latitude regions in Europe. Its distribution is supposed to be linked to the occurrence of its primary tick vector Rhipicephalus sanguineus. A young male golden jackal (Canis aureus) found as road kill close to Vienna, Austria, was infected by this pathogen. Cloning and sequencing of the PCR product revealed 6 different haplotypes of H. canis. Based on the sequences, no clear relationship to the origin of infection could be traced. This is the first report of H. canis for Austria, and wild canines such as the currently found jackal may provide a source of natural spread of this parasite into non-endemic areas. This natural immigration of wild animals represents a way of pathogen introduction, which has to be considered in disease prevention in addition to human-made introduction due to animal import and export. Copyright © 2012 Elsevier GmbH. All rights reserved.
Exploring the evolutionary origins of overimitation: a comparison across domesticated and non-domesticated canids.

Science.gov (United States)

Johnston, Angie M; Holden, Paul C; Santos, Laurie R

2017-07-01

When learning from others, human children tend to faithfully copy - or 'overimitate' - the actions of a demonstrator, even when these actions are irrelevant for solving the task at hand. We investigate whether domesticated dogs (Canis familiaris) and dingoes (Canis dingo) share this tendency to overimitate in three experiments. In Experiment 1, dogs and dingoes had the opportunity to solve a puzzle after watching an ostensive demonstrator who used both a relevant action and an irrelevant action. We find clear evidence against overimitation in both species. In contrast to human children (Horner & Whiten, 2005), dogs and dingoes used the irrelevant action less often across trials, suggesting that both species were filtering out the irrelevant action as they gained experience with the puzzle (like chimpanzees; Horner & Whiten, 2005). Experiments 2 and 3 provide further evidence against overimitation, demonstrating that both species' behavior is better characterized by individual exploration than overimitation. Given that both species, particularly dogs, show human-like social learning in other contexts, these findings provide additional evidence that overimitation may be a unique aspect of human social learning. A video abstract of this article can be viewed at: https://youtu.be/g2mRniJZ7aU. © 2016 John Wiley & Sons Ltd.
Pesquisa de aglutininas anti Brucella canis em soros humanos na cidade de São Paulo, Brasil Research on agglutinins for Brucella canis in human sera in the city of S. Paulo, Brazil

Directory of Open Access Journals (Sweden)

Maria Helena Matiko Akao Larsson

1980-09-01

Full Text Available De 330 soros humanos examinados pela prova de soroaglutinação lenta em tubos, 4(1,21% apresentaram aglutininas anti Brucella canis em diluição 1:100 (1 reagente com título 100, 2 reagentes com título 200 e 1 reagente com título 400.Of the 330 human sera tested by tube agglutination test, 4 (1.21% were positive for Brucella canis antibodies with tilers 1:100 or higher (1 reagent with titer of 1:100, 2 reagents with titer of 1:200, and 1 reagent with tiler of 1:400.
Adaptation and niche construction in human prehistory: a case study from the southern Scandinavian Late Glacial.

Science.gov (United States)

Riede, Felix

2011-03-27

The niche construction model postulates that human bio-social evolution is composed of three inheritance domains, genetic, cultural and ecological, linked by feedback selection. This paper argues that many kinds of archaeological data can serve as proxies for human niche construction processes, and presents a method for investigating specific niche construction hypotheses. To illustrate this method, the repeated emergence of specialized reindeer (Rangifer tarandus) hunting/herding economies during the Late Palaeolithic (ca 14.7-11.5 kyr BP) in southern Scandinavia is analysed from a niche construction/triple-inheritance perspective. This economic relationship resulted in the eventual domestication of Rangifer. The hypothesis of whether domestication was achieved as early as the Late Palaeolithic, and whether this required the use of domesticated dogs (Canis familiaris) as hunting, herding or transport aids, is tested via a comparative analysis using material culture-based phylogenies and ecological datasets in relation to demographic/genetic proxies. Only weak evidence for sustained niche construction behaviours by prehistoric hunter-gatherer in southern Scandinavia is found, but this study nonetheless provides interesting insights into the likely processes of dog and reindeer domestication, and into processes of adaptation in Late Glacial foragers.
Prevalence of Ehrlichia canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, Bartonella vinsonii berkhoffii, and Rickettsia spp. in dogs from Grenada.

Science.gov (United States)

Yabsley, Michael J; McKibben, John; Macpherson, Calum N; Cattan, Peggy F; Cherry, Natalie A; Hegarty, Barbara C; Breitschwerdt, Edward B; O'Connor, Tom; Chandrashekar, Ramaswamy; Paterson, Tara; Perea, Marta Lanza; Ball, Geoffrey; Friesen, Stanley; Goedde, Jill; Henderson, Brooke; Sylvester, Wayne

2008-02-14

To identify the tick-borne pathogens in dogs from Grenada, we conducted a serologic survey for Ehrlichia canis in 2004 (104 dogs) and a comprehensive serologic and molecular survey for a variety of tick-borne pathogens in 2006 (73 dogs). In 2004 and 2006, 44 and 32 dogs (42.3% and 43.8%) were seropositive for E. canis, respectively. In 2006, several tick-borne pathogens were identified by serology and PCR. DNA of E. canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, and Bartonella sp. were identified in 18 (24.7%), 14 (19.2%), 5 (7%), 5 (7%), and 1 (1.4%) dogs, respectively. Six (8.2%) dogs were seropositive for Bartonella vinsonii subsp. berkhoffii. All dogs were seronegative and PCR-negative for Rickettsia spp. Coinfection with two or three pathogens was observed in eight dogs. Partial 16S rRNA E. canis and A. platys sequences were identical to sequences in GenBank. Partial 18S rRNA gene sequences from the Grenadian H. canis were identical to each other and had one possible mismatch (ambiguous base) from H. canis detected from Spain and Brazil. Grenadian B. c. vogeli sequences were identical to B. c. vogeli from Brazil and Japan. All of the detected pathogens are transmitted, or suspected to be transmitted, by Rhipicephalus sanguineus. Results of this study indicate that dogs from Grenada are infected with multiple tick-borne pathogens; therefore, tick-borne diseases should be included as differentials for dogs exhibiting thrombocytopenia, leukopenia, fever, or lethargy. One pathogen, E. canis, is also of potential public health significance.
La gender diversity nelle aziende familiari italiane: Una risorsa da valorizzare

OpenAIRE

D. Montemerlo; P. Profeta

2009-01-01

Questo articolo ha per oggetto la diversity relazionale di genere nelle imprese familiari italiane di medie e grandi dimensioni, misurata in termini di presenza femminile. Qual è lo stato effettivo della diversity di genere nelle aziende familiari medie e grandi, con riguardo non solo alle posizioni di imprenditore – capo azienda ma anche agli altri ruoli chiave della proprietà, del consiglio di amministrazione e del top management? La diversity di genere varia in funzione di caratteris...
Wolves (Canis lupus) and Dogs (Canis familiaris) Differ in Following Human Gaze Into Distant Space But Respond Similar to Their Packmates’ Gaze

Science.gov (United States)

Werhahn, Geraldine; Virányi, Zsófia; Barrera, Gabriela; Sommese, Andrea; Range, Friederike

2017-01-01

Gaze following into distant space is defined as visual co-orientation with another individual’s head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills might have been altered through domestication that may have influenced their performance in Study 1. Because following human gaze in dogs might be influenced by special evolutionary as well as developmental adaptations to interactions with humans, we suggest that comparing dogs to other animal species might be more informative when done in intraspecific social contexts. PMID:27244538
Wolves (Canis lupus) and dogs (Canis familiaris) differ in following human gaze into distant space but respond similar to their packmates' gaze.

Science.gov (United States)

Werhahn, Geraldine; Virányi, Zsófia; Barrera, Gabriela; Sommese, Andrea; Range, Friederike

2016-08-01

Gaze following into distant space is defined as visual co-orientation with another individual's head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills might have been altered through domestication that may have influenced their performance in Study 1. Because following human gaze in dogs might be influenced by special evolutionary as well as developmental adaptations to interactions with humans, we suggest that comparing dogs to other animal species might be more informative when done in intraspecific social contexts. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
Molecular cloning and characterization of arginine kinase gene of Toxocara canis

OpenAIRE

Sahu, Shivani; Samanta, S.; Harish, D. R.; Sudhakar, N. R.; Raina, O. K.; Shantaveer, S. B.; Madhu, D. N.; Kumar, Ashok

2013-01-01

Toxocara canis is an important gastrointestinal nematode of dogs and also a causative agent of visceral larva migrans in humans. Arginine kinase (AK) gene is one of the important biomolecule of phosphagen kinase of T. canis which is emerging as an exciting novel diagnostic target in toxocarosis. The present study was carried out to clone and characterize AK gene of T. canis for future utilization as a diagnostic molecule. Total RNA was extracted from intact adult worms and reverse transcripti...
Dog Breed Differences in Visual Communication with Humans.

Science.gov (United States)

Konno, Akitsugu; Romero, Teresa; Inoue-Murayama, Miho; Saito, Atsuko; Hasegawa, Toshikazu

2016-01-01

Domestic dogs (Canis familiaris) have developed a close relationship with humans through the process of domestication. In human-dog interactions, eye contact is a key element of relationship initiation and maintenance. Previous studies have suggested that canine ability to produce human-directed communicative signals is influenced by domestication history, from wolves to dogs, as well as by recent breed selection for particular working purposes. To test the genetic basis for such abilities in purebred dogs, we examined gazing behavior towards humans using two types of behavioral experiments: the 'visual contact task' and the 'unsolvable task'. A total of 125 dogs participated in the study. Based on the genetic relatedness among breeds subjects were classified into five breed groups: Ancient, Herding, Hunting, Retriever-Mastiff and Working). We found that it took longer time for Ancient breeds to make an eye-contact with humans, and that they gazed at humans for shorter periods of time than any other breed group in the unsolvable situation. Our findings suggest that spontaneous gaze behavior towards humans is associated with genetic similarity to wolves rather than with recent selective pressure to create particular working breeds.
Mixed Ehrlichia canis, Hepatozoon canis, and presumptive Anaplasma phagocytophilum infection in a dog.

Science.gov (United States)

Mylonakis, Mathio E; Koutinas, Alex F; Baneth, Gad; Polizopoulou, Zoe; Fytianou, Anna

2004-01-01

A 5-month-old, female, mongrel dog was admitted to the Clinic of Companion Animal Medicine, Aristotle University of Thessaloniki, Greece, with depression, anorexia, fever, peripheral lymphadenopathy, splenomegaly, oculonasal discharge, nonregenerative anemia, and mild thrombocytopenia. Cytology of Giemsa-stained buffy coat, bone marrow, and lymph node aspiration smears revealed numerous morulae in mononuclear leukocytes and in neutrophils, and Hepatozoon canis gamonts in neutrophils. The dog was seropositive to Ehrlichia canis (immunofluorescence assay [IFA]) and Hepatozoon canis (ELISA) but not to Anaplasma phagocytophilum (IFA). A nested polymerase chain reaction performed on bone marrow aspirates was positive for E canis. This method was not applied for the detection of A phagocytophilum. Treatment with doxycycline and imidocarb dipropionate resulted in both clinical and parasitologic cure. This is the first reported case of a mixed infection with E canis, H canis, and presumptive A phagocytophilum. The findings emphasize the value of cytology in offering a quick and inexpensive diagnosis in mixed tick-borne infections of dogs.
Gray wolf exposure to emerging vector-borne diseases in Wisconsin with comparison to domestic dogs and humans

Science.gov (United States)

Jara, Rocio F.; Wydeven, Adrian P.; Samuel, Michael D.

2016-01-01

World-wide concern over emerging vector-borne diseases has increased in recent years for both animal and human health. In the United Sates, concern about vector-borne diseases in canines has focused on Lyme disease, anaplasmosis, ehrlichiosis, and heartworm which infect domestic and wild canids. Of these diseases, Lyme and anaplasmosis are also frequently diagnosed in humans. Gray wolves (Canis lupus) recolonized Wisconsin in the 1970s, and we evaluated their temporal and geographic patterns of exposure to these four vector-borne diseases in Wisconsin as the population expanded between 1985 and 2011. A high proportion of the Wisconsin wolves were exposed to the agents that cause Lyme (65.6%) and anaplasma (47.7%), and a smaller proportion to ehrlichiosis (5.7%) and infected with heartworm (9.2%). Wolf exposure to tick borne diseases was consistently higher in older animals. Wolf exposure was markedly higher than domestic dog (Canis familiaris) exposure for all 4 disease agents during 2001–2013. We found a cluster of wolf exposure to Borrelia burgdorferi in northwestern Wisconsin, which overlaps human and domestic dog clusters for the same pathogen. In addition, wolf exposure to Lyme disease in Wisconsin has increased, corresponding with the increasing human incidence of Lyme disease in a similar time period. Despite generally high prevalence of exposure none of these diseases appear to have slowed the growth of the Wisconsin wolf population.
Domestic Dogs (Canis lupus familiaris are Sensitive to the “Human” Qualities of Vocal Commands

Directory of Open Access Journals (Sweden)

Jennifer M. Gibson

2014-08-01

Full Text Available In recent years, domestic dogs have been recognized for their ability to utilize human communicative gestures in choice tasks, as well as communicate with humans through visual and auditory means. A few dogs have even demonstrated the capacity to learn hundreds to thousands of human words and object labels with extensive training. However less is known about dogs‟ understanding or perception of human vocalizations in the absence of explicit training. This study was conducted to determine what aspects of human scolding vocalizations dogs would be most responsive to when presented with a choice to consume or avoid available food items. Variables included the gender, authenticity, word clarity and the human quality of the vocal commands. Our results suggest that dogs are generally cautious about novel sounds produced in the proximity of food. However they are most likely to avoid consumption when hearing a vocalization originally produced by a scolding human, suggesting awareness of vocal qualities common to human speech.
Canine vector-borne co-infections: Ehrlichia canis and Hepatozoon canis in the same host monocytes.

Science.gov (United States)

Baneth, Gad; Harrus, Shimon; Gal, Arnon; Aroch, Itamar

2015-02-28

The protozoon Hepatozoon canis and the rickettsia Ehrlichia canis are tick-borne pathogens, transmitted by Rhipicephalus sanguineus, which cause canine hepatozoonosis and canine monocytic ehrlichiosis, respectively. Co-infection of the same host monocytes with H. canis and E. canis confirmed by molecular characterization of the infecting agents and quantitative assessment of co-infected cells is described for the first time in three naturally-infected dogs. Blood smear evaluation indicated that at least 50% of the leukocytes infected with H. canis gamonts contained E. canis morulae. Co-infection of the same host cell demonstrated in this report suggests that infection with one pathogen may permit or enhance invasion or prolonged cellular survival of the other. Copyright © 2014 Elsevier B.V. All rights reserved.
Molecular cloning and characterization of arginine kinase gene of Toxocara canis.

Science.gov (United States)

Sahu, Shivani; Samanta, S; Harish, D R; Sudhakar, N R; Raina, O K; Shantaveer, S B; Madhu, D N; Kumar, Ashok

2015-06-01

Toxocara canis is an important gastrointestinal nematode of dogs and also a causative agent of visceral larva migrans in humans. Arginine kinase (AK) gene is one of the important biomolecule of phosphagen kinase of T. canis which is emerging as an exciting novel diagnostic target in toxocarosis. The present study was carried out to clone and characterize AK gene of T. canis for future utilization as a diagnostic molecule. Total RNA was extracted from intact adult worms and reverse transcription was done with oligo dT primers to obtain complementary DNA (cDNA). Polymerase chain reaction (PCR) was carried out using cDNA as template with specific primers which amplified a product of 1,202 bp. The amplicon was cloned into pDrive cloning vector and clone was confirmed by colony PCR and restriction endonuclease analysis. Sequence analysis of the gene showed 99.8 and 77.9 % homology with the published AK gene of T. canis (EF015466.1) and Ascaris suum respectively. Structural analysis shown that the mature AK protein consist of 400 amino acids with a molecular wt of 45360.73 Da. Further expression studies are required for producing the recombinant protein for its evaluation in the diagnosis of T. canis infection in humans as well as in adult dogs.
A critical reflection on current control of Toxocara canis in household dogs

NARCIS (Netherlands)

Nijsse, E.R.|info:eu-repo/dai/nl/314103198

2016-01-01

Toxocara canis is a roundworm that is common worldwide and also in Dutch household dogs. Adult stages of T. canis can be present in the small intestines of dogs where they produce large numbers of eggs that are shed in the environment (patent infection). Because very young dogs and humans can
Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India.

Science.gov (United States)

Singh, B B; Sharma, R; Gill, J P S

2015-09-01

Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts.

Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog.

Science.gov (United States)

Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M

2013-12-01

A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles. © 2013 American Society for Veterinary Clinical Pathology.
Toxoplasma gondii, Neospora caninum, Sarcocystis neurona, and Sarcocystis canis-like infections in marine mammals

Science.gov (United States)

Dubey, J.P.; Zarnke, R.; Thomas, N.J.; Wong, S.K.; Vanbonn, W.; Briggs, M.; Davis, J.W.; Ewing, R.; Mense, M.; Kwok, O.C.H.; Romand, S.; Thulliez, P.

2003-01-01

Toxoplasma gondii, Neospora caninum, Sarcocystis neurona, and S. canis are related protozoans that can cause mortality in many species of domestic and wild animals. Recently, T. gondii and S. neurona were recognized to cause encephalitis in marine mammals. As yet, there is no report of natural exposure of N. caninum in marine mammals. In the present study, antibodies to T. gondii and N. caninum were assayed in sera of several species of marine mammals. For T. gondii, sera were diluted 1:25, 1:50, and 1:500 and assayed in the T. gondii modified agglutination test (MAT). Antibodies (MAT a?Y1:25) to T. gondii were found in 89 of 115 (77%) dead, and 18 of 30 (60%) apparently healthy sea otters (Enhydra lutris), 51 of 311 (16%) Pacific harbor seals (Phoca vitulina), 19 of 45 (42%) sea lions (Zalophus californianus), 5 of 32 (16%) ringed seals (Phoca hispida), 4 of 8 (50%) bearded seals (Erignathus barbatus), 1 of 9 (11.1%) spotted seals (Phoca largha), 138 of 141 (98%) Atlantic bottlenose dolphins (Tursiops truncatus), and 3 of 53 (6%) walruses (Odobenus rosmarus). For N. caninum, sera were diluted 1:40, 1:80, 1:160, and 1:320 and examined with the Neospora agglutination test (NAT) using mouse-derived tachyzoites. NAT antibodies were found in 3 of 53 (6%) walruses, 28 of 145 (19%) sea otters, 11 of 311 (3.5%) harbor seals, 1 of 27 (3.7%) sea lions, 4 of 32 (12.5%) ringed seals, 1 of 8 (12.5%) bearded seals, and 43 of 47 (91%) bottlenose dolphins. To our knowledge, this is the first report of N. caninum antibodies in any marine mammal, and the first report of T. gondii antibodies in walruses and in ringed, bearded, spotted, and ribbon seals. Current information on T. gondii-like and Sarcocystis-like infections in marine mammals is reviewed. New cases of clinical S. canis and T. gondii infections are also reported in sea lions, and T. gondii infection in an Antillean manatee (Trichechus manatus manatus).
Gray Wolf Exposure to Emerging Vector-Borne Diseases in Wisconsin with Comparison to Domestic Dogs and Humans.

Directory of Open Access Journals (Sweden)

Rocio F Jara

Full Text Available World-wide concern over emerging vector-borne diseases has increased in recent years for both animal and human health. In the United Sates, concern about vector-borne diseases in canines has focused on Lyme disease, anaplasmosis, ehrlichiosis, and heartworm which infect domestic and wild canids. Of these diseases, Lyme and anaplasmosis are also frequently diagnosed in humans. Gray wolves (Canis lupus recolonized Wisconsin in the 1970s, and we evaluated their temporal and geographic patterns of exposure to these four vector-borne diseases in Wisconsin as the population expanded between 1985 and 2011. A high proportion of the Wisconsin wolves were exposed to the agents that cause Lyme (65.6% and anaplasma (47.7%, and a smaller proportion to ehrlichiosis (5.7% and infected with heartworm (9.2%. Wolf exposure to tick borne diseases was consistently higher in older animals. Wolf exposure was markedly higher than domestic dog (Canis familiaris exposure for all 4 disease agents during 2001-2013. We found a cluster of wolf exposure to Borrelia burgdorferi in northwestern Wisconsin, which overlaps human and domestic dog clusters for the same pathogen. In addition, wolf exposure to Lyme disease in Wisconsin has increased, corresponding with the increasing human incidence of Lyme disease in a similar time period. Despite generally high prevalence of exposure none of these diseases appear to have slowed the growth of the Wisconsin wolf population.
Do dogs (Canis lupus familiaris) make counterproductive choices because they are sensitive to human ostensive cues?

Science.gov (United States)

Marshall-Pescini, Sarah; Passalacqua, Chiara; Miletto Petrazzini, Maria Elena; Valsecchi, Paola; Prato-Previde, Emanuela

2012-01-01

Dogs appear to be sensitive to human ostensive communicative cues in a variety of situations, however there is still a measure of controversy as to the way in which these cues influence human-dog interactions. There is evidence for instance that dogs can be led into making evaluation errors in a quantity discrimination task, for example losing their preference for a larger food quantity if a human shows a preference for a smaller one, yet there is, so far, no explanation for this phenomenon. Using a modified version of this task, in the current study we investigated whether non-social, social or communicative cues (alone or in combination) cause dogs to go against their preference for the larger food quantity. Results show that dogs' evaluation errors are indeed caused by a social bias, but, somewhat contrary to previous studies, they highlight the potent effect of stimulus enhancement (handling the target) in influencing the dogs' response. A mild influence on the dog's behaviour was found only when different ostensive cues (and no handling of the target) were used in combination, suggesting their cumulative effect. The discussion addresses possible motives for discrepancies with previous studies suggesting that both the intentionality and the directionality of the action may be important in causing dogs' social biases.
Demodex canis: redescription and reevaluation.

Science.gov (United States)

Nutting, W B; Desch, C E

1978-04-01

A brief review of the taxonomy of Demodex canis is followed by a complete redescription. Demodex canis is diagnosed with D. odocoilei of the white-tailed deer. In view of the continued speculation that dogs and man share the same demodicid, simple morphological characters are noted which distinguish D. canis from D. folliculorum and D. brevis in all stages of their life cycles.
Cross-infection between cats and cows: Origin and control of Streptococcus canis mastitis in a dairy herd

OpenAIRE

Tikofsky, L L; Zadoks, R N

2005-01-01

Group G streptococci in animals usually belong to the species Streptococcus canis and are most commonly found in dogs and cats. Occasionally, Strep. canis is detected in milk from dairy cows. An outbreak of Strep. canis mastitis in a dairy herd is described. Based on results from bacterial culture and ribotyping, a cat with chronic sinusitis was the most likely source of the outbreak. Subsequent cow-to-cow transmission of Strep. canis was facilitated by poor udder health management, including...
Dicty_cDB: Contig-U01557-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22
SCM-positive Streptococcus canis are predominant among pet-associated group G streptococci.

Science.gov (United States)

Verkühlen, Gerd-Josef; Pägelow, Dennis; Valentin-Weigand, Peter; Fulde, Marcus

2016-01-01

Streptococcus (S.) canis is a neglected zoonotic pathogen with increasing impor- tance. Since knowledge about its distribution in pets in Germany is scant, we designed a study and tested 335 dogs and 71 cats for colonization by S. canis. S. canis was isolated from swabs taken from the perianal region by culture and subsequent identification was performed biochemically as well as by PCR. In total, 15.8% (53) of the canine and 8.5% (six) of the feline strains grown on Staphlyo- coccus/Streptococcus Selective Agar were tested positive for the Lancefield group G antigen. The vast majority of strains expressing the Lancefield Group G carbohy- drate (56 out of 59) were further identified as S. canis underlining their outstanding role among animal-associated Group G streptococci (GGS). Furthermore, 90.0% of the canine and 83.3% of the feline S. canis strains harbour the species-specific anti- phagocytic M protein homologue SCM, which has been described as an important virulence factor. In contrast, emm-genes typically encoded by human-specific GGS could not be detected in any of the S. canis isolates. Taken together, this study provides insights into the distribution of the neglected zoonotic pathogen S. canis in a population of pets in Germany. The presence of SCM in the vast majority of strains indicates their pathogenic potential.
Learning and owner-stranger effects on interspecific communication in domestic dogs (Canis familiaris).

Science.gov (United States)

Elgier, Angel M; Jakovcevic, Adriana; Mustaca, Alba E; Bentosela, Mariana

2009-05-01

Domestic dogs are very successful at following human cues like gazing or pointing to find hidden food in an object choice task. They solve this kind of situation at their first attempts and from early stages of their development and perform better than wolves. Most of the authors proposed that these abilities are a domestication product, and independent from learning processes. There are few systematic studies on the effects of learning on dogs' communicative skills. We aim to evaluate the effect of extinction and reversal learning procedures on the use of the pointing gesture in an object choice task. The results showed that dogs stopped following the pointing cue in the extinction and that they learned to choose the not pointed container in the reversal learning. Results suggest that instrumental learning plays an important role in interspecific communication mechanisms between humans and dogs. In both experiments for half of the subjects the pointer was the owner and for the rest was a stranger. A differential effect was found: extinction was slower but reversal learning was faster when the owner gave the cue. This data indicates that the relationship of the dog with the person who emits the cue influences performance.
Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

Index Scriptorium Estoniae

Häniläne,, pseud.

2008-01-01

Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)
Gene : CBRC-EEUR-01-0576 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID
Cross-infection between cats and cows: origin and control of Streptococcus canis mastitis in a dairy herd.

Science.gov (United States)

Tikofsky, L L; Zadoks, R N

2005-08-01

Group G streptococci in animals usually belong to the species Streptococcus canis and are most commonly found in dogs and cats. Occasionally, Strep. canis is detected in milk from dairy cows. An outbreak of Strep. canis mastitis in a dairy herd is described. Based on results from bacterial culture and ribotyping, a cat with chronic sinusitis was the most likely source of the outbreak. Subsequent cow-to-cow transmission of Strep. canis was facilitated by poor udder health management, including use of a common udder cloth and failure to use postmilking teat disinfection. Infected cows had macroscopically normal udders and milk, but significantly higher somatic cell counts than Strep. canis-negative herd mates. The outbreak was controlled through antibiotic treatment of lactating cows, early dry-off with dry cow therapy, culling of infected animals, and implementation of standard mastitis prevention measures. Cure was significantly more likely in dry-treated cows (87.5%) and cows treated during lactation (67%) than in untreated cows (9%). Whereas mastitis due to group G streptococci or Strep. canis in dairy cows is usually limited to sporadic cases of environmental (canine or feline) origin, this case study shows that crossing of the host species barrier by Strep. canis may result in an outbreak of mastitis if management conditions are conducive to contagious transmission. In such a situation, measures that are successful in control of Strep. agalactiae can also be used to control Strep. canis mastitis.
The Way Dogs (Canis familiaris Look at Human Emotional Faces Is Modulated by Oxytocin. An Eye-Tracking Study

Directory of Open Access Journals (Sweden)

Anna Kis

2017-10-01

Full Text Available Dogs have been shown to excel in reading human social cues, including facial cues. In the present study we used eye-tracking technology to further study dogs’ face processing abilities. It was found that dogs discriminated between human facial regions in their spontaneous viewing pattern and looked most to the eye region independently of facial expression. Furthermore dogs played most attention to the first two images presented, afterwards their attention dramatically decreases; a finding that has methodological implications. Increasing evidence indicates that the oxytocin system is involved in dogs’ human-directed social competence, thus as a next step we investigated the effects of oxytocin on processing of human facial emotions. It was found that oxytocin decreases dogs’ looking to the human faces expressing angry emotional expression. More interestingly, however, after oxytocin pre-treatment dogs’ preferential gaze toward the eye region when processing happy human facial expressions disappears. These results provide the first evidence that oxytocin is involved in the regulation of human face processing in dogs. The present study is one of the few empirical investigations that explore eye gaze patterns in naïve and untrained pet dogs using a non-invasive eye-tracking technique and thus offers unique but largely untapped method for studying social cognition in dogs.
A comparison of pet and purpose-bred research dog (Canis familiaris) performance on human-guided object-choice tasks.

Science.gov (United States)

Lazarowski, Lucia; Dorman, David C

2015-01-01

Several studies have shown that domestic dogs respond to human social cues such as pointing. Some experiments have shown that pet dogs outperformed wolves in following a momentary distal point. These findings have lent support to the hypothesis that domestication is responsible for domestic dogs' ability to utilize human gestures. Other studies demonstrating comparable performance in human-socialized wolves suggest this skill depends on experience with relevant human stimuli. However, domestic dogs lacking thorough exposure to humans are underrepresented in the comparative literature. The goal of this study was to evaluate pet and kennel-reared research domestic dogs on their ability to follow two types of point in an object-choice task. This study used young adult, intact male research dogs (n=11) and a comparison group of pet dogs living in human homes (n=9). We found that while pet dogs followed the momentary distal point above chance levels, research dogs did not. Both groups followed the simpler dynamic proximal point; however, pet dogs outperformed research dogs on this task. Our results indicate that ontogenetic experiences may influence a domestic dog's ability to use human gestures, highlighting the importance of testing different sub-populations of domestic dogs. Copyright © 2014 Elsevier B.V. All rights reserved.
Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in dogs in a village of eastern Sudan by using a screening PCR and sequencing methodologies.

Science.gov (United States)

Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

2005-11-01

Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis.
Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in Dogs in a Village of Eastern Sudan by Using a Screening PCR and Sequencing Methodologies

OpenAIRE

Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

2005-01-01

Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis.
FIRST CASE OF AUTOCHTHONOUS HUMAN VISCERAL LEISHMANIASIS IN THE URBAN CENTER OF RIO DE JANEIRO: CASE REPORT

Directory of Open Access Journals (Sweden)

Guilherme Almeida Rosa da Silva

2014-01-01

Full Text Available Visceral leishmaniasis is an anthropozoonosis that is caused by protozoa of the genus Leishmania, especially Leishmania (Leishmania infantum, and is transmitted to humans by the bite of sandflies of the genus Lutzomyia, such as Lutzomyia longipalpis. There are many reservoirs, including Canis familiaris. It is a chronic infectious disease with systemic involvement that is characterized by three phases: the initial period, the state period and the final period. The main symptoms are fever, malnutrition, hepatosplenomegaly, and pancytopenia. This article reports a case of a patient diagnosed with visceral leishmaniasis in the final period following autochthonous transmission in the urban area of Rio de Janeiro. The case reported here is considered by the Municipal Civil Defense and Health Surveillance of Rio de Janeiro to be the first instance of autochthonous visceral leishmaniasis in humans in the urban area of this city. The patient was discharged and is undergoing a follow-up at the outpatient clinic, demonstrating clinical improvement.
First case of autochthonous human visceral leishmaniasis in the urban center of Rio de Janeiro: case report.

Science.gov (United States)

Silva, Guilherme Almeida Rosa da; Boechat, Thiago de Oliveira; Ferry, Fernando Raphael de Almeida; Pinto, Jorge Francisco da Cunha; Azevedo, Marcelo Costa Velho Mendes de; Carvalho, Ricardo de Souza; Motta, Rogerio Neves; Veras, Mariana Ferreira

2014-01-01

Visceral leishmaniasis is an anthropozoonosis that is caused by protozoa of the genus Leishmania, especially Leishmania (Leishmania) infantum, and is transmitted to humans by the bite of sandflies of the genus Lutzomyia, such as Lutzomyia longipalpis. There are many reservoirs, including Canis familiaris. It is a chronic infectious disease with systemic involvement that is characterized by three phases: the initial period, the state period and the final period. The main symptoms are fever, malnutrition, hepatosplenomegaly, and pancytopenia. This article reports a case of a patient diagnosed with visceral leishmaniasis in the final period following autochthonous transmission in the urban area of Rio de Janeiro. The case reported here is considered by the Municipal Civil Defense and Health Surveillance of Rio de Janeiro to be the first instance of autochthonous visceral leishmaniasis in humans in the urban area of this city. The patient was discharged and is undergoing a follow-up at the outpatient clinic, demonstrating clinical improvement.
Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in Dogs in a Village of Eastern Sudan by Using a Screening PCR and Sequencing Methodologies

Science.gov (United States)

Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

2005-01-01

Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis. PMID:16275954
Scanning electron microscopy description of a new species of Demodex canis spp.

Science.gov (United States)

Tamura, Y; Kawamura, Y; Inoue, I; Ishino, S

2001-10-01

Between 1997 and 1999, the prevalence of Demodex canis mites was determined in 150 dogs. In two dogs, we found two different species of mites; Demodex canis and another, unidentified, Demodex mite. The unidentified Demodex mite species had several different morphological features. First, it had a short opisthosoma and an obtuse end. In addition, the fourth coxisternal plate was rectangular and there was a band-like segmental plate between the fourth coxisternal plate and opisthosoma. Although all of the morphology and the development of male mites could not be investigated in this study, the location of the opisthosoma and the genital pore clearly differed from Demodex canis, suggesting that this unidentified mite is a new species.

Breed differences in dogs sensitivity to human points: a meta-analysis.

Science.gov (United States)

Dorey, Nicole R; Udell, Monique A R; Wynne, Clive D L

2009-07-01

The last decade has seen a substantial increase in research on the behavioral and cognitive abilities of pet dogs, Canis familiaris. The most commonly used experimental paradigm is the object-choice task in which a dog is given a choice of two containers and guided to the reinforced object by human pointing gestures. We review here studies of this type and attempt a meta-analysis of the available data. In the meta-analysis breeds of dogs were grouped into the eight categories of the American Kennel Club, and into four clusters identified by Parker and Ostrander [Parker, H.G., Ostrander, E.A., 2005. Canine genomics and genetics: running with the pack. PLoS Genet. 1, 507-513] on the basis of a genetic analysis. No differences in performance between breeds categorized in either fashion were identified. Rather, all dog breeds appear to be similarly and highly successful in following human points to locate desired food. We suggest this result could be due to the paucity of data available in published studies, and the restricted range of breeds tested.
Phylogenetic Analysis of C Type Lectin from Toxocara canis Infective Larvae and Comparison with the C Type Lectin Fam-ily in the Immune System of Mouse and Human

Directory of Open Access Journals (Sweden)

Fazeleh ETEBAR

2018-03-01

Full Text Available Background: C type lectin (CTL family is a type of calcium-dependent proteins found in vertebrates and invertebrates. The objective of this study was to perform a comparative analysis and phylogenetic inferring for understanding the similarities and differences of carbohydrate recognition domain (CRD domain of Toxocara canis CTL and other nematodes, and similar C type lectin involved in the immune system of mouse and human as their host.Methods: The female T. canis was retrieved from the 2-6 months puppies (Department of Parasitology, Faculty of Veterinary Medicine, University of Tehran, 2015. To collect T. canis eggs, the worms were cultured for 5 d until they were embryonated. The hatching process was accelerated for collecting the stage 2 larvae, and the larvae were cultured for a week. A cDNA library was made from the total mRNA of T. canis infective larvae. The PCR amplification for C type lectin gene was performed and the amino acids were analyzed using the alignment method and the construction of phylogenetic tree.Results: The suspension sample maintained at 30 ºC for four weeks could embryonate 90%-100% of eggs. T. canis CTL gene was 657 bp in length and encoded a protein with 219 amino acids. The CTL of species of Strongylida order were closely placed in the tree, whereas the members of Ascaridida orders were located in a separate branch. High levels of similarity (36%-44% and conservation of C type lectin from T. canis with mouse and human C type lectins. Its C type lectin showed a higher similarity with asialoglycoprotein receptor (ASGPR, macrophage lectin, dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin (DC-SIGN, MINCLE receptor of mouse and human.Conclusion: Analysis of CRD domain of C type lectin protein could make a better understanding of their role in the interaction of nematode parasite with their hosts.
Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs

Directory of Open Access Journals (Sweden)

Ciarmela, M. L.

2010-01-01

Full Text Available The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated and scored according to Lỳsek’s ovicidal effect classification. These procedures were repeated three times which each fungal species. Chrysosporium merdarium and F. oxysporum showed very high ovicidal activity, F. sulphureum high ovicidal activity, F. moniliforme intermediate ovicidal activity and T. harzianum did not affect the viability of T. canis eggs. Taking into account the effects on human and animal health and the environment, the species with better prospects for studying its potential use as biological control was F. sulphureum.
NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-134 48% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 2e-98 40% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0695 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-107 43% ...
Primers for polymerase chain reaction to detect genomic DNA of Toxocara canis and T. cati.

Science.gov (United States)

Wu, Z; Nagano, I; Xu, D; Takahashi, Y

1997-03-01

Primers for polymerase chain reaction to amplify genomic DNA of both Toxocara canis and T. cati were constructed by adapting cloning and sequencing random amplified polymorphic DNA. The primers are expected to detect eggs and/or larvae of T. canis and T. cati, both of which are known to cause toxocariasis in humans.
A case report: a dog with acute onset of Hepatozoon canis infection.

Science.gov (United States)

Sakuma, Masato; Nakahara, Yoshitaka; Suzuki, Hiroyuki; Uchimura, Masato; Sekiya, Zin; Setoguchi, Asuka; Endo, Yasuyuki

2009-06-01

We present a clinical overview of a dog with acute onset of Hepatozoon canis infection. A stray female beagle dog of unknown age was referred to Kagoshima University showing anemia. Blood tests revealed the presence of anemia, thrombocytopenia, hyperproteinemia, polyclonal gammopathy, hypoalbuminemia, and elevated creatine kinase and alkaline phosphatase activities. In addition, capsule-like organisms were detected in the cytoplasm of approximately 50% of neutrophils in blood smears. H. canis infection was confirmed by polymerase chain reaction and DNA sequencing analyses. Amplified DNA fragments revealed 100% identity to the 18S ribosomal RNA gene of H. canis. The clinical symptoms improved after the administration of antibiotics. Hepatozoonosis in dogs is rare, but veterinarians should be alert to its possible acute onset.
Dogs (Canis familiaris, but not chimpanzees (Pan troglodytes, understand imperative pointing.

Directory of Open Access Journals (Sweden)

Katharina C Kirchhofer

Full Text Available Chimpanzees routinely follow the gaze of humans to outside targets. However, in most studies using object choice they fail to use communicative gestures (e.g. pointing to find hidden food. Chimpanzees' failure to do this may be due to several difficulties with this paradigm. They may, for example, misinterpret the gesture as referring to the opaque cup instead of the hidden food. Or perhaps they do not understand informative communicative intentions. In contrast, dogs seem to be skilful in using human communicative cues in the context of finding food, but as of yet there is not much data showing whether they also use pointing in the context of finding non-food objects. Here we directly compare chimpanzees' (N = 20 and dogs' (N = 32 skills in using a communicative gesture directed at a visible object out of reach of the human but within reach of the subject. Pairs of objects were placed in view of and behind the subjects. The task was to retrieve the object the experimenter wanted. To indicate which one she desired, the experimenter pointed imperatively to it and directly rewarded the subject for handing over the correct one. While dogs performed well on this task, chimpanzees failed to identify the referent. Implications for great apes' and dogs' understanding of human communicative intentions are discussed.
Abnormal neurobehaviour and impaired memory function as a consequence of Toxocara canis- as well as Toxocara cati-induced neurotoxocarosis.

Directory of Open Access Journals (Sweden)

Elisabeth Janecek

2017-05-01

Full Text Available Neuroinvasive larvae of the worldwide occurring zoonotic roundworms Toxocara canis and T. cati may induce neurotoxocarosis (NT in humans, provoking a variety of symptoms including cognitive deficits as well as neurological dysfunctions. An association with neuropsychological disorders has been discussed. Similar symptoms have been described in T. canis-infected mice, whereas data on T. cati-induced NT are rare. Therefore, it was aimed to obtain insights into the impact on neurobehaviour as well as progression of neurological symptoms and behavioural alterations during the course of NT directly comparing T. canis- and T. cati-infected mice as models for human NT.C57BL/6 mice were orally infected with 2000 embryonated T. canis or T. cati eggs, respectively, the control group received tap water. Mice were screened weekly for neurobehavioural alterations and memory function starting one day prior infection until 97 days post infection (pi; T. canis-infection and day 118 pi (T. cati-infection, uninfected control. Mostly motoric and neurological parameters were affected in T. canis-infected mice starting day 20 pi with severe progression accompanied by stereotypical circling. In contrast, T. cati-infected mice mostly showed reduced response to sudden sound stimulus (indicator for excitability and flight behaviour starting day 6 pi. Interestingly, enhanced grooming behaviour was observed exclusively in T. cati-infected mice, indicating a possible role of neurotransmitter dysregulation. Reduced exploratory behaviour and memory impairment was observed in both infection groups with delayed onset and less severe progression in T. cati- compared to T. canis-infected mice.Results highlight the need to consider T. cati beside T. canis as causative agent of human NT. Findings provide valuable hints towards differences in key regulatory mechanisms during T. canis- and T. cati-induced NT, contributing to a comprehensive picture and consequently a broader
[Characterization of the genetic variability of field strains of Brucella canis isolated in Antioquia].

Science.gov (United States)

Vidal Arboleda, Juana L; Ortiz Roman, Luisa F; Olivera Angel, Martha

2017-12-22

Brucella canis is a facultative intracellular pathogen responsible for canine brucellosis, a zoonotic disease that affects canines, causing abortions and reproductive failure; and the production of non-specific symptoms in humans. In 2005 the presence of B. canis in Antioquia was demonstrated and the strains were identified as type 2. The sequencing of the genome of a field strain denoted Brucella canis str. Oliveri, showed species-specific indel events, which led us to investigate the genomic characteristics of the B. canis strain isolated and to establish the phylogenetic relationships and the divergence time of B. canis str. Oliveri. Conventional PCR sequencing was performed in 30 field strains identifying 5 indel events recognized in B. canis str. Oliveri. ADN from Brucella suis, Brucella melitensis and vaccine strains from Brucella abortus were used as control, and it was determined that all of the studied field strains shared 4 out of the 5 indels of the sequenced Oliveri strain, indicating the presence of more than one strain circulating in the region. Phylogenetic analysis was performed with 24 strains of Brucella using concatenated sequences of genetic markers for species differentiation. The molecular clock hypothesis and Tajima's relative rate test were tested, showing that the Oliveri strain, similarly to other canis species, diverged from B. suis. The molecular clock hypothesis between Brucella species was rejected and an evolution rate and a similar genetic distance between the B. canis were demonstrated. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
The attribution of navigational- and goal-directed agency in dogs (Canis familiaris) and human toddlers (Homo sapiens).

Science.gov (United States)

Tauzin, Tibor; Csík, Andor; Lovas, Kata; Gergely, György; Topál, József

2017-02-01

Both human infants and nonhuman primates can recognize unfamiliar entities as instrumental agents ascribing to them goals and efficiency of goal-pursuit. This competence relies on movement cues indicating distal sensitivity to the environment and choice of efficient goal-approach. Although dogs' evolved sensitivity to social cues allow them to recognize humans as communicative agents, it remains unclear whether they have also evolved a basic concept of instrumental agency. We used a preferential object-choice procedure to test whether adult pet dogs and human toddlers can identify unfamiliar entities as agents based on different types of movement cues that specify different levels of agency. In the navigational agency condition, dogs preferentially chose an object that modified its pathway to avoid collision with obstacles over another object showing no evidence of distal sensitivity (regularly bumping into obstacles). However, in the goal-efficiency condition where neither object collided with obstacles as it navigated toward a distal target, but only 1 of them exhibited efficient goal-approach as well, toddlers, but not dogs, showed a preference toward the efficient goal-directed agent. These findings indicate that dogs possess a limited concept of environmentally sensitive navigational agency that they attribute to self-propelled entities capable of modifying their movement to avoid colliding with obstacles. Toddlers, in contrast, demonstrated clear sensitivity to cues of efficient variability of goal-approach as the basis for differentiating, attributing, and showing preference for goal-directed instrumental agency. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Comparative study of Microsporum canis isolates by DNA fingerprinting.

Science.gov (United States)

Shafiee, Shabnam; Khosravi, Ali Reza; Ashrafi Tamai, Iradj

2014-08-01

Microsporum canis is a zoophilic fungus and it is an important agent of dermatophytosis. Cats act as important reservoirs. Clinically, it is too difficult to differentiate dermatophytosis caused by various species, also this fungus loses its morphological characteristics easily because of subculture; so using of rapid and accurate laboratory techniques for identifying the dermatophytes is important, therefore, RAPD-PCR was applied for the differentiation of the isolates. In this study, 10 M. canis isolates were detected in cats, dog, human, fox and rabbit at the Mycology Research Center, Faculty of Veterinary Medicine, University of Tehran. For running the RAPD-PCR, PCR set system and three random primers OPU 15, OPU 13 and OPA 04 were used. Then phylogenetic tree and similarity coefficient table were drawn. The results showed that there were some common bands between M. canis isolates. There were some specific bands for each isolates, as well. Our study showed, despite the typical morphology of the whole isolates, they were placed in different branches in molecular typing. © 2014 Blackwell Verlag GmbH.
Meta-analysis of relationships between human offtake, total mortality and population dynamics of gray wolves (Canis lupus).

Science.gov (United States)

Creel, Scott; Rotella, Jay J

2010-09-29

Following the growth and geographic expansion of wolf (Canis lupus) populations reintroduced to Yellowstone National Park and central Idaho in 1995-1996, Rocky Mountain wolves were removed from the endangered species list in May 2009. Idaho and Montana immediately established hunting seasons with quotas equaling 20% of the regional wolf population. Combining hunting with predator control, 37.1% of Montana and Idaho wolves were killed in the year of delisting. Hunting and predator control are well-established methods to broaden societal acceptance of large carnivores, but it is unprecedented for a species to move so rapidly from protection under the Endangered Species Act to heavy direct harvest, and it is important to use all available data to assess the likely consequences of these changes in policy. For wolves, it is widely argued that human offtake has little effect on total mortality rates, so that a harvest of 28-50% per year can be sustained. Using previously published data from 21 North American wolf populations, we related total annual mortality and population growth to annual human offtake. Contrary to current conventional wisdom, there was a strong association between human offtake and total mortality rates across North American wolf populations. Human offtake was associated with a strongly additive or super-additive increase in total mortality. Population growth declined as human offtake increased, even at low rates of offtake. Finally, wolf populations declined with harvests substantially lower than the thresholds identified in current state and federal policies. These results should help to inform management of Rocky Mountain wolves.
Meta-analysis of relationships between human offtake, total mortality and population dynamics of gray wolves (Canis lupus.

Directory of Open Access Journals (Sweden)

Scott Creel

Full Text Available Following the growth and geographic expansion of wolf (Canis lupus populations reintroduced to Yellowstone National Park and central Idaho in 1995-1996, Rocky Mountain wolves were removed from the endangered species list in May 2009. Idaho and Montana immediately established hunting seasons with quotas equaling 20% of the regional wolf population. Combining hunting with predator control, 37.1% of Montana and Idaho wolves were killed in the year of delisting. Hunting and predator control are well-established methods to broaden societal acceptance of large carnivores, but it is unprecedented for a species to move so rapidly from protection under the Endangered Species Act to heavy direct harvest, and it is important to use all available data to assess the likely consequences of these changes in policy. For wolves, it is widely argued that human offtake has little effect on total mortality rates, so that a harvest of 28-50% per year can be sustained. Using previously published data from 21 North American wolf populations, we related total annual mortality and population growth to annual human offtake. Contrary to current conventional wisdom, there was a strong association between human offtake and total mortality rates across North American wolf populations. Human offtake was associated with a strongly additive or super-additive increase in total mortality. Population growth declined as human offtake increased, even at low rates of offtake. Finally, wolf populations declined with harvests substantially lower than the thresholds identified in current state and federal policies. These results should help to inform management of Rocky Mountain wolves.
Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis

Directory of Open Access Journals (Sweden)

Richards Vincent P

2012-12-01

Full Text Available Abstract Background Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Results Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection. A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs [plasmid, phage, integrative conjugative element (ICE] and comparison to other species provided convincing evidence for lateral gene transfer (LGT between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae, with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST of a subset of the isolates (n = 45 detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types], suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. Conclusion This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human
Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis.

Science.gov (United States)

Richards, Vincent P; Zadoks, Ruth N; Pavinski Bitar, Paulina D; Lefébure, Tristan; Lang, Ping; Werner, Brenda; Tikofsky, Linda; Moroni, Paolo; Stanhope, Michael J

2012-12-18

Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection). A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs) [plasmid, phage, integrative conjugative element (ICE)] and comparison to other species provided convincing evidence for lateral gene transfer (LGT) between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae), with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST) of a subset of the isolates (n = 45) detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types]), suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates) occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human bacteria (Streptococcus urinalis) is cause for concern
Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis

Science.gov (United States)

2012-01-01

Background Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Results Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection). A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs) [plasmid, phage, integrative conjugative element (ICE)] and comparison to other species provided convincing evidence for lateral gene transfer (LGT) between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae), with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST) of a subset of the isolates (n = 45) detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types]), suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates) occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. Conclusion This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human bacteria (Streptococcus
Tissue distribution and functional analysis of vitellogenin-6 of Toxocara canis.

Science.gov (United States)

Zhu, Hong-Hong; Ma, Guang-Xu; Luo, Yong-Fang; Luo, Yong-Li; Yin, Sha-Sha; Xiong, Yi; Zhou, Rong-Qiong

2017-06-01

Toxocara canis is an common intestinal nematode of canids and the principal causative agent of human toxocariasis. Vitellogenin (Vg), a source of amino acids and lipids in the eggs, are considered to play an important role in embryo development of a wide range of organisms. In the present study, the transcriptional levels of Tc-vit-6 gene in male and female adult T. canis were determined by quantitative real-time PCR, which indicated high transcription of Tc-vit-6 in the intestine, reproductive tract and body wall of male and female adult T. canis. The fragment of Tc-vit-6 encoding a vWD domain, was cloned and expressed to produce a rabbit anti-TcvWD polyclonal antibody. Tissue distribution of TcVg6 was detected by immunohistochemical assays, which showed predominant distribution of TcVg6 in the tissues of intestine, as well as reproductive tract (including some of the germ cells) and musculature of male and female adult worms. Collectively, these results indicated multiple biological roles of TcVg6 apart from that in the reproduction of T. canis. Copyright © 2017 Elsevier Inc. All rights reserved.
Neospora caninum and Ehrlichia canis co-infection in a dog with meningoencephalitis.

Science.gov (United States)

Aroch, Itamar; Baneth, Gad; Salant, Harold; Nachum-Biala, Yaarit; Berkowitz, Asaf; Shamir, Merav; Chai, Orit

2018-06-01

An 8-year-old mixed-breed dog was presented for acute, progressive weakness and ataxia, inappetence, and weight loss. The patient was mentally normal, but nonambulatory, with a right head tilt, right positional ventral strabismus, and slight head tremors. A neurologic lesion was localized to the cerebellum and right brainstem. Cerebrospinal fluid (CSF) analysis showed a markedly increased protein concentration and mixed pleocytosis, with eosinophil predominance (44%), intracytoplasmic inclusions within eosinophils, consistent with Ehrlichia canis (E canis) morulae, and Toxoplasma gondii (T gondii) or Neospora caninum (N caninum) tachyzoites within eosinophils and monocytes. A serum indirect immunofluorescent antibody test was positive for N caninum (titer 1:12 800) and negative for T gondii. Both blood and CSF PCR results were N caninum- and E canis-positive and T gondii- and Anaplasma phagocytophilum-negative, and blood PCR, but not CSF PCR, was Hepatozoon canis-positive. The dog was treated for 30 days with clindamycin, sulfamethoxazole-trimethoprim, doxycycline, prednisone, and cephalosporin, but did not improve neurologically, and was euthanized. Brain histopathology showed moderate multifocal, subacute meningoencephalitis with necrosis and gliosis. The neurologic disease was mostly attributed to central nervous system (CNS) neosporosis, with the possible contribution of ehrlichiosis, which was likely a manifestation of blood-brain barrier disruption. Hepatozoonosis was probably a result or cause of underlying immunosuppression. To our knowledge, this is the first report of CNSN caninum and E canis co-infection detected by both CSF PCR and cytology and E canis morulae identified within CSF eosinophils. © 2018 American Society for Veterinary Clinical Pathology.

Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

Science.gov (United States)

Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

2016-07-01

Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. Copyright © 2016
The infection of questing Dermacentor reticulatus ticks with Babesia canis and Anaplasma phagocytophilum in the Chernobyl exclusion zone.

Science.gov (United States)

Karbowiak, Grzegorz; Vichová, Bronislavá; Slivinska, Kateryna; Werszko, Joanna; Didyk, Julia; Peťko, Branislav; Stanko, Michal; Akimov, Igor

2014-08-29

Tick occurrence was studied in the Chernobyl exclusion zone (CEZ) during the August-October 2009-2012. Dermacentor reticulatus ticks were collected using the flagging method and then screened for infection with Anaplasma phagocytophilum and Babesia canis by a PCR method incorporating specific primers and sequence analysis. The prevalence of infection with B. canis canis and A. phagocytophilum was found to be 3.41% and 25.36%, respectively. The results present the first evidence of B. canis canis and A. phagocytophilum in questing D. reticulatus ticks from the Chernobyl exclusion zone. They also reveal the presence of tick-borne disease foci in areas with no human activity, and confirm that they can be maintained in areas after a nuclear disaster with radioactive contamination. Copyright © 2014 Elsevier B.V. All rights reserved.
Molecular detection of Hepatozoon canis and Babesia canis vogeli in domestic dogs from Cuiabá, Brazil.

Science.gov (United States)

Spolidorio, Mariana Granziera; Torres, Mariana de Medeiros; Campos, Wilma Neres da Silva; Melo, Andréia Lima Tomé; Igarashi, Michelle; Amude, Alexandre Mendes; Labruna, Marcelo Bahia; Aguiar, Daniel Moura

2011-01-01

The objective of this study was to report for the first time infection by Hepatozoon spp. and Babesia spp. in 10 dogs from the city of Cuiabá, State of Mato Grosso, central-western Brazil. A pair of primers that amplifies a 574 bp fragment of the 18S rRNA of Hepatozoon spp., and a pair of primers that amplifies a 551 bp fragment of the gene 18S rRNA for Babesia spp. were used. Six dogs were positive for Babesia spp., and 9 were positive for Hepatozoon spp. Co‑infection of Babesia spp. and Hepatozoon spp. was seen in 5 dogs. Sequenced samples revealed 100% identity with B. canis vogeli, and H. canis. This is the first molecular detection of H. canis in domestic dogs from Cuiabá. Additionally, it is described for the first time the presence of B. canis vogeli circulating among dogs in Cuiabá.
Molecular detection of Hepatozoon canis and Babesia canis vogeli in domestic dogs from Cuiabá, Brazil Detecção molecular de Hepatozoon canis e Babesia canis vogeli em cães domésticos de Cuiabá, Brasil

Directory of Open Access Journals (Sweden)

Mariana Granziera Spolidorio

2011-09-01

Full Text Available The objective of this study was to report for the first time infection by Hepatozoon spp. and Babesia spp. in 10 dogs from the city of Cuiabá, State of Mato Grosso, central-western Brazil. A pair of primers that amplifies a 574 bp fragment of the 18S rRNA of Hepatozoon spp., and a pair of primers that amplifies a 551 bp fragment of the gene 18S rRNA for Babesia spp. were used. Six dogs were positive for Babesia spp., and 9 were positive for Hepatozoon spp. Co-infection of Babesia spp. and Hepatozoon spp. was seen in 5 dogs. Sequenced samples revealed 100% identity with B. canis vogeli, and H. canis. This is the first molecular detection of H. canis in domestic dogs from Cuiabá. Additionally, it is described for the first time the presence of B. canis vogeli circulating among dogs in Cuiabá.O objetivo deste estudo foi relatar pela primeira vez a infecção por Hepatozoon spp. e Babesia spp. em cães domésticos provenientes da cidade de Cuiabá, estado de Mato Grosso. Foram utilizados pares de primers que amplificam um fragmento de 574 pb do gene 18S rRNA de Hepatozoon spp., e 551 pb do gene 18S rRNA para Babesia spp. Dos 10 cães amostrados, 6 apresentaram-se positivos para Babesia spp., e 9 foram positivos para Hepatozoon spp. pela PCR. Co-infecção entre Babesia spp. e Hepatozoon spp. ocorreu em 5 cães. As amostras revelaram 100% de identidade com B. canis vogeli, e as amostras que foram positivas para Hepatozoon spp. foram 100% idênticas a H. canis. Esta é a primeira identificação molecular de H. canis em cães domésticos em Cuiabá. Adicionalmente, descrevemos pela primeira vez a presença de B. canis vogeli circulando entre cães em Cuiabá.
NCBI nr-aa BLAST: CBRC-CINT-01-0147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0147 ref|XP_547405.2| PREDICTED: similar to Feline leukemia virus subg...roup C receptor-related protein 1 (Feline leukemia virus subgroup C receptor) (hFLVCR) [Canis familiaris] XP_547405.2 2e-76 47% ...
Development of multiplex polymerase chain reaction for detection of Ehrlichia canis, Babesia spp and Hepatozoon canis in canine blood.

Science.gov (United States)

Kledmanee, Kan; Suwanpakdee, Sarin; Krajangwong, Sakranmanee; Chatsiriwech, Jarin; Suksai, Parut; Suwannachat, Pongpun; Sariya, Ladawan; Buddhirongawatr, Ruangrat; Charoonrut, Phingphol; Chaichoun, Kridsada

2009-01-01

A multiplex polymerase chain reaction (PCR) has been developed for simultaneous detection of canine blood parasites, Ehrlichia canis, Babesia spp and Hepatozoon canis, from blood samples in a single reaction. The multiplex PCR primers were specific to E. canis VirB9, Babesia spp 16S rRNA and H. canis 16S rRNA genes. Specificity of the amplicons was confirmed by DNA sequencing. The assay was evaluated using normal canine and infected blood samples, which were detected by microscopic examination. This multiplex PCR offers scope for simultaneous detection of three important canine blood parasites and should be valuable in monitoring parasite infections in dogs and ticks.
Estructura comunitaria de helmintos de perros vagabundos de San Juan de Lurigancho, Lima, Perú Community structure of helminths in stray dogs from San Juan de Lurigancho, Lima, Peru

Directory of Open Access Journals (Sweden)

José O. Iannacone

2001-07-01

Full Text Available Thirty stray dogs Canis familiaris Linnaeus, 1758 were collected in San Juan de Lurigancho, Lima, Peru, between January and March 1997 and necropsied for helminths. Three species were collected: the cestodes Dipylidium caninum (Linnaeus, 1758 Railliet, 1892 and Taenia pisiformis (Bloch, 1780 and the nematode Toxocara canis (Werner, 1782 Stiles, 1905. Fifty per cent of the examined dogs showed one or two parasites. A total of 303 (0-116 helminths were recovered and the intensity of infection was 30,3. The Simpson index (C for all parasite species was 0,414, indicating a dominance by one species in the parasite community. The mean diversity in the infracommunities of C. familiaris was H' = 0,038 and uniformity index of Pielou J = 0,207. Dipylidium caninum, T. pisiformis, and T. canis presented a prevalence of infection of 33,30%, 10% and 16,6% respectively. Dipylidium caninum presented the highest frequency and mean intensity of infection. Dipylidium caninum was the helminth with the highest dominance (94% whereas the lowest was due to T. pisiformis (4% and T. canis (2%. Helminths were not related to the age of the hosts, prevalence and mean intensity of infection. Out of the 10 equally divided segments of the intestinal gut, D. caninum was found from the 6th to the 9th segment. T canis preferred almost exclusively the 1st segment while T. pisiformis was randomly distributed.
The Mitochondrial Genome of Toxocara canis

OpenAIRE

Jex, Aaron R.; Waeschenbach, Andrea; Littlewood, D. Timothy J.; Hu, Min; Gasser, Robin B.

2008-01-01

Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provid...
Survival and infectivity of Sarcoptes scabiei var. canis and var. hominis.

Science.gov (United States)

Arlian, L G; Runyan, R A; Achar, S; Estes, S A

1984-08-01

Sarcoptes scabiei var. canis served as a suitable model for the study of S. scabiei var. hominis survival. S. scabiei var. canis and var. hominis mites were found to survive off the host for 24 to 36 hours at room conditions (21 degrees C and 40% to 80% relative humidity [RH]), and the canine variety survived 19 days at 10 degrees C and 97% RH. Female mites survived decidedly longer than male mites at comparable conditions. Generally, higher RH values and lower temperatures favored survival, whereas higher temperature and lower RH led to early death. Most canine scabies mites that were held off the host for 36 hours at 75% RH and 22 degrees to 24 degrees C remained infective and penetrated when returned to the host. Live mites of the human variety that were recovered from bed linen slept on by infested patients would also penetrate a host after being held off a host for 96 hours in alternating 12-hour periods of room conditions and refrigeration. Penetration required less than 30 minutes for all life stages of both varieties, and it was accomplished by a mite secretion that dissolved the host tissue. Dislodged mites, particularly those in close proximity to the source, can be a likely source of infestation.
Fatal Babesia canis canis infection in a splenectomized Estonian dog.

Science.gov (United States)

Tiškina, Valentina; Capligina, Valentina; Must, Külli; Berzina, Inese; Ranka, Renate; Jokelainen, Pikka

2016-01-25

A previously splenectomized dog from Estonia was presented with a sudden lack of appetite and discoloration of the urine. Despite supportive therapy, its condition deteriorated dramatically during 1 day. Severe thrombocytopenia and high numbers of protozoan hemoparasites were evident in blood smears, and the hematocrit dropped from 46 to 33 %. The dog was euthanized before specific antibabesial treatment was initiated. Blood samples from the dog and from two other dogs in the same household tested positive for Babesia using molecular methods, and the sequences of partial 18S rRNA gene confirmed the causative species as Babesia canis canis. The risk of severe, rapidly progressing babesiosis in splenectomized dogs merits awareness.
Dog handlers' and dogs' emotional and cortisol secretion responses associated with animal-assisted therapy sessions

NARCIS (Netherlands)

Haubenhofer, D.K.; Kirchengast, S.

2007-01-01

The study investigated 13 dog handlers and 18 companion dogs (Canis familiaris) working as teams in nonhuman animal-assisted service. The handlers described in questionnaires what emotions they chose to associate with their daily life and therapeutic work. They described their emotional condition
Experimental evidence against transmission of Hepatozoon canis by Ixodes ricinus.

Science.gov (United States)

Giannelli, Alessio; Ramos, Rafael Antonio Nascimento; Dantas-Torres, Filipe; Mencke, Norbert; Baneth, Gad; Otranto, Domenico

2013-09-01

Hepatozoon canis is among the most widespread tick-borne protozoa infecting domestic and wild carnivores. Its distribution is related to the occurrence of its major vector, the brown dog tick Rhipicephalus sanguineus. However, the role of Ixodes ricinus as a vector of H. canis has been hypothesized. In the present study, the development of H. canis was investigated in I. ricinus and R. sanguineus nymphs collected from a naturally infested dog. All I. ricinus ticks examined (n=133) were negative by cytological examination at days 20, 30, and 90 post collection, although H. canis DNA was detected in one nymph at day 20 and in 2 nymphs at day 30 post collection. On the other hand, H. canis sporogony was documented by cytology, and H. canis DNA was detected by PCR in R. sanguineus at day 30 post collection. These results indicate that H. canis sporogony does not occur in I. ricinus, but in R. sanguineus, suggesting that I. ricinus does not act as a vector of H. canis. Copyright © 2013 Elsevier GmbH. All rights reserved.
MRI findings of spinal visceral larva migrans of Toxocara canis

Energy Technology Data Exchange (ETDEWEB)

Lee, In Ho, E-mail: leeinho1974@hanmail.ne [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: st7.kim@hotmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: odk6464@nate.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: drpjeon@gmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)

2010-08-15

Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.
MRI findings of spinal visceral larva migrans of Toxocara canis

International Nuclear Information System (INIS)

Lee, In Ho; Kim, Sung Tae; Oh, Dae Kun; Kim, Hyung-Jin; Kim, Keon Ha; Jeon, Pyoung; Byun, Hong Sik

2010-01-01

Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.
Dicty_cDB: CHK317 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag
50 CFR 14.4 - What terms do I have to understand?

Science.gov (United States)

2010-10-01

... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...
The retinal fascin gene 2 (FSCN2) - partial structural analysis and polymorphisms detection in dogs with progressive retinal atrophy (PRA)

Czech Academy of Sciences Publication Activity Database

Horák, Pavel; Knoll, Aleš; Dvořák, J.

2006-01-01

Roč. 47, č. 4 (2006), s. 361-364 ISSN 1234-1983 R&D Projects: GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : canis familiaris * FSCN2 gene * PCR-RFLP Subject RIV: EB - Genetics ; Molecular Biology
Can f 1 levels in hair and homes of different dog breeds: Lack of evidence to describe any dog breed as hypoallergenic

NARCIS (Netherlands)

Vredegoor, D.W.; Willemse, T.; Chapman, M.D.; Heederik, D.J.J.; Krop, E.J.M.

2012-01-01

BACKGROUND Certain dog breeds are described and marketed as being "hypoallergenic" on the basis of anecdotal reports that these dogs are better tolerated by patients allergic to dogs. OBJECTIVE These observations were investigated by comparing Can f 1 (major dog [Canis familiaris] allergen) levels
Road Killed Carnivores Illustrate the Status of Zoonotic Helminthes in Caspian Sea Littoral of Iran.

Science.gov (United States)

Vafae Eslahi, Aida; Kia, Eshrat Beigom; Mobedi, Iraj; Sharifdini, Meysam; Badri, Milad; Mowlavi, Gholamreza

2017-01-01

Carnivore carcasses on the roads can be regarded as study materials in parasitology and eco-epidemiology. Stray carnivores such as dogs and cats are known to harbor so many different pathogens like zoonotic helminthes. The current investigation, apparent the status of the helminthic parasites found in road killed carnivores from different parts of Guilan Province north of Iran. Fifty road killed carnivores including 27 stray dogs ( Canis familiaris ), 11 golden jackals ( Canis aureus ) and 12 stray cats ( Felis catus ) were collected from 21 locations of Guilan Province, during Apr to Nov 2015. Internal organs of the carcasses, including digestive tract, heart, kidneys, lungs, liver, skin, eyes as well as muscles were carefully inspected and sampled for helminthological investigation. About 80% of the 50 carnivores, (stray dogs 77.77%, golden jackals 81.81%, and stray cats 91.66%) were found naturally infected with helminthic parasites. Dipylidum caninum , Toxocara cati , Toxocara canis , Toxascaris leonine , Ancylostoma caninum , Ancylostoma tubaeforme , Dirofilaria immitis , Dioctophyma renale , Dipylidum caninum , Echinococcus granulosus , Mesocestoides spp ., Taenia hydatigena, Taenia hydatigera , Joyuxiella spp. , Spirometra spp. are reported herein. The prevalent occurrence of zoonotic helminthes such as T. canis , T. cati , T. leonina , E. granulosus , D. immitis and D. renale in stray carnivores should be considered as a public health hazard, specifically within a vast tourism area like Guilan Province.
Road Killed Carnivores Illustrate the Status of Zoonotic Helminthes in Caspian Sea Littoral of Iran

Directory of Open Access Journals (Sweden)

Aida VAFAE ESLAHI

2017-06-01

Full Text Available Background: Carnivore carcasses on the roads can be regarded as study materials in parasitology and eco-epidemiology. Stray carnivores such as dogs and cats are known to harbor so many different pathogens like zoonotic helminthes. The current investigation, apparent the status of the helminthic parasites found in road killed carnivores from different parts of Guilan Province north of Iran.Methods: Fifty road killed carnivores including 27 stray dogs (Canis familiaris, 11 golden jackals (Canis aureus and 12 stray cats (Felis catus were collected from 21 locations of Guilan Province, during Apr to Nov 2015. Internal organs of the carcasses, including digestive tract, heart, kidneys, lungs, liver, skin, eyes as well as muscles were carefully inspected and sampled for helminthological investigation.Results: About 80% of the 50 carnivores, (stray dogs 77.77%, golden jackals 81.81%, and stray cats 91.66% were found naturally infected with helminthic parasites. Dipylidum caninum, Toxocara cati, Toxocara canis, Toxascaris leonine, Ancylostoma caninum, Ancylostoma tubaeforme, Dirofilaria immitis, Dioctophyma renale, Dipylidum caninum, Echinococcus granulosus, Mesocestoides spp., Taenia hydatigena, Taenia hydatigera, Joyuxiella spp., Spirometra spp. are reported herein.Conclusion: The prevalent occurrence of zoonotic helminthes such as T. canis, T. cati, T. leonina, E. granulosus, D. immitis and D. renale in stray carnivores should be considered as a public health hazard, specifically within a vast tourism area like Guilan Province.

Rhipicephalus turanicus, a new vector of Hepatozoon canis.

Science.gov (United States)

Giannelli, Alessio; Lia, Riccardo Paolo; Annoscia, Giada; Buonavoglia, Canio; Lorusso, Eleonora; Dantas-Torres, Filipe; Baneth, Gad; Otranto, Domenico

2017-05-01

The distribution of Hepatozoon canis mainly encompasses areas where its main tick vector, Rhipicephalus sanguineus sensu lato, is present. However, the detection of this pathogen in dogs, foxes and golden jackals well outside the areas inhabited by this tick species reinforced the hypothesis that additional ixodids are involved in the life cycle and transmission of this protozoon. The present study provides, for the first time, data supporting the sporogonic development of H. canis in specimens of Rhipicephalus turanicus collected from a naturally infected fox from southern Italy. The epidemiological role of R. turanicus as a vector of H. canis is discussed, along with information on the potential use of cell cultures for the experimental infection with H. canis sporozoites. The in vitro infection of canine leucocytes by sporozoites from ticks is proposed as a potential tool for future in-depth studies on the biology of H. canis.
Identification of Babesia canis genotypes in dogs from Lithuania

OpenAIRE

Tamoliūnaitė, Dovilė; Radzijevskaja, Jana; Paulauskas, Algimantas; Sabūnas, Vytautas; Karvelienė, Birutė; Zamokas, Gintaras

2018-01-01

Canine babesiosis is a widespread tick-borne disease caused by haematozoan parasites of the genus Babesia. The vast majority of clinical babesiosis cases in dogs in Europe is caused by Babesia canis. Canine babesiosis has become quite frequent in Lithuania during the past decade. Babesiosis caused by B. canis may range from mild to severe disease in dogs. Such difference in the virulence of B. canis strains is associated with genetic heterogeneity among B. canis strains. We aimed to investiga...
Epidemiological aspects and spatial distribution of human and canine visceral leishmaniasis in an endemic area in northeastern Brazil.

Science.gov (United States)

Campos, Roseane; Santos, Márcio; Tunon, Gabriel; Cunha, Luana; Magalhães, Lucas; Moraes, Juliana; Ramalho, Danielle; Lima, Sanmy; Pacheco, José Antônio; Lipscomb, Michael; Ribeiro de Jesus, Amélia; Pacheco de Almeida, Roque

2017-05-11

Visceral leishmaniasis (VL) is a systemic disease endemic in tropical countries and transmitted through sand flies. In particular, Canis familiaris (or domesticated dogs) are believed to be a major urban reservoir for the parasite causing the disease Leishmania. The average number of human VL cases was 58 per year in the state of Sergipe. The city of Aracaju, capital of Sergipe in Northeastern Brazil, had 159 cases of VL in humans. Correlatively, the percentage of serologically positive dogs for leishmaniasis increased from 4.73% in 2008 to 12.69% in 2014. Thus, these studies aimed to delineate the spatial distribution and epidemiological aspects of human and canine VL as mutually supportive for increased incidence. The number of human cases of VL and the frequency of canine positive serology for VL both increased between 2008 and 2014. Spatial distribution analyses mapped areas of the city with the highest concentration of human and canine VL cases. The neighbourhoods that showed the highest disease frequency were located on the outskirts of the city and in urbanised areas or subjected to development. Exponential increase in VL-positive dogs further suggests that the disease is expanding in urban areas, where it can serve as a reservoir for transmission of dogs to humans via the sand fly vector.
Epidemiological aspects and spatial distribution of human and canine visceral leishmaniasis in an endemic area in northeastern Brazil

Directory of Open Access Journals (Sweden)

Roseane Campos

2017-05-01

Full Text Available Visceral leishmaniasis (VL is a systemic disease endemic in tropical countries and transmitted through sand flies. In particular, Canis familiaris (or domesticated dogs are believed to be a major urban reservoir for the parasite causing the disease Leishmania. The average number of human VL cases was 58 per year in the state of Sergipe. The city of Aracaju, capital of Sergipe in Northeastern Brazil, had 159 cases of VL in humans. Correlatively, the percentage of serologically positive dogs for leishmaniasis increased from 4.73% in 2008 to 12.69% in 2014. Thus, these studies aimed to delineate the spatial distribution and epidemiological aspects of human and canine VL as mutually supportive for increased incidence. The number of human cases of VL and the frequency of canine positive serology for VL both increased between 2008 and 2014. Spatial distribution analyses mapped areas of the city with the highest concentration of human and canine VL cases. The neighbourhoods that showed the highest disease frequency were located on the outskirts of the city and in urbanised areas or subjected to development. Exponential increase in VL-positive dogs further suggests that the disease is expanding in urban areas, where it can serve as a reservoir for transmission of dogs to humans via the sand fly vector.
Study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test Estudo da reatividade cruzada em amostras de soro de cães positivos para Leishmania sp., Babesia canis e Ehrlichia canis, pelo ensaio imunoenzimático indireto e pela reação de imunofluorescência indireta

Directory of Open Access Journals (Sweden)

Trícia Maria F. de Sousa Oliveira

2008-03-01

Full Text Available To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT and Enzyme-linked immunosorbent assay (ELISA. All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis by IFAT. None of the serum samples from non-endemic areas were positive for Leishmania sp., by IFAT, but 67% were positive for B. canis and 78% for E. canis using the same test. When tested by ELISA for Leishmania sp., four samples from non-endemic area were positive. These dogs were then located and no clinical signs, parasites or antibody was detected in new tests for a six month period. Only one of these 4 samples was positive for B. canis by IFAT and ELISA and three for E. canis by IFAT. The results of the work suggest a co-infection in the endemic area and no serological cross-reaction among these parasites by IFAT and ELISA.Para verificar a existência de reação cruzada entre leishmaniose visceral, erliquiose e babesiose, nos testes sorológicos utilizados em programas de controle da leishmaniose visceral humana, amostras de soro canino provenientes de áreas endêmicas e não endêmicas para essa enfermidade, foram testadas pela Reação de Imunofluorescência (RIFI e Ensaio imunoenzimático (ELISA. Todos os soros provenientes de área endêmica foram positivos para Leishmania sp pelo ELISA e RIFI, 51% para Babesia canis e 43% para Ehrlichia canis pela RIFI. Pela RIFI, nenhum dos soros provenientes de área não endêmica foi positivo para Leishmania sp, sendo 67% positivos para B. canis e 78% para E. canis pelo mesmo teste. Quando testados pelo ELISA para Leishmania sp., quatro soros da área não endêmica foram positivos. Os cães foram localizados
Hair Contamination of Sheepdog and Pet Dogs with Toxocara Canis Eggs

Directory of Open Access Journals (Sweden)

AR Khezri

2012-12-01

Full Text Available Background: We tried to investigate the hair contamination of pet dogs and farm sheepdog with Toxocara eggs in terms of the different sex and age groups in north-west of Iran (Urmia and its suburbs.Methods: Hair samples were collected from a total of 138 pet and farm sheepdogs from November 2008 to June 2009 in Urmia City and the suburb (West Azerbaijan-Iran and examined for the presence of T. canis eggs.Results: T. canis eggs found in 60 samples altogether (pet and shepherd dogs showed a contamination rate of 36.2%. The number of observed T. canis eggs in each microscope field was varied from 1 to > 400. The age of the dog was found a significant factor to influence the prevalence and intensity of contamination, with 82% of all the eggs recovered from puppies (six months and younger. Additionally, the numbers of eggs in farm sheepdogs were significantly higher than pet dogs (P<0.05.Conclusions: This report shows that direct contact with T. canis infected dogs, particularly puppies from shepherd dogs, may pose a serious hazard to human. Besides, as they may harbor a considerable number of eggs on their hair, they can contaminate the soil and the environment.
What did domestication do to dogs? A new account of dogs' sensitivity to human actions.

Science.gov (United States)

Udell, Monique A R; Dorey, Nicole R; Wynne, Clive D L

2010-05-01

Over the last two decades increasing evidence for an acute sensitivity to human gestures and attentional states in domestic dogs has led to a burgeoning of research into the social cognition of this highly familiar yet previously under-studied animal. Dogs (Canis lupus familiaris) have been shown to be more successful than their closest relative (and wild progenitor) the wolf, and than man's closest relative, the chimpanzee, on tests of sensitivity to human social cues, such as following points to a container holding hidden food. The "Domestication Hypothesis" asserts that during domestication dogs evolved an inherent sensitivity to human gestures that their non-domesticated counterparts do not share. According to this view, sensitivity to human cues is present in dogs at an early age and shows little evidence of acquisition during ontogeny. A closer look at the findings of research on canine domestication, socialization, and conditioning, brings the assumptions of this hypothesis into question. We propose the Two Stage Hypothesis, according to which the sensitivity of an individual animal to human actions depends on acceptance of humans as social companions, and conditioning to follow human limbs. This offers a more parsimonious explanation for the domestic dog's sensitivity to human gestures, without requiring the use of additional mechanisms. We outline how tests of this new hypothesis open directions for future study that offer promise of a deeper understanding of mankind's oldest companion.
Molecular characterization and functional analysis of serine/threonine protein phosphatase of Toxocara canis.

Science.gov (United States)

Ma, Guang Xu; Zhou, Rong Qiong; Hu, Shi Jun; Huang, Han Cheng; Zhu, Tao; Xia, Qing You

2014-06-01

Toxocara canis (T. canis) is a widely prevalent zoonotic parasite that infects a wide range of mammalian hosts, including humans. We generated the full-length complementary DNA (cDNA) of the serine/threonine phosphatase gene of T. canis (Tc stp) using 5' rapid amplification of the cDNA ends. The 1192-bp sequence contained a continuous 942-nucleotide open reading frame, encoding a 313-amino-acid polypeptide. The Tc STP polypeptide shares a high level of amino-acid sequence identity with the predicted STPs of Loa loa (89%), Brugia malayi (86%), Oesophagostomum columbianum (76%), and Oesophagostomumdentatum (76%). The Tc STP contains GDXHG, GDXVDRG, GNHE motifs, which are characteristic of members of the phosphoprotein phosphatase family. Our quantitative real-time polymerase chain reaction analysis showed that the Tc STP was expressed in six different tissues in the adult male, with high-level expression in the spermary, vas deferens, and musculature, but was not expressed in the adult female, suggesting that Tc STP might be involved in spermatogenesis and mating behavior. Thus, STP might represent a potential molecular target for controlling T. canis reproduction. Copyright © 2014 Elsevier Inc. All rights reserved.
Selenium status in adult cats and dogs fed high levels of dietary inorganic and organic selenium

NARCIS (Netherlands)

Todd, S.E.; Ugarte, S.E.; Thomas, D.G.; Bosch, Guido; Hendriks, W.H.

2012-01-01

Cats (Felis catus) maintain greater blood Se concentrations compared with dogs (Canis familiaris) and, unlike dogs, show no signs of chronic Se toxicity (selenosis) when fed dietary organic Se (selenomethionine) concentrations of 10 μg/g DM. This study investigated the response of cats and dogs to
Fatal Sarcocystis canis-like hepatitis in an Indo-Pacific bottlenose dolphin (Tursiops aduncus) in Hong Kong

Science.gov (United States)

Unlike most species in the genus Sarcocystis, Sarcocystis canis has a broad intermediate host range. Its life cycle is incompletely known and most reports are from the USA. Here we report fatal hepatitis in a 4 year old male Indo-Pacific bottlenose dolphin (Tursiops aduncus) from Hong Kong associate...
A new PCR assay for the detection and differentiation of Babesia canis and Babesia vogeli.

Science.gov (United States)

Annoscia, Giada; Latrofa, Maria Stefania; Cantacessi, Cinzia; Olivieri, Emanuela; Manfredi, Maria Teresa; Dantas-Torres, Filipe; Otranto, Domenico

2017-10-01

Babesia spp. are globally distributed tick-borne protozoan parasites that infect the red blood cells of a wide range of vertebrate hosts, including humans. Diagnosis of babesiosis is often impeded by the transient presence of the parasites in peripheral blood, as well as by their pleomorphic nature. Given the reports of an expanding and, in some cases, sympatric geographical distribution of Babesia canis and Babesia vogeli in dogs and associated vectors, in Europe, the development of time-efficient and cost-effective diagnostic tools to detect and differentiate these two species is warranted. In this study, we designed and developed a novel polymerase chain reaction (PCR) assay targeting the parasite cytochrome c oxidase subunit 1 (cox1) gene, for the simultaneous detection and differentiation of B. canis and B. vogeli. The analytical sensitivity of the PCR was evaluated using serial dilutions of genomic DNA extracted from individual and artificially mixed canine blood samples infected by B. canis (3×10 2 infected erythrocytes/ml, ie/ml) and B. vogeli (2.1×10 1 ie/ml). The analytical specificity of the assay was assessed using blood samples positive for Hepatozoon canis, Ehrlichia canis, Anaplasma platys, Babesia microti, Babesia rossi and Theileria annae (syn. Babesia vulpes). The clinical specificity of the PCR assay was evaluated on 147 blood samples from dogs and 128 tick specimens (Dermacentor reticulatus and Rhipicephalus sanguineus sensu lato). Species-specific bands of the expected sizes (i.e., 750bp for B. canis and 450bp for B. vogeli), and two bands in the mixed blood samples were obtained. The PCR assay developed herein detected a low number of infected erythrocytes (i.e., 3×10 -2 B. canis, 2.1×10 -2 B. vogeli ie/ml). Of the 147 blood samples, nine (6.1%) were positive for B. canis and six (4.1%) for B. vogeli, whereas only one tick (D. reticulatus) was positive for B. canis. This PCR assay represents a rapid and reliable tool for the diagnosis of B
Paw Preference Correlates to Task Performance in Dogs

NARCIS (Netherlands)

Alphen, A. van; Bosse, T.; Frank, I.; Jonker, C.M.; Koeman, F.; Bara, B.G.; Barsalou, L.; Bucciarelli, M.

2005-01-01

A study involving 36 domestic dogs (Canis familiaris) in a simple search task provides evidence of a correlation between paw use and performance. The study was carried out to determine whether or not paw use is related to task performance. Different aspects of task performance were taken into
Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

NARCIS (Netherlands)

Hassan, M.M.; Osman, O.F.; El-Raba'a, F.M.A.; Schallig, H.D.F.H.; Elnaiem, D.E.A.

2009-01-01

Background: The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a
Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

NARCIS (Netherlands)

Hassan, Mo'awia M.; Osman, Omran F.; El-Raba'a, Fathi Ma; Schallig, Henk Dfh; Elnaiem, Dia-Eldin A.

2009-01-01

The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a reservoir host
Molecular characterization of Hepatozoon canis from farm dogs in Pakistan.

Science.gov (United States)

Ahmad, Abdullah S; Saeed, Muhammad A; Rashid, Imran; Ashraf, Kamran; Shehzad, Wasim; Traub, Rebecca J; Baneth, Gad; Jabbar, Abdul

2018-04-01

Hepatozoon canis is a tick-borne pathogen of canids, which is distributed worldwide. However, very little is known about this protozoan parasite in Pakistan. This study provides the first molecular evidence of H. canis from farm dogs from three agro-ecological zones of Punjab, Pakistan. A conventional PCR targeting the 18S rRNA gene was used to characterize H. canis from farm dogs from three districts, namely Kasur, Rawalpindi, and Muzaffargarh, in Punjab. Of 341 blood samples tested, 155 (45.5%) were positive for H. canis, 73 (61.3%) from Kasur, 46 (42.5%) from Rawalpindi, and 36 (31.5%) from Muzaffargarh. Phylogenetic analyses revealed that 18S rRNA sequences of H. canis from this study clustered in three clades with those of H. canis from previously published studies to the exclusion of all other Hepatozoon spp. included in the analysis. This study provides the first insight into H. canis from farm dogs in Pakistan. Furthermore, it lays a foundation for future studies of the parasite to assess the impact of canine hepatozoonosis in dogs from various agro-ecological zones in Pakistan where pet ownership of dogs is increasing.
Serological Surveillance for Non-Rabies Lyssaviruses among ...

African Journals Online (AJOL)

Out of the seven recognized and four putative genotypes of lyssaviruses, genotypes 1-3 comprising namely the classical rabies virus (RABV), Lagos bat virus (LBV) and Mokola virus (MOKV) respectively have been reported in Nigeria. The domestic dog, Canis familiaris, is recognized as the reservoir for genotype 1, and the ...
Drilled teeth and shell artefacts from a grave at Prague-Březiněves and a review of decorative artefacts made from animal material from Corded Ware culture in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Kyselý, René; Dobeš, Miroslav; Svoboda, K.

-, - (2017) ISSN 1866-9557 R&D Projects: GA ČR(CZ) GA16-14855S Institutional support: RVO:67985912 Keywords : tooth pendants * shell beads * solar disc * dog (Canis familiaris) * Margaritifera auricularia * Chalcolithic (Copper Age) * Bohemia * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.844, year: 2016
Differential serodiagnostics of Toxocara canis and Toxocara cati - is it possible?

DEFF Research Database (Denmark)

Poulsen, C. S.; Skov, Søren; Yoshida, A.

2015-01-01

and uncertainties regarding the validity of existing serological assays. In this study, we used sera from a pig model experimentally infected with T. canis and T. cati to evaluate whether a Western blot could discriminate between the two species. No proteins were observed that could be used as a diagnostic tool......One of the most common zoonotic helminth infections is caused by species in the genus Toxocara, particularly Toxocara canis and T. cati (Syn. T. mystax). However, their relative contribution to toxocarosis in humans remains largely unknown because causative larvae are seldom recovered...
High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples.

Science.gov (United States)

Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

2014-06-01

Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines. Copyright © 2014 Elsevier GmbH. All rights reserved.
Prevalence of Demodex canis-positive healthy dogs at trichoscopic examination.

Science.gov (United States)

Fondati, Alessandra; De Lucia, Michela; Furiani, Nicla; Monaco, Moira; Ordeix, Laura; Scarampella, Fabia

2010-04-01

Demodex canis is thought to be present in small numbers in the skin of most healthy dogs; however, available data on the prevalence of normal dogs harbouring D. canis are scarce. The purpose of this study was to investigate, using microscopic examination of plucked hairs, the prevalence of healthy dogs harbouring D. canis. Seventy-eight clinically healthy dogs with no history of dermatological problems and clinically normal skin and hair coat were included in the study. Five areas (perioral skin 2-3mm from both labial commissures, periungual skin of the third digit of both anterior paws and chin) were examined in each dog. Fifty to sixty hairs were plucked from each skin site and microscopically examined. No D. canis mites were observed and only one adult form of Demodex injai was found in the labial commissure of one dog. Based on these results, the estimated prevalence of healthy dogs harbouring D. canis in clinically normal skin should not exceed the threshold of 5.4%, with 95% confidence level. Considering our and previous findings, we propose that, although small numbers of D. canis might inhabit the skin of normal dogs, the probability of finding these mites in normal dogs is low. Consequently, in most cases, the presence of a D. canis mite in the skin should not be considered as indicative of normality.

Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...
Gray wolf (Canis lupus) is a natural definitive host for Neospora caninum

Science.gov (United States)

The gray wolf (Canis lupus) was found to be a new natural definitive host for Neospora caninum. This finding is based on the recovery of Neospora-like oocysts from the feces of 3 of 73 wolves from Minnesota examined at necropsy, and on successful amplification of N. caninum-specific sequences from ...
When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus).

Science.gov (United States)

Udell, Monique A R

2015-09-01

Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' 'looking back' behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks more generally. In this study, pet dogs, shelter dogs and wolves were given up to three opportunities to open a solvable puzzle box: when subjects were with a neutral human caretaker, alone and when encouraged by the human. Wolves were more persistent and more successful on this task than dogs, with 80% average success rate for wolves versus a 5% average success rate for dogs in both the human-in and alone conditions. Dogs showed increased contact with the puzzle box during the encouragement condition, but only a moderate increase in problem-solving success. Social sensitivity appears to play an important role in pet and shelter dogs' willingness to engage in problem-solving behaviour, which could suggest generalized dependence on, or deference to, human action. © 2015 The Author(s).
A PCR-based epidemiological survey of Hepatozoon canis in dogs in Nigeria.

Science.gov (United States)

Sasaki, Mizuki; Omobowale, Olutayo; Ohta, Kaisaku; Tozuka, Morito; Matsuu, Aya; Hirata, Haruyuki; Nottidge, Helen Oyebukola; Ikadai, Hiromi; Oyamada, Takashi

2008-07-01

The prevalence of Hepatozoon canis infections in dogs in Nigeria was surveyed using molecular methods. DNA was extracted from blood samples obtained from 400 dogs. A primer set that amplified the Babesia canis 18S rRNA gene, which has high similarity to the H. canis 18S rRNA gene, was used for the PCR. As a result, samples from 81 dogs (20.3%) produced 757 bp bands, which differed from the 698 bp band that corresponded to B. canis infection. The sequence of the PCR products of 10 samples were determined, all of which corresponded with the H. canis sequence.
The 33.1 kDa Excretory/secretory Protein Produced by Toxo-cara canis Larvae Serves as a Potential Common Biomarker for Serodiagnosis of Toxocariasis in Paratenic Animals and Human

Directory of Open Access Journals (Sweden)

Huu-Hung NGUYEN

2017-02-01

Full Text Available Background: Toxocariasis is a prevalent zoonosis disease caused by the closely related nematode species Toxocara canis and Toxocara cati which parasitise Canidae and Felidae respectively. In paratenic hosts, larvae of these worms cause multiple organ damage. However, how these paratenic hosts response to these worms and whether any common biomarker can be applied for diagnosis are still unclear.Methods: Excreted/secreted (E/S antigens were prepared by culture of T. canis larvae in vitro. Using a western blot (WB assay the humoral IgG responses, induced by Toxocara spp. larvae to the worm’s E/S antigens in different infected hosts including mice, rabbits and human, were examined.Results: In a mouse model of toxocariasis, intraperitoneal injection of T. canis larvae induces inflammatory leukocyte accumulation in the liver and the lungs but not in the brain, although a remarkable number of larvae were detected in this organ. Mice and rabbits responded differently to Toxocara spp. resulting in distinct heterogenous WB band patterns. Mice and rabbits both responded to a 33.1 kDa E/S constituent that turned out to be the most sensitive protein for serodiagnosis. Sera from human toxocariasis patients showed heterogenous WB band patterns similar to those observed in rabbits and all responded to the 33.1 kDa band. Conclusion: 33.1 kDa E/S protein can be considered as a critical common biomarker for toxocariasis immuno-diagnosis in both paratenic animals and human and its specificity requires further investigation.
SCM, the M Protein of Streptococcus canis Binds Immunoglobulin G.

Science.gov (United States)

Bergmann, Simone; Eichhorn, Inga; Kohler, Thomas P; Hammerschmidt, Sven; Goldmann, Oliver; Rohde, Manfred; Fulde, Marcus

2017-01-01

The M protein of Streptococcus canis (SCM) is a virulence factor and serves as a surface-associated receptor with a particular affinity for mini-plasminogen, a cleavage product of the broad-spectrum serine protease plasmin. Here, we report that SCM has an additional high-affinity immunoglobulin G (IgG) binding activity. The ability of a particular S. canis isolate to bind to IgG significantly correlates with a scm -positive phenotype, suggesting a dominant role of SCM as an IgG receptor. Subsequent heterologous expression of SCM in non-IgG binding S. gordonii and Western Blot analysis with purified recombinant SCM proteins confirmed its IgG receptor function. As expected for a zoonotic agent, the SCM-IgG interaction is species-unspecific, with a particular affinity of SCM for IgGs derived from human, cats, dogs, horses, mice, and rabbits, but not from cows and goats. Similar to other streptococcal IgG-binding proteins, the interaction between SCM and IgG occurs via the conserved Fc domain and is, therefore, non-opsonic. Interestingly, the interaction between SCM and IgG-Fc on the bacterial surface specifically prevents opsonization by C1q, which might constitute another anti-phagocytic mechanism of SCM. Extensive binding analyses with a variety of different truncated SCM fragments defined a region of 52 amino acids located in the central part of the mature SCM protein which is important for IgG binding. This binding region is highly conserved among SCM proteins derived from different S. canis isolates but differs significantly from IgG-Fc receptors of S. pyogenes and S. dysgalactiae sub. equisimilis , respectively. In summary, we present an additional role of SCM in the pathogen-host interaction of S. canis . The detailed analysis of the SCM-IgG interaction should contribute to a better understanding of the complex roles of M proteins in streptococcal pathogenesis.
Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...
Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...
Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...
Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...
Zoonotic enteric parasites transmitted from dogs in Egypt with special concern to Toxocara canis infection

Directory of Open Access Journals (Sweden)

Maysa A. I. Awadallah

2015-08-01

Full Text Available Aim: This work aimed to study the role played by dogs in transmitting zoonotic enteric parasites to humans in Egypt and to analyze the risk factors associated with the occurrence of such infection in dogs. Serodiagnosis of anti-Toxocara immunoglobulin G (IgG antibodies among human beings as well as analyzing risk factors predispose to Toxocara canis infection in human beings are another objectives of this study. Materials and Methods: From June to December 2013, a total of 130 fecal samples from 4 dog populations (Military, nomadic and domiciled dogs from rural and high standard districts and 150 stool samples of 6 occupational groups were examined for the presence of enteric parasitic infection. Moreover, 150 serum samples were collected from humans from whom stool samples were collected and examined for the presence of anti-T. canis antibodies. Results: Enteric parasites were detected in 30% of fecal samples from 4 dog populations in Egypt. High infectivity had been reported in nomadic dogs (63.33% (Crude odds ratios [COR]=67.36, 95% confidence interval [CI]=8.09-560.8, p˂0.000, followed by domiciled dogs from rural areas (40% (COR=26, 95% CI=3.14-215.54, p=0.003, domiciled dogs from high standard areas (23.33% (COR=11.87, 95% CI=1.37-102.69, p=0.025 and military dogs (2.5%. Twelve species of enteric parasites were identified, Ancylostomatidae (6.15%, T. canis and Cryptosporidium spp. (5.38%, each, Heterophyes spp. (3.85%, Toxocara leonina and Blastocystis spp. (3.07%, Taenidae eggs (2.31%, Hymenolepis diminuta (1.54% and Entamoeba canis, Cyclospora cayetanensis, and Paragonimus spp. (0.77%, each. Univariate logestic regression revealed significant association of age (COR=4.73, 95% CI=2.13-10.53, p˂0.000, gender (COR=2.63, 95% CI=1.22-5.68, p˂0.014, housing system (COR=5.10, 95% CI=2.04-12.75, p˂0.000 with enteric parasitic infection in dogs. However, breeds (COR=6.91, 95% CI=0.88-54.52, p=0.067 and type of feeding (COR ranged from 3.5 to
Helicobacter canis bacteremia in a renal transplant patient

NARCIS (Netherlands)

van der Vusse, M. L.; van Son, W. J.; Ott, A.; Manson, W.

Here we present a case report of a 41-year-old woman suffering from high fever and bacteremia due to Helicobacter canis, 11months after kidney transplantation. Identification of H.canis was achieved by 16s rDNA sequence analysis of a positive blood culture. The patient was restored fully to health
Clinical Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum infections in dogs.

Science.gov (United States)

Dubey, J P; Chapman, Jennifer L; Rosenthal, Benjamin M; Mense, M; Schueler, Ronald L

2006-04-15

Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum are related apicomplexans that can cause systemic illness in many species of animals, including dogs. We investigated one breeder's 25 Basset Hounds for these infections. In addition, tissues from dogs and other non-canine hosts previously reported as S. canis infections were studied retrospectively. Schizonts resembling those of S. neurona, and recognized by polyclonal rabbit anti-S. neurona antibodies, were found in six of eight retrospective cases, as well as in two additional dogs (one Basset Hound, one Springer Spaniel) not previously reported. S. neurona schizonts were found in several tissues including the central nervous system, lungs, and kidneys. Fatal toxoplasmosis was diagnosed in an adult dog, and neosporosis was diagnosed in an adult and a pup related to the one diagnosed with S. neurona. No serological reactivity to S. neurona antibodies occurred when S. canis-like liver schizonts were retrospectively assayed from two dogs, a dolphin, a sea lion, a horse, a chinchilla, a black or either of two polar bears. Sequencing conserved (18S) and variable (ITS-1) portions of nuclear ribosomal DNA isolated from the schizont-laden liver of a polar bear distinguished it from all previously characterized species of Sarcocystis. We take this genetic signature as provisionally representative of S. canis, an assumption that should be tested with future sequencing of similar liver infections in other mammalian hosts. These findings further extend the uncharacteristically broad intermediate host range for S. neurona, which also causes a neurologic disease in cats, mink, raccoons, skunks, Pacific harbor seals, ponies, zebras, lynxes, and sea otters. Further work is necessary to delineate the causative agent(s) of other cases of canine sarcocystosis, and in particular to specify the attributes of S. canis, which corresponds morphologically to infections reported from wide range of terrestrial
Production of Toxocara cati TES-120 Recombinant Antigen and Comparison with its T. canis Homolog for Serodiagnosis of Toxocariasis

Science.gov (United States)

Zahabiun, Farzaneh; Sadjjadi, Seyed Mahmoud; Yunus, Muhammad Hafiznur; Rahumatullah, Anizah; Moghaddam, Mohammad Hosein Falaki; Saidin, Syazwan; Noordin, Rahmah

2015-01-01

Toxocariasis is a cosmopolitan zoonotic disease caused by the infective larvae of Toxocara canis and T. cati. Diagnosis in humans is usually based on clinical symptoms and serology. Immunoglobulin G (IgG)-enzyme-linked immunosorbent assay kits using T. canis excretory–secretory (TES) larval antigens are commonly used for serodiagnosis. Differences in the antigens of the two Toxocara species may influence the diagnostic sensitivity of the test. In this study, T. cati recombinant TES-120 (rTES-120) was cloned, expressed, and compared with its T. canis homolog in an IgG4-western blot. The diagnostic sensitivity and specificity of T. cati rTES-120 were 70% (33/47) and 100% (39/39), respectively. T. canis rTES-120 showed 57.4% sensitivity and 94.4% specificity. When the results of assays using rTES-120 of both species were considered, the diagnostic sensitivity was 76%. This study shows that using antigens from both Toxocara species may improve the serodiagnosis of toxocariasis. PMID:26033026
Book review, Amati cani, José Jorge Letria

Directory of Open Access Journals (Sweden)

Manuel Graziani

2008-03-01

Full Text Available Con Amati cani ci discostiamo per una volta dalle pubblicazioni a carattere scientifico, per dare il giusto risalto ad un’interessante raccolta di narrativa che esplora il rapporto tra l'uomo e il suo miglior amico. José Jorge Latria, noto soprattutto per essere un esponente di spicco della canzone politica portoghese e per le sue opere poetiche, teatrali e di letteratura per ragazzi, nello scrivere questo libro compie un vero e proprio atto d’amore verso i cani, con il preciso intento di costringere i lettori ad eliminare dal proprio vocabolario il gratuito modo di dire ‘mondo cane’. L’Autore delinea brevi ritratti di cani che, da Argo in poi, hanno accompagnato da amici veri i loro celebri padroni nella buona e nella cattiva sorte: racconta cioè la storia di quei cani che non sono sprofondati nella voragine dell’oblio perchè i loro padroni hanno raggiunto la celebrità nel mondo della letteratura, della politica, del cinema, delle scienze o della musica. Con a fianco un amico fedele come un cane, la vita ha avuto un sapore diverso per Ernest Hemingway, Isaac Newton, Sigmund Freud, Buster Keaton, Marilyn Monroe, Pablo Picasso, John Steinbeck, Lord Byron, Tim Burton e altri ancora, tutti personaggi che sono presenti in questo libro grazie ai cani che hanno condiviso con loro la vita e le memorie. La lettura di Amati cani dà piacere poichè in ognuno di questi racconti batte, affettuoso e delicato, il cuore di un cane; ma dà anche un pò da pensare in quanto celebra in maniera molto tenera l’amore, la fedeltà e la solidarietà tra l’uomo e il suo speciale amico a quattro zampe.
First occurrence of an autochthonous canine case of Leishmania (Leishmania infantum chagasi in the municipality of Campinas, State of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Elisa San Martin Mouriz Savani

2011-08-01

Full Text Available An autochthonous case of visceral leishmaniasis is reported in a dog (Canis familiaris as an apparently natural infection in a non-endemic area. DNA obtained from spleen and liver samples produced the expected fragment in a Leishmania-specific rDNA-based nested-PCR assay. The PCR product, a 490 bp fragment, was sequenced and the nucleotide sequence was identical to that of Leishmania (Leishmania infantum chagasi. These results are surprising since no autochthonous human or canine cases of visceral leishmaniasis have ever been reported in this municipality. This case suggests that natural transmission of this disease is occurring in this area.
Another way to learn about teaching: What dogs can tell us about the evolution of pedagogy.

Science.gov (United States)

Johnston, Angie M; McAuliffe, Katherine; Santos, Laurie R

2015-01-01

Kline argues that it is crucial to isolate the respective roles of teaching and learning in order to understand how pedagogy has evolved. We argue that doing so requires testing species that learn from pedagogy but that rarely teach themselves. Here, we review how one previously neglected species - domesticated dogs (Canis familiaris) - may allow researchers to do just that.
Association between canine leishmaniosis and Ehrlichia canis co-infection: a prospective case-control study.

Science.gov (United States)

Attipa, Charalampos; Solano-Gallego, Laia; Papasouliotis, Kostas; Soutter, Francesca; Morris, David; Helps, Chris; Carver, Scott; Tasker, Séverine

2018-03-20

In the Mediterranean basin, Leishmania infantum is a major cause of disease in dogs, which are frequently co-infected with other vector-borne pathogens (VBP). However, the associations between dogs with clinical leishmaniosis (ClinL) and VBP co-infections have not been studied. We assessed the risk of VBP infections in dogs with ClinL and healthy controls. We conducted a prospective case-control study of dogs with ClinL (positive qPCR and ELISA antibody for L. infantum on peripheral blood) and clinically healthy, ideally breed-, sex- and age-matched, control dogs (negative qPCR and ELISA antibody for L. infantum on peripheral blood) from Paphos, Cyprus. We obtained demographic data and all dogs underwent PCR on EDTA-blood extracted DNA for haemoplasma species, Ehrlichia/Anaplasma spp., Babesia spp., and Hepatozoon spp., with DNA sequencing to identify infecting species. We used logistic regression analysis and structural equation modelling (SEM) to evaluate the risk of VBP infections between ClinL cases and controls. From the 50 enrolled dogs with ClinL, DNA was detected in 24 (48%) for Hepatozoon spp., 14 (28%) for Mycoplasma haemocanis, 6 (12%) for Ehrlichia canis and 2 (4%) for Anaplasma platys. In the 92 enrolled control dogs, DNA was detected in 41 (45%) for Hepatozoon spp., 18 (20%) for M. haemocanis, 1 (1%) for E. canis and 3 (3%) for A. platys. No Babesia spp. or "Candidatus Mycoplasma haematoparvum" DNA was detected in any dog. No statistical differences were found between the ClinL and controls regarding age, sex, breed, lifestyle and use of ectoparasitic prevention. A significant association between ClinL and E. canis infection (OR = 12.4, 95% CI: 1.5-106.0, P = 0.022) was found compared to controls by multivariate logistic regression. This association was confirmed using SEM, which further identified that younger dogs were more likely to be infected with each of Hepatozoon spp. and M. haemocanis, and dogs with Hepatozoon spp. were more likely to
The response of guide dogs and pet dogs (Canis familiaris) to cues of human referential communication (pointing and gaze).

Science.gov (United States)

Ittyerah, Miriam; Gaunet, Florence

2009-03-01

The study raises the question of whether guide dogs and pet dogs are expected to differ in response to cues of referential communication given by their owners; especially since guide dogs grow up among sighted humans, and while living with their blind owners, they still have interactions with several sighted people. Guide dogs and pet dogs were required to respond to point, point and gaze, gaze and control cues of referential communication given by their owners. Results indicate that the two groups of dogs do not differ from each other, revealing that the visual status of the owner is not a factor in the use of cues of referential communication. Both groups of dogs have higher frequencies of performance and faster latencies for the point and the point and gaze cues as compared to gaze cue only. However, responses to control cues are below chance performance for the guide dogs, whereas the pet dogs perform at chance. The below chance performance of the guide dogs may be explained by a tendency among them to go and stand by the owner. The study indicates that both groups of dogs respond similarly in normal daily dyadic interaction with their owners and the lower comprehension of the human gaze may be a less salient cue among dogs in comparison to the pointing gesture.
Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea) in soil and fecal samples

OpenAIRE

Durant, Jean-Francois; Irenge, Leonid M; Fogt-Wyrwas, Renata; Dumont, Catherine; Doucet, Jean-Pierre; Mignon, Bernard; Losson, Bertrand; Gala, Jean-Luc

2012-01-01

Abstract Background Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis) and/or Toxocara cati (T. cati), two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. Methods A duplex qua...

Brucella canis: inquéritos sorológico e bacteriológico em população felina Brucella canis: serological and bacteriological surveys in the feline population

Directory of Open Access Journals (Sweden)

Maria Helena Matiko Akao Larsson

1984-02-01

Full Text Available De 134 soros de felinos domésticos examinados pela prova de soroaglutinação lenta em tubos, 4 (3% foram positivos para Brucella canis, todos com título igual a 100. Não se obteve êxito na tentativa de isolamento de Brucella canis através de hemocultura desses animais.Of the 134 feline sera tested by tube agglutination test, 4 (3% were positive for Brucella canis antibodies, all with titer 100. It was not possible to isolate Brucella canis by blood culture in the case of these animals.
Oxytocin enhances the appropriate use of human social cues by the domestic dog (Canis familiaris) in an object choice task.

Science.gov (United States)

Oliva, J L; Rault, J-L; Appleton, B; Lill, A

2015-05-01

It has been postulated that the neuropeptide, oxytocin, is involved in human-dog bonding. This may explain why dogs, compared to wolves, are such good performers on object choice tasks, which test their ability to attend to, and use, human social cues in order to find hidden food treats. The objective of this study was to investigate the effect of intranasal oxytocin administration, which is known to increase social cognition in humans, on domestic dogs' ability to perform such a task. We hypothesised that dogs would perform better on the task after an intranasal treatment of oxytocin. Sixty-two (31 males and 31 females) pet dogs completed the experiment over two different testing sessions, 5-15 days apart. Intranasal oxytocin or a saline control was administered 45 min before each session. All dogs received both treatments in a pseudo-randomised, counterbalanced order. Data were collected as scores out of ten for each of the four blocks of trials in each session. Two blocks of trials were conducted using a momentary distal pointing cue and two using a gazing cue, given by the experimenter. Oxytocin enhanced performance using momentary distal pointing cues, and this enhanced level of performance was maintained over 5-15 days time in the absence of oxytocin. Oxytocin also decreased aversion to gazing cues, in that performance was below chance levels after saline administration but at chance levels after oxytocin administration.
Intraoperative bleeding in dogs from Grenada seroreactive to Anaplasma platys and Ehrlichia canis.

Science.gov (United States)

Lanza-Perea, M; Zieger, U; Qurollo, B A; Hegarty, B C; Pultorak, E L; Kumthekar, S; Bruhl-Day, R; Breitschwerdt, E B

2014-01-01

Frequent exposure of Grenadian dogs to Rhipicephalus sanguineus results in Anaplasma platys, and Ehrlichia canis seroreactivity. During elective surgeries, substantial intraoperative hemorrhage occurs in some seroreactive dogs. To assess hemostatic parameters and bleeding tendencies as well as prevalence of PCR positivity in apparently healthy A. platys and E. canis seroreactive and seronegative free-roaming dogs from Grenada. Forty-seven elective surgery dogs allocated to 4 groups: Seronegative control (n = 12), A. platys (n = 10), E. canis (n = 14) and A. platys, and E. canis (n = 11) seroreactive. Preoperatively, hemostasis was assessed by platelet count, prothrombin time, activated partial thromboplastin time, and buccal mucosal bleeding time. Intra- and postoperative bleeding scores were subjectively assigned. Blood, spleen, bone marrow, and lymph node aspirates were tested by PCR. Bleeding scores in dogs coseroreactive for A. platys and E. canis were higher (P = .015) than those of seronegative dogs. A. platys DNA was amplified from 7/21 (33%) A. platys seroreactive dogs and from 1 E. canis seroreactive dog; E. canis DNA was amplified from 21/25 (84%) E. canis seroreactive dogs. E. canis DNA was amplified most often from blood, whereas A. platys DNA was amplified most often from bone marrow. Apparently healthy, free-roaming dogs coseropositive for A. platys and E. canis may have increased intraoperative bleeding tendencies despite normal hemostatic parameters. Future investigations should explore the potential for vascular injury as a cause for bleeding in these dogs. Improved tick control is needed for dogs in Grenada. Copyright © 2014 by the American College of Veterinary Internal Medicine.
Serologic evidence of Leishmania infection in free-ranging wild and domestic canids around a Brazilian National Park

Directory of Open Access Journals (Sweden)

Nelson Henrique de Almeida Curi

2006-02-01

Full Text Available Transmission of disease between wildlife, domestic animals, and humans is of great concern to conservation issues and public health. Here we report on the prevalence of anti-Leishmania sp. antibodies in 21 wild canids (7 Chrysocyon brachyurus, 12 Cerdocyon thous, and 2 Lycalopex vetulus and 74 free domestic dogs (Canis familiaris sampled around the Serra do Cipó National Park. In dogs, the apparent prevalence was 8.1% and in wild canids it was 19% (2 crab-eating foxes, C. thous, and 2 maned wolves, C. brachyurus. Management of the domestic dog population with evaluation of incidence changes in humans and wildlife, and enlightenment on the role of wild reservoirs are essential issues for future action and research.
Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

Directory of Open Access Journals (Sweden)

Decaprariis Donato

2011-04-01

Full Text Available Abstract Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling and also by PCR for H. canis (second sampling. In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season, the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively, with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8% out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to
Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

Science.gov (United States)

2011-01-01

Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling) and also by PCR for H. canis (second sampling). In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season), the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively), with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8%) out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to blood smear evaluation
Diagnosis of Hepatozoon canis in young dogs by cytology and PCR.

Science.gov (United States)

Otranto, Domenico; Dantas-Torres, Filipe; Weigl, Stefania; Latrofa, Maria Stefania; Stanneck, Dorothee; Decaprariis, Donato; Capelli, Gioia; Baneth, Gad

2011-04-13

Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling) and also by PCR for H. canis (second sampling). In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season), the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively), with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8%) out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to blood smear evaluation. This study has also demonstrated
Different Babesia canis isolates, different diseases.

Science.gov (United States)

Schetters, T P; Moubri, K; Précigout, E; Kleuskens, J; Scholtes, N C; Gorenflot, A

1997-11-01

Using surface immunofluorescence isolate-specific antigens were detected on the membrane of erythrocytes infected with Babesia parasites. In addition, the strains reacted differently with Plasmagel in that the European isolate (B.c. canis) could be purified on Plasmagel effectively, whereas infected erythrocytes of the South-African isolate (B.c. rossi) could not. Experimental infection of dogs with Babesia canis isolates from geographically different areas revealed different pathology. The European isolate obtained from France exhibited transient parasitaemia, usually below 1%, associated with low PCV values and congestion of internal organs. Clinical disease was correlated with an effect on the coagulation system, and not with peripheral parasitaemia. Infection of dogs with South-African-derived isolate induced high parasitaemia usually much higher than 1%, which required chemotherapeutic treatment. In these animals clinical disease was correlated with peripheral parasitaemia and not with parameters of the coagulation system. The results show that the etiology of disease caused by these isolates of B.c. canis and B.c. rossi is different. This might have implications for the development of vaccines against these infections.
Gene repertoire evolution of Streptococcus pyogenes inferred from phylogenomic analysis with Streptococcus canis and Streptococcus dysgalactiae.

Directory of Open Access Journals (Sweden)

Tristan Lefébure

Full Text Available Streptococcus pyogenes, is an important human pathogen classified within the pyogenic group of streptococci, exclusively adapted to the human host. Our goal was to employ a comparative evolutionary approach to better understand the genomic events concomitant with S. pyogenes human adaptation. As part of ascertaining these events, we sequenced the genome of one of the potential sister species, the agricultural pathogen S. canis, and combined it in a comparative genomics reconciliation analysis with two other closely related species, Streptococcus dysgalactiae and Streptococcus equi, to determine the genes that were gained and lost during S. pyogenes evolution. Genome wide phylogenetic analyses involving 15 Streptococcus species provided convincing support for a clade of S. equi, S. pyogenes, S. dysgalactiae, and S. canis and suggested that the most likely S. pyogenes sister species was S. dysgalactiae. The reconciliation analysis identified 113 genes that were gained on the lineage leading to S. pyogenes. Almost half (46% of these gained genes were phage associated and 14 showed significant matches to experimentally verified bacteria virulence factors. Subsequent to the origin of S. pyogenes, over half of the phage associated genes were involved in 90 different LGT events, mostly involving different strains of S. pyogenes, but with a high proportion involving the horse specific pathogen S. equi subsp. equi, with the directionality almost exclusively (86% in the S. pyogenes to S. equi direction. Streptococcus agalactiae appears to have played an important role in the evolution of S. pyogenes with a high proportion of LGTs originating from this species. Overall the analysis suggests that S. pyogenes adaptation to the human host was achieved in part by (i the integration of new virulence factors (e.g. speB, and the sal locus and (ii the construction of new regulation networks (e.g. rgg, and to some extent speB.
[Seroprevalence of T. cruzi infection in Canis familiaris, state of Sucre, Venezuela].

Science.gov (United States)

Berrizbeitia, Mariolga; Concepción, Juan Luis; Carzola, Valentina; Rodríguez, Jéssicca; Cáceres, Ana; Quiñones, Wilfredo

2013-01-01

Trypanosoma cruzi infection in humans has been extensively studied in Venezuela; however, in reservoirs it has been less investigated. The objective of this study was to determine the seroepidemiology of T. cruzi in the state of Sucre, Venezuela. A cross-sectional and prospective study conducted in 95 towns and 577 dwellings in the 15 municipalies of the state of Sucre, Venezuela, from August to November, 2008. The evaluation of serum samples was performed with the CruziELISA kit and the multiple antigens binding assays (MABA). Furthermore, epidemiological surveys were applied to evaluate the risk factors. A total of dogs (average age of 2, 6 + 2.2 years, 226 males and 137 females) was evaluated. The combination of the ELISA / MABA tests detected 78 positive sera, sixty-nine negative and 10 of inconclusive results. The seroprevalence of the T. cruzi infection in dogs in the state of Sucre, was 22.1% (CI 95%: 20.58-22.4%). No significant statistic association was found between the T. cruzi infection in dogs and the evaluated epidemiological variables: hunting dogs that slept oudoors roaming freely in the populated center, sex of the animal and eating habits. The T. cruzi infection was associated to the age of canines, being significantly higher in the group of 0 to 3 years, when compared with older dogs. The high T. cruzi seroprevalence dected in dogs shows that in this región of Venezuela there prevails an important risk factor of transmissibility of this parasite to human populations.
A protected area influences genotype-specific survival and the structure of a Canis hybrid zone.

Science.gov (United States)

Benson, John F; Patterson, Brent R; Mahoney, Peter J

2014-02-01

It is widely recognized that protected areas can strongly influence ecological systems and that hybridization is an important conservation issue. However, previous studies have not explicitly considered the influence of protected areas on hybridization dynamics. Eastern wolves are a species of special concern and their distribution is largely restricted to a protected population in Algonquin Provincial Park (APP), Ontario, Canada, where they are the numerically dominant canid. We studied intrinsic and extrinsic factors influencing survival and cause-specific mortality of hybrid and parental canids in the three-species hybrid zone between eastern wolves, eastern coyotes, and gray wolves in and adjacent to APP. Mortality risk for eastern wolves in areas adjacent to APP was significantly higher than for other sympatric Canis types outside of APP, and for eastern wolves and other canids within APP. Outside of APP, the annual mortality rate of all canids by harvest (24%) was higher than for other causes of death (4-7%). Furthermore, eastern wolves (hazard ratio = 3.5) and nonresidents (transients and dispersing animals, hazard ratio = 2.7) were more likely to die from harvest relative to other Canis types and residents, respectively. Thus, eastern wolves dispersing from APP were especially vulnerable to harvest mortality. For residents, eastern wolf survival was more negatively influenced by increased road density than for other Canis types, further highlighting the sensitivity of eastern wolves to human disturbance. A cycle of dispersal from APP followed by high rates of mortality and hybridization appears to maintain eastern wolves at low density adjacent to APP, limiting the potential for expansion beyond the protected area. However, high survival and numerical dominance of eastern wolves within APP suggest that protected areas can allow rare hybridizing species to persist even if their demographic performance is compromised and barriers to hybridization are largely
Anti-Hepatozoon canis serum antibodies and gamonts in naturally-occurring canine monocytic ehrlichiosis.

Science.gov (United States)

Mylonakis, Mathios E; Leontides, Leonidas; Gonen, Liat; Billinis, Charalambos; Koutinas, Alexander F; Baneth, Gad

2005-05-15

The prevalence of IgG antibodies to Hepatozoon canis and the presence of gamonts in the blood and hemolymphatic tissues were studied in dogs with canine monocytic ehrlichiosis (CME) caused by Ehrlichia canis. Both pathogens are transmitted by the tick Rhipicephalus sanguineus. Forty-five out of 69 (65.2%) dogs with CME were seropositive to H. canis by an enzyme-linked immunosorbent assay (ELISA). Intra-neutrophilic gamonts of H. canis were found in 2 out of 69 dogs (2.9%) comprising 4.5% of the seropositive dogs. The present study indicated that the prevalence of antibodies to H. canis was high among dogs with CME in an area where both infections are endemic. However, previous exposure to H. canis was not found as an important contributor to clinical or clinicopathologic abnormalities found in dogs with CME.
Hepatozoon canis infection in Slovakia: imported or autochthonous?

Science.gov (United States)

Majláthová, Viktória; Hurníková, Zuzana; Majláth, Igor; Petko, Branislav

2007-01-01

Tissue samples from nine red foxes (four samples of striated muscle tissue and five samples of heart tissue) that originated from the Michalovce district (Slovakia), an area with endemic occurrence of canine babesiosis were examined by PCR method using primers amplifying a fragment of the 18S rRNA spanning the V4 region of Babesia and Theileria. An unexpected determination of 450 bp DNA fragment of Hepatozoon canis was found in four samples. Partial sequences of the 18S rRNA gene from the H. canis showed 100% similarity with the sequence from Brasil isolate of H. canis from a pampas fox (Pseudalopex gymnocercus) (AY471615) as well as from a fox in Spain (AY150067) and from a dog in Brazil (AY864677). In the present study, we report the first PCR detection of Hepatozoon canis in a naturally infected red fox from Slovakia, a Rhipicephalus sanguineus-free region. We assume that the infection was spread by infected R. sanguineus that might have been brought to Slovakia by travelers, by golden jackals, or by foxes migrating because of expansion of golden jackals and environmental and climate changes.
Molecular and serological detection of Ehrlichia canis and Babesia vogeli in dogs in Colombia.

Science.gov (United States)

Vargas-Hernández, G; André, M R; Faria, J L M; Munhoz, T D; Hernandez-Rodriguez, M; Machado, R Z; Tinucci-Costa, M

2012-05-25

Ehrlichiosis and babesiosis are tick-borne diseases, caused mainly by Ehrlichia canis and Babesia canis, respectively, with a worldwide occurrence in dogs, whose main vector is the brown-dog tick, Rhipicephalus sanguineus. The present work aimed to detect the presence of E. canis and Babesia sp. in 91 dog blood samples in Colombia, by molecular and serological techniques. We also performed sequence alignment to indicate the identity of the parasite species infecting these animals. The present work shows the first molecular detection of E. canis and B. vogeli in dogs from Colombia. Immunoglobulin-G (IgG) antibodies to E. canis and Babesia vogeli were found in 75 (82.4%) and 47 (51.6%) sampled dogs, respectively. Thirty-seven (40.6%) and 5 (5.5%) dogs were positive in PCR for E. canis and Babesia sp., respectively. After sequencing, amplicons showed 99% of identity with isolates of E. canis and B. vogeli. The phylogenetic trees based on 16S rRNA-Anaplasmataceae sequences and 18S rRNA-piroplasmid sequences supported the identity of the found E. canis and B. vogeli DNAs, respectively. The present work shows the first molecular detection of E. canis and B. vogeli in dogs in Colombia. Copyright © 2011 Elsevier B.V. All rights reserved.
Neutropenia associated with osteomyelitis due to Hepatozoon canis infection in a dog.

Science.gov (United States)

Shimokawa Miyama, Takako; Umeki, Saori; Baba, Kenji; Sada, Kumiko; Hiraoka, Hiroko; Endo, Yasuyuki; Inokuma, Hisashi; Hisasue, Masaharu; Okuda, Masaru; Mizuno, Takuya

2011-10-01

A 4-year-old, intact male Shiba dog was referred to Yamaguchi University Animal Medical Center, Yamaguchi, Japan, for the following complaints: anorexia, lethargy, intermittent fever, gingival bleeding and abdominal purpura. The dog presented with persistent neutropenia. Histopathological examination of a bone marrow sample revealed round to oval structures that resembled Hepatozoon micromerozoites and formed a "wheel-spoke" pattern. Furthermore, mature neutrophils were observed around these structures. PCR and sequencing using bone marrow aspirate confirmed Hepatozoon canis (H. canis) infection. These findings suggest that the neutropenia observed in this case was associated with osteomyelitis due to H. canis infection. This is the first report of neutropenia associated with H. canis infection. H. canis infection can be included in the differential diagnosis in canine cases of neutropenia in areas where the disease is endemic.
The prevalence and impact of Babesia canis and Theileria sp. in free-ranging grey wolf (Canis lupus) populations in Croatia.

Science.gov (United States)

Beck, Ana; Huber, Doroteja; Polkinghorne, Adam; Kurilj, Andrea Gudan; Benko, Valerija; Mrljak, Vladimir; Reljić, Slaven; Kusak, Josip; Reil, Irena; Beck, Relja

2017-04-04

Babesia spp. and Theileria spp. are important emerging causes of disease in dogs. Alongside these domesticated hosts, there is increasing recognition that these piroplasms can also be found in a range of wild animals with isolated reports describing the presence of these pathogen in foxes (Vulpes vulpes) and captive grey wolves (Canis lupus). The prevalence and impact of these infections in free-ranging populations of canids are unknown. To gain a better insight into the epidemiology and pathogenesis of piroplasm infections in free-ranging grey wolves, pathological and molecular investigations into captive and free-ranging grey wolves in Croatia were performed. The carcasses of 107 free-ranging wolves and one captive wolf were the subjects of post-mortem investigations and sampling for molecular studies. A blood sample from one live captured wolf for telemetric tracking was also used for molecular analysis. PCR amplification targeting the 18S RNA gene revealed that 21 of 108 free-ranging wolves and one captive animal were positive for Theileria/Babesia DNA. Subsequent sequencing of a fragment of the 18S RNA gene revealed that 7/22 animals were positive for Babesia canis while the other amplified sequence were found to be identical with corresponding 18S rDNA sequences of Theileria capreoli isolated from wild deer (15/22). Haematological and cytological analysis revealed the presence of signet-ring shaped or pear-shaped piroplasms in several animals with the overall parasite burden in all positive animals assessed to be very low. Pathological investigation of the captive animal revealed fatal septicemia as a likely outcome of hemolytic anaemia. There was little or no evidence of hemolytic disease consistent with babesiosis in other animals. Importantly, the presence of B. canis in free-ranging grey wolves has not been described before but has been reported in a single fox and domestic dogs only. That B. canis infections cause disease in dogs but have little impact
Lactobacillus rhamnosus reduces parasite load on Toxocara canis experimental infection in mice, but has no effect on the parasite in vitro.

Science.gov (United States)

Walcher, Débora Liliane; Cruz, Luis Augusto Xavier; de Lima Telmo, Paula; Martins, Lourdes Helena Rodrigues; da Costa de Avila, Luciana Farias; Berne, Maria Elisabeth Aires; Scaini, Carlos James

2018-02-01

Human toxocariasis is a neglected global parasitic zoonosis. The efficacy of drug treatment for this disease has been hindered by the biological complexity of the main etiological agent, the nematode Toxocara canis. Experimental studies have shown the potential of probiotics to promote a reduction in the parasite load of T. canis larvae. This study aimed to evaluate the effect of probiotic Lactobacillus rhamnosus ATCC 7469 on the parasite load of BALB/c mice with acute toxocariasis and evaluate the direct effect of this probiotic on T. canis larvae in vitro. In vivo administration of probiotics reduced the parasite load of T. canis larvae by 53.3% (p = 0.0018) during the early stage of infection in mice. However, when analyzed in vitro, it was observed that the probiotic did not present a deleterious effect on the larvae, as approximately 90% of these remained viable. These results demonstrate the potential of the probiotic L. rhamnosus in the reduction of T. canis larvae in BALB/c mice and suggest it could be used as an alternative means for the controlling of visceral toxocariasis. However, further studies are required to elucidate the mechanisms of action promoted by this probiotic.
Genome Sequence of Canine Polyomavirus in Respiratory Secretions of Dogs with Pneumonia of Unknown Etiology.

Science.gov (United States)

Delwart, Eric; Kapusinszky, Beatrix; Pesavento, Patricia A; Estrada, Marko; Seguin, M Alexis; Leutenegger, Christian M

2017-07-20

We report here the first canine polyomavirus genome, identified by metagenomics in respiratory secretions of two dogs with severe pneumonia, which tested negative for all canine respiratory pathogens except Mycoplasma cynos The isolate, Canis familiaris polyomavirus 1 (DogPyV-1), is a beta polyomavirus whose closest known LT antigen relatives are primate polyomaviruses. Copyright © 2017 Delwart et al.
Seroepidemiology of Toxocara canis infection among primary schoolchildren in the capital area of the Republic of the Marshall Islands.

Science.gov (United States)

Fu, Chung-Jung; Chuang, Ting-Wu; Lin, Huei-Shan; Wu, Chih-Hsiung; Liu, Yung-Ching; Langinlur, Mailynn K; Lu, Min-Yun; Hsiao, Wesley Wei-Wen; Fan, Chia-Kwung

2014-05-15

Toxocariasis, which is predominantly caused by Toxocara canis (T. canis) infection, is a common zoonotic parasitosis worldwide; however, the status of toxocariasis endemicity in the Republic of the Marshall Islands (RMI) remains unknown. A seroepidemiological investigation was conducted among 166 primary school children (PSC) aged 7-12 years from the capital area of the RMI. Western blots based the excretory-secretory antigens of larval T. canis (TcES) was employed, and children were considered seropositive if their serum reacted with TcES when diluted at a titer of 1:64. Information regarding demographic characteristics of and environmental risk factors affecting these children was collected using a structured questionnaire. A logistic regression model was applied to conduct a multivariate analysis. The overall seropositive rate of T. canis infection was 86.75% (144/166). In the univariate analysis, PSC who exhibited a history of feeding dogs at home (OR = 5.52, 95% CI = 1.15-26.61, p = 0.02) and whose parents were employed as nonskilled workers (OR = 2.86, 95% CI = 1.08-7.60, p = 0.03) demonstrated a statistically elevated risk of contracting T. canis infections. Cleaning dog huts with gloves might prevent infection, but yielded nonsignificant effects. The multivariate analysis indicated that parental occupation was the critical risk factor in this study because its effect remained significant after adjusting for other variables; by contrast, the effect of dog feeding became nonsignificant because of other potential confounding factors. No associations were observed among gender, age, consuming raw meat or vegetables, drinking unboiled water, cleaning dog huts with gloves, or touching soil. This is the first serological investigation of T. canis infection among PSC in the RMI. The high seroprevalence indicates the commonness of T. canis transmission and possible human risk. The fundamental information that the present study provides
Transstadial transmission of Hepatozoon canis from larvae to nymphs of Rhipicephalus sanguineus.

Science.gov (United States)

Giannelli, Alessio; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Mencke, Norbert; Dantas-Torres, Filipe; Baneth, Gad; Otranto, Domenico

2013-09-01

Hepatozoon canis is an apicomplexan parasite of dogs, which is known to become infected by ingesting Rhipicephalus sanguineus adult ticks. To investigate the possibility of H. canis transovarial and transstadial transmission from larvae to nymphs, engorged adult female ticks were collected from a private animal shelter in southern Italy, where H. canis infection is highly prevalent. Female ticks (n=35) and egg batches were tested by PCR for H. canis. All eggs examined were PCR-negative whereas 88.6% of females from the environment tested positive. Additionally, fed larvae (n=120) from a dog naturally infected by H. canis were dissected at different time points post collection (i.e. 0, 10, 20 and 30 days). Molted nymphs dissected at 20 days post collection revealed immature oocysts displaying an amorphous central structure in 50% of the specimens, and oocysts containing sporocysts with sporozoites were found in 53.3% of the nymphs dissected at 30 days post collection. This study demonstrates that H. canis is not transmitted transovarially, but it is transmitted transstadially from larvae to nymphs of R. sanguineus and develops sporozoites in oocysts that may infect dogs. Copyright © 2013 Elsevier B.V. All rights reserved.

Hematologic changes in dogs naturally infected Leptospira spp., Brucella abortus and Brucella canis

Directory of Open Access Journals (Sweden)

Jacqueline Ribeiro de Castro

2014-01-01

Full Text Available ABSTRACT. Castro J.R., Silva C.B., Souza M.A., Salaberry S.R.S., Guimarães E.C., Mundim A.V. & Lima-Ribeiro A.M.C. [Hematologic changes in dogs naturally infected Leptospira spp., Brucella abortus and Brucella canis.] Altera- ções hematológicas em cães naturalmente infectados por Leptospira spp., Brucella abortus e Brucella canis. Revista Brasileira de Medicina Veterinária, 36(1:49-54, 2014. Laboratório de Doenças Infectocontagiosas, Faculdade de Medicina Veterinária, Universidade Federal de Uberlândia, Av. Ceará s/n, Bloco 2D, Sala 33, Campus Umuarama, Uberlândia, MG 38400-902, Brasil. E-mail: jack_ufu@yahoo.com.br The investigations of leptospirosis and brucellosis canine act as sanitary control in public health and zoonoses because they were established by close contact between dog and human. The aim was to determine the main hematological reagents in asymptomatic dogs against Leptospira spp. Brucella abortus and Brucella canis naturally infected, living in urban areas in the city of Uberlandia, Minas Gerais. We examined 140 blood samples from clinically healthy dogs, males and females and different ages. Leptospirosis was diagnosed by microscopic agglutination test (MAT, with a collection of twelve serovars, whereas, brucellosis was identified through the tests of Agar Gel Immunodiffusion (AGID for B. canis and buffered acidified antigen (TAA confirmed 2-Mercaptoethanol (2-ME for B. abortus. The results were analyzed using descriptive statistics with the calculation of simple percentages, mean and standard deviation. He applied and short sample t test for two independent samples to assess whether there were significant differences (p<0.05 between hematological parameters obtained. Dogs evaluated, 15% (21/140 and 2.85% (4/140 were reactive to Leptospira spp. and B. abortus, respectively. There was no sample reagent against B. canis. It was concluded that although no specific thrombocytopenia may be a significant finding in dogs
Comparison of effects of humans versus wildlife-detector dogs

Science.gov (United States)

Heaton, Jill S.; Cablk, Mary E.; Nussear, Kenneth E.; Esque, Todd C.; Medica, Philip A.; Sagebiel, John C.; Francis, S. Steve

2008-01-01

The use of dogs (Canis lupus familiaris) trained to locate wildlife under natural conditions may increase the risk of attracting potential predators or alter behavior of target species. These potentially negative effects become even more problematic when dealing with threatened or endangered species, such as the Mojave Desert tortoise (Gopherus agassizii). We addressed three concerns regarding use of dogs trained to locate desert tortoises in the wild. First, we looked at the potential for dogs to attract native and non-native predators to sites at a greater rate than with human visitation alone by comparing presence of predator sign before and after visitation by dogs and by humans. We found no significant difference in predator sign based upon type of surveyor. Second, we looked at the difference in risk of predation to desert tortoises that were located in the wild by humans versus humans with wildlife-detector dogs. Over a 5-week period, during which tortoises were extensively monitored and a subsequent period of 1 year during which tortoises were monitored monthly, there was no predation on, nor sign of predator-inflicted trauma to tortoises initially encountered either by humans or wildlife-detector dogs. Third, we looked at movement patterns of tortoises after encounter by either humans or wildlife-detector dogs. Movement of desert tortoises was not significantly different after being found by a human versus being found by a wildlife-detector dog. Based upon these initial results we conclude that use of trained wildlife-detector dogs to survey for desert tortoises in the wild does not appear to increase attraction of predators, increase risk of predation, or alter movement patterns of desert tortoises more than surveys conducted by humans alone.
Free-ranging dogs prefer petting over food in repeated interactions with unfamiliar humans.

Science.gov (United States)

Bhattacharjee, Debottam; Sau, Shubhra; Das, Jayjit; Bhadra, Anindita

2017-12-15

Dogs ( Canis lupus familiaris ) are the first species to have been domesticated and, unlike other domesticated species, they have developed a special bond with their owners. The ability to respond to human gestures and language, and the hypersocial behaviours of dogs are considered key factors that have led them to become man's best friend. Free-ranging dogs provide an excellent model system for understanding the dog-human relationship in various social contexts. In India, free-ranging dogs occur in all possible human habitations. They scavenge among garbage, beg for food from humans, give birth in dens close to human habitations, and establish social bonds with people. However, there is ample dog-human conflict on the streets, leading to morbidity and mortality of dogs. Hence, the ability to assess an unfamiliar human before establishing physical contact could be adaptive for dogs, especially in the urban environment. We tested a total of 103 adult dogs to investigate their response to immediate social and long-term food and social rewards. The dogs were provided a choice of obtaining food either from an experimenter's hand or the ground. The dogs avoided making physical contact with the unfamiliar human. While immediate social reward was not effective in changing this response, the long-term test showed a strong effect of social contact. Our results revealed that these dogs tend to build trust based on affection, not food. This study provides significant insights into the dynamics of dog-human interactions on the streets and subsequent changes in behaviour of dogs through the process of learning. © 2017. Published by The Company of Biologists Ltd.
Sarcocystis canis associated hepatitis in a Steller sea lion (Eumetopias jubatus) from Alaska.

Science.gov (United States)

Welsh, Trista; Burek-Huntington, Kathy; Savage, Kate; Rosenthal, Benjamin; Dubey, J P

2014-04-01

Sarcocystis canis infection was associated with hepatitis in a Steller sea lion (Eumetopias jubatus). Intrahepatocellular protozoal schizonts were among areas of necrosis and inflammation. The parasite was genetically identical to S. canis and is the first report in a Steller sea lion, indicating another intermediate host species for S. canis.
Digital gene expression analysis of Microsporum canis exposed to berberine chloride.

Directory of Open Access Journals (Sweden)

Chen-Wen Xiao

Full Text Available Berberine, a natural isoquinoline alkaloid of many medicinal herbs, has an active function against a variety of microbial infections including Microsporum canis (M. canis. However, the underlying mechanisms are poorly understood. To study the effect of berberine chloride on M. canis infection, a Digital Gene Expression (DGE tag profiling was constructed and a transcriptome analysis of the M. canis cellular responses upon berberine treatment was performed. Illumina/Hisseq sequencing technique was used to generate the data of gene expression profile, and the following enrichment analysis of Gene Ontology (GO and Pathway function were conducted based on the data of transcriptome. The results of DGE showed that there were 8476945, 14256722, 7708575, 5669955, 6565513 and 9303468 tags respectively, which was obtained from M. canis incubated with berberine or control DMSO. 8,783 genes were totally mapped, and 1,890 genes have shown significant changes between the two groups. 1,030 genes were up-regulated and 860 genes were down-regulated (P<0.05 in berberine treated group compared to the control group. Besides, twenty-three GO terms were identified by Gene Ontology functional enrichment analysis, such as calcium-transporting ATPase activity, 2-oxoglutarate metabolic process, valine catabolic process, peroxisome and unfolded protein binding. Pathway significant enrichment analysis indicated 6 signaling pathways that are significant, including steroid biosynthesis, steroid hormone biosynthesis, Parkinson's disease, 2,4-Dichlorobenzoate degradation, and tropane, piperidine and Isoquinoline alkaloid biosynthesis. Among these, eleven selected genes were further verified by qRT-PCR. Our findings provide a comprehensive view on the gene expression profile of M. canis upon berberine treatment, and shed light on its complicated effects on M. canis.
Critical analysis of vector-borne infections in dogs: Babesia vogeli, Babesia gibsoni, Ehrlichia canis and Hepatozoon canis in Punjab, India.

Science.gov (United States)

Singla, Lachhman Das; Sumbria, Deepak; Mandhotra, Ajay; Bal, M S; Kaur, Paramjit

2016-12-01

There are few published studies on various vector borne diseases of dogs in India and most depict clinical infection in dogs, diagnosed by observation of the haemopathogens in stained blood smears. This study provides the first report regarding molecular confirmation and ancestral relationship analysis of blood smears positive cases of assorted haemopathogens in Punjab province of India. On blood smear examination, haemopathogens were observed in 124 out of 778 (15.95%, 95% CI: 13.53- 18.68) blood smears. Further polymerase chain reactions (PCR) was used on bloods smear positive cases to validate the results. Out of 778 blood samples, Babesia gibsoni was most common parasite infecting dogs (15.04%, 95% CI: 12.7-17.72), followed by Ehrlichia canis (0.39%, 95% CI: 0.0-1.13), infection of Babesia vogeli and Hepatozoon canis was same (0.26%, 95% CI: 0.0-0.9). Among various risk factors studied (age, sex, season), prevalence of infection was non-significantly higher in 1-2 year of age group (19.88%, 95% CI: 14.45-26.71), regarding sex same prevalence was recorded (15.94%), and chances of infection was highest in pre-monsoon i.e. summer (18.26%, 95% CI: 14.49-22.76). Phylogenetic analysis revealed ancestral background of Ludhiana isolates of B. vogeli, B. gibsoni, H. canis, and E. canis with the isolates of Philippines, Mongolia and Tunisia.
Restricted evaluation of Trichodectes canis (Phthiraptera: Trichodectidae detection methods in Alaska gray wolves

Directory of Open Access Journals (Sweden)

Theresa M. Woldstad

2014-12-01

Full Text Available Trichodectes canis (Phthiraptera: Trichodectidae was first documented on Alaska (USA gray wolves (Canis lupus on the Kenai Peninsula in 1981. In subsequent years, numerous wolves exhibited visually apparent, moderate to severe infestations. Currently, the Alaska Department of Fish and Game utilizes visual inspection, histopathology, and potassium hydroxide (KOH hide digestion for T. canis detection. Our objective was to determine optimal sampling locations for T. canis detection. Wolf hides were subjected to lice enumeration using KOH hide digestion. Thirty nine of the 120 wolves examined had lice. Of these 39, total louse burdens ranged from 14 to an extrapolated 80,000. The hides of 12 infested animals were divided into 10 cm by 10 cm subsections and the lice enumerated on a subsection from each of four regions: neck; shoulder; groin; and rump. Combining the data from these 12 wolves, the highest mean proportions of the total louse burdens on individual wolves were found on the rump and differed significantly from the lowest mean proportion on the neck. However, examination of the four subsections failed to detect all infested wolves. Hides from 16 of the 39 infested animals were cut into left and right sides, and each side then cut into four, approximately equal sections: neck and shoulder; chest; abdomen; and rump. Half hides were totally digested from 11 wolves, and whole hides from 5. For these 21 half hides, the highest mean proportions of total louse burdens were found on the rump, and this section had the highest sensitivity for louse detection, regardless of burden. However, removal of this large section from a hide would likely be opposed by hunters and trappers.
Zoonotic enteric parasites transmitted from dogs in Egypt with special concern to Toxocara canis infection

Science.gov (United States)

Awadallah, Maysa A. I.; Salem, Lobna M. A.

2015-01-01

Aim: This work aimed to study the role played by dogs in transmitting zoonotic enteric parasites to humans in Egypt and to analyze the risk factors associated with the occurrence of such infection in dogs. Serodiagnosis of anti-Toxocara immunoglobulin G (IgG) antibodies among human beings as well as analyzing risk factors predispose to Toxocara canis infection in human beings are another objectives of this study. Materials and Methods: From June to December 2013, a total of 130 fecal samples from 4 dog populations (Military, nomadic and domiciled dogs from rural and high standard districts) and 150 stool samples of 6 occupational groups were examined for the presence of enteric parasitic infection. Moreover, 150 serum samples were collected from humans from whom stool samples were collected and examined for the presence of anti-T. canis antibodies. Results: Enteric parasites were detected in 30% of fecal samples from 4 dog populations in Egypt. High infectivity had been reported in nomadic dogs (63.33%) (Crude odds ratios [COR]=67.36, 95% confidence interval [CI]=8.09-560.8, p0.05) did not seem to have a significant association among the examined dogs. Enteric parasitic infection was reported in 31/150 human stools (20.67%). Students were the most affected groups (37.14%), followed by nomadic people (24%), house wives (20%), house guarders and military workers (12%, each), and employees (10%). The identified parasites were Cryptosporidium spp. (9.33%), Ascaris lumbercoides (3.33%), Heterophyes spp. and Ancylostoma spp. (2.66%, each) and Paragonimus spp. and Hymenolepis nana (1.33%, each). Toxocara IgG antibodies were detected in 36/150 (24%) serum samples investigated. Toxocara IgG antibodies were more prevalent in males (26.66%) than females (20%). Seroprevalence was highest (17/35, 48.57%) in 7-15 years old (COR=6.93, 95% CI=1.75-27.43, p=0.006). Seroprevalence values for T. canis antibodies were higher in those; raising dogs (29.85%), eating raw vegetables (25
Identification of toxocara canis antigens by Western blot in experimentally infected rabbits

Directory of Open Access Journals (Sweden)

MORALES Olga Lucía

2002-01-01

Full Text Available Toxocariasis is a frequent helminthiasis that can cause visceral and ocular damage in humans specially in children. The identification of specific antigens of Toxocara canis is important in order to develop better diagnostic techniques. Ten rabbits were infected orally with a dose of 5000 Toxocara canis embryonated eggs. Rabbits were bled periodically and an ELISA assay was performed to determine levels of specific Toxocara IgG antibodies. ELISA detected antibodies at day 15 after infection. Western blot (WB assay was performed using excretory/secretory antigens (E/S of T. canis second stage larvae. Different antigen concentrations were evaluated: 150, 200, 250 and 300 µg/mL. The concentration of 250 µg/mL was retained for analysis. Rabbit sera were diluted 1:100. Secondary antibody was used at a dilution of 1:1000. Results of WB indicated that in the first month after infection specific antibodies against the 200 KDa, 116 KDa, 92 KDa and 35 KDa antigens were detected; antibodies against the 92 KDa, 80 KDa, 66 KDa, 45 KDa, 31 KDa and 28 KDa antigens appeared later. All positive sera in the ELISA test were also positive in WB. Two antigen bands, 92 KDa and 35 KDa, were identified since the beginning and throughout the course of infection. These antigens merit further evaluation as candidates for use in diagnosis.
Ecological changes in Coyotes (Canis latrans in response to the ice age megafaunal extinctions.

Directory of Open Access Journals (Sweden)

Julie A Meachen

Full Text Available Coyotes (Canis latrans are an important species in human-inhabited areas. They control pests and are the apex predators in many ecosystems. Because of their importance it is imperative to understand how environmental change will affect this species. The end of the Pleistocene Ice Age brought with it many ecological changes for coyotes and here we statistically determine the changes that occurred in coyotes, when these changes occurred, and what the ecological consequences were of these changes. We examined the mandibles of three coyote populations: Pleistocene Rancho La Brean (13-29 Ka, earliest Holocene Rancho La Brean (8-10 Ka, and Recent from North America, using 2D geometric morphometrics to determine the morphological differences among them. Our results show that these three populations were morphologically distinct. The Pleistocene coyotes had an overall robust mandible with an increased shearing arcade and a decreased grinding arcade, adapted for carnivory and killing larger prey; whereas the modern populations show a gracile morphology with a tendency toward omnivory or grinding. The earliest Holocene populations are intermediate in morphology and smallest in size. These findings indicate that a niche shift occurred in coyotes at the Pleistocene/Holocene boundary - from a hunter of large prey to a small prey/more omnivorous animal. Species interactions between Canis were the most likely cause of this transition. This study shows that the Pleistocene extinction event affected species that did not go extinct as well as those that did.
Genetic blueprint of the zoonotic pathogen Toxocara canis

DEFF Research Database (Denmark)

Zhu, Xing-Quan; Korhonen, Pasi K.; Cai, Huimin

2015-01-01

Toxocara canis is a zoonotic parasite of major socioeconomic importance worldwide. In humans, this nematode causes disease (toxocariasis) mainly in the under-privileged communities in developed and developing countries. Although relatively well studied from clinical and epidemiological perspectives...... of 13.5% and encodes at least 18,596 protein-coding genes. We study transcription in a larval, as well as adult female and male stages, characterize the parasite's gene-silencing machinery, explore molecules involved in development or host-parasite interactions and predict intervention targets...
ULTRAESTRUCTURA DE Microsporum canis: UN CASO DE Tinea Capitis TRATADO TÓPICAMENTE CON AJOENE I ULTRAESTRUCTURE OF Microsporum canis: A CASE OF Tinea Capitis TREATED TOPICALLY WITH AJOENE

Directory of Open Access Journals (Sweden)

Duvric Espinoza-Lemus

2015-07-01

Full Text Available In this study, topic ajoene was used (0.4% to evaluate its effects in a case of a fungal infection of the scalp caused by Microsporum canis, a dermatophytes with a known keratinophylic activity. The activity of the fungus was evaluated by transmission electron microscopy, in samples extracted before the beginning and 45 days after the treatment. The most important changes were alteration of the cytoplasmic membrane, disintegration of the cytoplasm and organelles deterioration. This new evidence in the studies in vivo shows the degeneration suffered by conidia and hyphae of the fungus, compromising the cellular integrity with the topical treatment with ajoene. The cultures, 30 days after treatment, demonstrated the absence of the fungal structures maintaining this condition up to 45 days after the treatment. The study shows ultrastructurally the invasion endo-ectotrix of M. canis in human hair and the antifungal effect characteristic of ajoene with its outstanding and potent bioactivity antiproliferative bioactive in the evaluated micotic process.
Infestivity of Demodex canis to hamster skin engrafted onto SCID mice.

Science.gov (United States)

Tani, Kenji; Une, Satoshi; Hasegawa, Atsuhiko; Adachi, Makoto; Kanda, Naoko; Watanabe, Shin-ichi; Nakaichi, Munekazu; Taura, Yasuho

2005-04-01

We demonstrated that Demodex canis was transferred to skin xenografts of a dog and a hamster onto severe combined immunodeficiency mice. After the transfer of mites, the number of eggs, larvae, nymphs and adult mites per gram of canine and hamster xenografts increased, whereas no live mites were detected on murine allograft. These results indicate that D. canis proliferates in hair follicles of dog and hamster skins but not in murine allograft. Therefore, D. canis may have host preference but not strict host-specificity.
Seroprevalence of Ehrlichia canis, Ehrlichia chaffeensis and Ehrlichia ewingii in dogs in North America

Directory of Open Access Journals (Sweden)

Beall Melissa J

2012-02-01

Full Text Available Abstract Background This study evaluated the exposure of dogs to three different Ehrlichia spp. in the south and central regions of the United States where vector-borne disease prevalence has been previously difficult to ascertain, particularly beyond the metropolitan areas. Methods Dog blood samples (n = 8,662 were submitted from 14 veterinary colleges, 6 private veterinary practices and 4 diagnostic laboratories across this region. Samples were tested for E. canis, E. chaffeensis and E. ewingii specific antibodies using peptide microtiter ELISAs. Results Overall, E. canis, E. chaffeensis and E. ewingii seroprevalence was 0.8%, 2.8%, and 5.1%, respectively. The highest E. canis seroprevalence (2.3% was found in a region encompassing Arkansas, Louisiana, Oklahoma, Tennessee and Texas. E. chaffeensis seroreactivity was 6.6% in the central region (Arkansas, Kansas, Missouri, and Oklahoma and 4.6% in the southeast region (Georgia, Maryland, North Carolina, South Carolina, Tennessee and Virginia. Seroreactivity to E. ewingii was also highest in the central region (14.6% followed by the southeast region (5.9%. The geospatial pattern derived from E. chaffeensis and E. ewingii seropositive samples was similar to previous reports based on E. chaffeensis seroreactivity in white-tailed deer and the distribution of human monocytic ehrlichiosis (HME cases reported by the CDC. Conclusions The results of this study provide the first large scale regional documentation of exposure to E. canis, E. chaffeensis and E. ewingii in pet dogs, highlighting regional differences in seroprevalence and providing the basis for heightened awareness of these emerging vector-borne pathogens by veterinarians and public health agencies.
Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

Directory of Open Access Journals (Sweden)

Éloïse C Déaux

Full Text Available Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual or bimodal (audio-visual stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.
Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

Science.gov (United States)

Déaux, Éloïse C; Clarke, Jennifer A; Charrier, Isabelle

2015-01-01

Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks) have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual) or bimodal (audio-visual) stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.
Detecção molecular de Ehrlichia canis e Babesia canis vogeli em Rhipicephalus sanguineus sensu lato de carrapatos em Cuba

Directory of Open Access Journals (Sweden)

Maylin Gonzalez Navarrete

2016-12-01

Full Text Available Os carrapatos (Acari: Ixodidae são de importância médica e veterinária relevantes em todo o mundo por causa da variedade de agentes patogênicos que podem transmitir. No presente trabalho, foi realizada uma pesquisa para identificar Babesia spp. e Ehrlichia spp. em carrapatos coletados de cães de Cuba. Foram coletados 431 carrapatos de 378 cães, tendo sido identificados como pertencentes às espécies de Ripicephalus sanguineus sensu lato (s. 1. O DNA genômico foi extraído com protocolo usando fenol/clorofórmio. Os carrapatos foram organizados em “pools” e o DNA extraído foi testado pela reação em cadeia da polimerase (nPCR para amplificar 398 pares de bases (pb do DNA ribossômico 16S (rDNA de Ehrlichia canis e PCR para amplificar aproximadamente 560 pb do DNA ribossômico 18S (rDNA. Dos 49 pools testados, 8,16% (n = 4/49 foram positivos para o E. canis por nPCR visando o gene do 16S rDNA e apenas um pool (n = 1/49; 2,04% foi positivo para o gene 18S rDNA para Babesia canis. As quatro sequências obtidas para o fragmento de 16S rDNA foram idênticas entre si e resultaram em 100% de identidade com E. canis de diferentes países. A sequência obtida do gene do 18S rDNA para Babesia spp. apresentou semelhança de 100% com Babesia canis vogeli quando comparada às sequências depositadas no Genbank. Esta foi a primeira detecção molecular desses agentes no carrapato R. sanguineus s. l. em Cuba.
Angiostrongylus vasorum in 20 cani della provincia di Chieti, Italia

Directory of Open Access Journals (Sweden)

Daniela Morelli

2011-01-01

Full Text Available A seguito di un caso di Angiostrongylus vasorum, diagnosticato all’inizio del 2008 nella provincia di Chieti, è stata organizzata una ricerca parassitologica al fine di indagare la presenza del parassita nei cani nella stessa area. Da gennaio a settembre 2008 sono stati esaminati 178 cani, 56 carcasse e 122 campioni di feci. Nelle carcasse sono stati ricercati i parassiti adulti nel ventricolo destro e nell’arteria polmonare e le forme larvali in tessuti di organi interni e cervello. Nelle feci è stata ricercata la forma larvale L1 con tre metodiche diagnostiche utilizzate correntemente per la ricerca di endoparassiti e larve di strongili broncopolmonari. Sono stati diagnosticati 20 casi (8,9% con identificazione di parassiti adulti in 5 cani e larve L1 in altri 15 soggetti. L’esame anatomopatologico delle carcasse dei cani con nematodi adulti ha evidenziato polmonite, pleurite, schiuma rossastra in trachea, versamento di liquido sieroemorragico in cavità toracica e ingrossamento di linfonodi medinici e meseraici. L’esame istologico dei tessuti ha evidenziato quadri gravi e sovrapponibili con lesioni da localizzazione dei parassiti in reni, linfonodi e cervello. Il numero cospicuo di casi riscontrati ha reso indispensabile considerare l’angiostrongilosi nelle diagnosi differenziali degli esami clinici e autoptici di cani della provincia di Chieti (Italia e dei territori confinanti.
Cultural Resource Reconnaissance of U.S. Army Corps of Engineers Land Alongside Lake Sakakawea in Mountrail County, North Dakota. Volume 1. Main Report

Science.gov (United States)

1987-02-11

introduced by man] (Canis familiaris), otter (Mustela lutra canadensis), badger (Taxidea taxus), porcupine (Erethizon epixanthus), beaver (Castor...grasslands to flourish, and was accompanied by an increase in the size of bison herds . The earliest European observers on the Northern Plains witnessed...Pleistocene megafauna living in herds .. .became extinct about 3000 years ago" (Hester 1960:66). 50 While present evidence from the study region is very
Influence of land use and meteorological factors on the spatial distribution of Toxocara canis and Toxocara cati eggs in soil in urban areas.

Science.gov (United States)

Gao, Xiang; Wang, Hongbin; Li, Jianxin; Qin, Hongyu; Xiao, Jianhua

2017-01-15

Soil which has been contaminated by Toxocara spp. eggs is considered as one of the main infection sources of Toxocariasis in animals and humans. The present study conducted a detailed investigation into the spatial patterns of Toxocara canis (T. canis) and Toxocara cati (T. cati) eggs in soil in urban area of northeastern Mainland China, and assessed the inter-relationships between meteorological factors, land use and the distribution of the Toxocara spp. eggs. Polymerase chain reaction (PCR) was used for the determination of T. canis and T. cati eggs contamination in soil samples. Between April 2014 and May 2015, 9420 soil samples were subjected to PCR examination and 7027 sheep (74.6%) were determined to be positive for T. canis and T. cati eggs. Subsequently, we evaluated the effect of land use, and meteorological factors on the spatial distribution of T. canis and T. cati eggs based on a maximum entropy model. Jackknife analysis revealed that the area of residential land, wood and grass land and precipitation may influence the occurrence of T. canis and T. cati eggs in soil. Our findings indicate that land use and meteorological factors may be important variables affecting transmission of Toxocariasis and should be taken into account in the development of future surveillance programmes for Toxocariasis. Copyright © 2016 Elsevier B.V. All rights reserved.

Hepatozoon SPP. Infect Free-Ranging Jaguars (Panthera onca) in Brazil.

Science.gov (United States)

Furtado, Mariana Malzoni; Metzger, Betina; de Almeida Jácomo, Anah Tereza; Labruna, Marcelo Bahia; Martins, Thiago Fernandes; O'Dwyer, Lucia Helena; Paduan, Karina Dos Santos; Porfírio, Grasiela E O; Silveira, Leandro; Sollmann, Rahel; Taniwaki, Sueli Akemi; Tôrres, Natália Mundim; Neto, José Soares Ferreira

2017-06-01

This study investigated the presence of Hepatozoon spp. in jaguars ( Panthera onca ) and domestic animals in the Cerrado, Amazon, and Pantanal biomes of Brazil. Between February 2000 and January 2010, blood samples were collected from 30 jaguars, 129 domestic dogs ( Canis lupus familiaris), and 22 domestic cats ( Felis catus ) for molecular tests. All of the jaguars from the Pantanal (n = 22) and Cerrado (n = 4) and 3 of 4 jaguars from the Amazon were positive for Hepatozoon spp. Domestic dogs (62.8%) and cats (31.8%) were also positive for the agent. Hepatozoon nucleotide sequences from jaguars and domestic cats grouped with other Hepatozoon felis, whereas Hepatozoon from domestic dogs showed high similarity to Hepatozoon canis. Different species of Amblyomma were identified as parasitizing the jaguars and may act as vectors for Hepatozoon spp. Jaguars from the 3 sites were healthy and did not seem to be threatened by the hemoparasite within its population or environments. Most likely, jaguars play an important role in the maintenance of Hepatozoon spp. in nature.
Do as I … Did! Long-term memory of imitative actions in dogs (Canis familiaris).

Science.gov (United States)

Fugazza, Claudia; Pogány, Ákos; Miklósi, Ádám

2016-03-01

This study demonstrates long-term declarative memory of imitative actions in a non-human animal species. We tested 12 pet dogs for their ability to imitate human actions after retention intervals ranging from 1 to 24 h. For comparison, another 12 dogs were tested for the same actions without delay between demonstration and recall. Our test consisted of a modified version of the Do as I Do paradigm, combined with the two-action procedure to control for non-imitative processes. Imitative performance of dogs remained consistently high independent of increasing retention intervals, supporting the idea that dogs are able to retain mental representations of human actions for an extended period of time. The ability to imitate after such delays supports the use of long-term declarative memory.
Occurrence of Hepatozoon canis (Adeleorina: Hepatozoidae) and Anaplasma spp. (Rickettsiales: Anaplasmataceae) in black-backed jackals (Canis mesomelas) in South Africa.

Science.gov (United States)

Penzhorn, Barend L; Netherlands, Edward C; Cook, Courtney A; Smit, Nico J; Vorster, Ilse; Harrison-White, Robert F; Oosthuizen, Marinda C

2018-03-20

Domestic dogs are not native to sub-Saharan Africa, which may account for their susceptibility to Babesia rossi, of which endemic black-backed jackals (Canis mesomelas) are natural reservoirs. There is virtually no information on the occurrence of potentially pathogenic haemogregarines (e.g. Hepatozoon canis) or even rickettsial bacteria (e.g. Ehrlichia spp. and Anaplasma spp.) in indigenous canids in sub-Saharan Africa. Such organisms could pose a risk to domestic dogs, as well as to populations of endangered indigenous canid species. Genomic DNA extracted from blood samples taken from 126 free-ranging and 16 captive black-backed jackals was subjected to reverse line blot (RLB) hybridization assay; 82 (57.8%) specimens reacted only with the Ehrlichia/Anaplasma genera-specific probe. Full-length bacterial 16S rRNA gene of five of these specimens was cloned and the recombinants sequenced. The ten 16S rDNA sequences obtained were most closely related, with approximately 99% identity, to Anaplasma sp. South African Dog, various uncultured Anaplasma spp., as well as various Anaplasma phagocytophilum genotypes. Ninety-one specimens were screened for haemogregarines through PCR amplification using the 18S rRNA gene; 20 (21.9%) specimens reacted positively, of which 14 (15.4%) were confirmed positive for Hepatozoon genotypes from within H. canis. Two (2.2%) specimens were found positive for two different Hepatozoon genotypes. Sequence analyses confirmed the presence of 16S rDNA sequences closely related to A. phagocytophilum and Anaplasma sp. South African Dog as well as two H. canis genotypes in both free-ranging and captive black-backed jackals. Distinguishing between closely related lineages may provide insight into differences in pathogenicity and virulence of various Anaplasma and H. canis genotypes. By building up a more comprehensive understanding of the range and diversity of the bacteria and eukaryotic organisms (piroplasms and haemogregarines) in the blood of
Object permanence in domestic dogs (Canis lupus familiaris) and gray wolves (Canis lupus).

Science.gov (United States)

Fiset, Sylvain; Plourde, Vickie

2013-05-01

Recent evidence suggests that phylogenetic constraints exerted on dogs by the process of domestication have altered the ability of dogs to represent the physical world and the displacement of objects. In this study, invisible (Experiment 1) and visible (Experiment 2) displacement problems were administered to determine whether domestic dogs' and gray wolves' cognitive capacities to infer the position of a hidden object differ. The results revealed that adult dogs and wolves performed similarly in searching for disappearing objects: Both species succeeded the visible displacement tasks but failed the invisible displacement problems. We conclude that physical cognition for finding hidden objects in domestic dogs and gray wolves is alike and unrelated to the process of domestication.
Serodetection of Ehrlichia canis amongst dogs in central Namibia

Directory of Open Access Journals (Sweden)

Rutendo Manyarara

2015-06-01

Full Text Available Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories. The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6% compared with apparently healthy dogs (41.6% (P = 0.00. Location of habitation was significant (P < 0.017, with a high percentage of dogs exposed to E. canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.
Comparative Foraging Efficiency of Two Sympatric Jackals, Silver-Backed Jackals (Canis mesomelas) and Golden Jackals (Canis aureus), in the Ngorongoro Crater, Tanzania

OpenAIRE

Temu, S. E.; Nahonyo, C. L.; Moehlman, P. D.

2016-01-01

The foraging efficiency of two sympatric species of jackals, silver-backed jackals (Canis mesomelas) and golden jackals (Canis aureus), was studied in the Ngorongoro crater from July 2014 through May 2015. The focal animal observation method was used and individuals of both species were followed as they foraged from morning to evening. Observations of individuals of both jackal species were made from a vehicle using binoculars and a spotting scope. Three major parameters were used for determi...
Prevalence of Toxoplasma gondii and Toxocara canis among Patients with Uveitis.

Science.gov (United States)

Lim, Su Jin; Lee, Sang Eun; Kim, Sun Hyun; Hong, Sung-Hee; You, Yong Sung; Kwon, Oh Woong; Kim, Hyeun Seung

2015-04-01

To investigate the prevalence of Toxoplasma gondii and Toxocara canis in patients with uveitis. Patients with uveitis were examined. Serum antibodies to T. gondii and T. canis were tested by using the enzyme-linked immunosorbent assay. Polymerase chain reaction (PCR) was done using blood and aqueous humor (AH). Ninety-eight patients were enrolled. Mean age was 43.5 ± 13.2 years. Six patients were seropositive for T. gondii with the following pattern: anterior uveitis, 1; posterior uveitis with retinitis, 2; pan uveitis, 2. One patient had a positive PCR result for T. gondii in AH, who showed panuveitis. Twenty-three patients were positive to serum IgG for T. canis with the following clinical manifestation: granuloma, 6; pigmented scar, 3; vitritis, 6--but none were PCR positive. T. gondii and T. canis are still important causes of uveitis. Ocular toxocariasis is not an uncommon cause of uveitis, even in adults.
Extinguishing a learned response in a free-ranging gray wolf (Canis lupus)

Science.gov (United States)

Mech, L. David

2017-01-01

A free-ranging Gray Wolf (Canis lupus), habituated to human presence (the author) on Ellesmere Island, Canada, learned to anticipate experimental feeding by a human, became impatient, persistent, and bold and exhibited stalking behaviour toward the food source. Only after the author offered the wolf about 90 clumps of dry soil over a period of 45 minutes in three bouts, did the wolf give up this behaviour. To my knowledge, this is the first example of extinguishing a learned response in a free-ranging wolf and provides new insight into the learning behaviour of such animals.
Detection of Babesia canis vogeli and Hepatozoon canis in canine blood by a single-tube real-time fluorescence resonance energy transfer polymerase chain reaction assay and melting curve analysis.

Science.gov (United States)

Kongklieng, Amornmas; Intapan, Pewpan M; Boonmars, Thidarut; Thanchomnang, Tongjit; Janwan, Penchom; Sanpool, Oranuch; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

2015-03-01

A real-time fluorescence resonance energy transfer polymerase chain reaction (qFRET PCR) coupled with melting curve analysis was developed for detection of Babesia canis vogeli and Hepatozoon canis infections in canine blood samples in a single tube assay. The target of the assay was a region within the 18S ribosomal RNA gene amplified in either species by a single pair of primers. Following amplification from the DNA of infected dog blood, a fluorescence melting curve analysis was done. The 2 species, B. canis vogeli and H. canis, could be detected and differentiated in infected dog blood samples (n = 37) with high sensitivity (100%). The detection limit for B. canis vogeli was 15 copies of a positive control plasmid, and for H. canis, it was 150 copies of a positive control plasmid. The assay could simultaneously distinguish the DNA of both parasites from the DNA of controls. Blood samples from 5 noninfected dogs were negative, indicating high specificity. Several samples can be run at the same time. The assay can reduce misdiagnosis and the time associated with microscopic examination, and is not prone to the carryover contamination associated with the agarose gel electrophoresis step of conventional PCR. In addition, this qFRET PCR method would be useful to accurately determine the range of endemic areas or to discover those areas where the 2 parasites co-circulate. © 2015 The Author(s).
Mycoplasma canis and urogenital disease in dogs in Norway

DEFF Research Database (Denmark)

L'Abee-Lund, T.M.; Heiene, R.; Friis, N.F.

2003-01-01

Mycoplasmas identified as Mycoplasma canis were isolated from nine dogs with clinical signs of urogenital disease in Norway over a period of 20 months. Some of the dogs had been treated unsuccessfully with antibiotics, and three were euthanased as a result of severe persistent disease. Seven...... of the dogs had a urinary tract infection, one had chronic purulent epididymitis and one had chronic prostatitis. Overt haematuria was frequently observed among the dogs with cystitis. M canis was isolated in pure culture from seven of the dogs and in mixed culture from the other two. In three cases...... the mycoplasma was cultivated only from urinary sediment, and it was typically obtained in smaller numbers than would be considered indicative of a urinary tract infection. In contrast with most mycoplasmas, the M canis isolated from all the dogs grew on ordinary blood agar plates used for routine...
Social Interaction with an "Unidentified Moving Object" Elicits A-Not-B Error in Domestic Dogs.

Science.gov (United States)

Gergely, Anna; Compton, Anna B; Newberry, Ruth C; Miklósi, Ádám

2016-01-01

Mechanical "unidentified moving objects" (UMO's) are useful for controlled investigations into features of social interaction that generate cooperativeness and positive social affiliation in domestic dogs (Canis familiaris). We hypothesized that, if a UMO interacted socially with a dog, the UMO would become associated with certain social cues and would subsequently affect dog behaviour. We assigned dogs to a Human, Social UMO or Non-Social UMO partner. In the Human and Social UMO conditions, the partner interacted with the dog cooperatively whereas the Non-Social UMO partner was unresponsive to the dog's actions. We then tested dogs with their partner in a Piagetian A-not-B error paradigm, predicting that the Human and Social UMO partners would be more likely to elicit A-not-B errors in dogs than the Non-Social UMO partner. Five trials were conducted in which the dog watched its partner hide a ball behind one of two screens (A or B). As predicted, dogs in the Human and Social UMO conditions were more likely to search for the ball behind the A screen during B trials than dogs in the Non-Social UMO condition. These results reveal that the unfamiliar partner's social responsiveness leads rapidly to accepting information communicated by the partner. This study has generated a better understanding of crucial features of agents that promote dog social behaviour, which will facilitate the programming of robots for various cooperative tasks.
Cutaneous Hepatozoon canis infection in a dog from New Jersey.

Science.gov (United States)

Little, Liz; Baneth, Gad

2011-05-01

A 7-month-old mixed-breed intact female dog was presented to a private veterinarian with a 2 cm in diameter raised, pruritic, alopecic, subcutaneous, fluctuant swelling over the right eye. Cytology of the mass revealed many degenerate neutrophils, moderate numbers of eosinophils, moderate numbers of macrophages, rare mast cells, and few erythrocytes. Rare neutrophils contained a protozoal agent compatible with a Hepatozoon gamont. Real-time polymerase chain reaction of peripheral blood was positive for Hepatozoon canis. The complete sequence identity of the amplified 18S ribosomal RNA fragment from the dog's blood confirmed H. canis and proved it was relatively distant from the corresponding fragment sequence of Hepatozoon americanum. This case is important in documenting an unusual presentation of infection with H. canis outside of the southern United States. © 2011 The Author(s)
First Case of Canine Infection with Hepatozoon canis (Apicomplexa: Haemogregarinidae) in the Republic of Korea.

Science.gov (United States)

Kwon, Seung-Joo; Kim, Yoon-Hee; Oh, Hyun-Hee; Choi, Ul-Soo

2017-10-01

This report describes a dog infected with Hepatozoon canis, the first canine infection in the Republic of Korea. A 2-year-old intact male Maltese dog presented with anorexia and depression. Physical examinations revealed mild dehydration and hyperthermia (39.8°C), and blood analysis showed pancytopenia. Diff-Quik staining of blood smear specimens showed the presence of ellipsoidal shaped structures (gamonts of H. canis) within a small number of neutrophils. Real-time PCR analysis using whole blood confirmed infection by H. canis. The clinical condition of the dog improved after symptomatic treatment and administration of doxycycline. Although a molecular epidemiologic survey in Korea showed H. canis infection of dogs, to our knowledge this is the first report of a dog infection in Korea molecularly shown to be H. canis.
Transstadial Transmission of Hepatozoon canis by Rhipicephalus sanguineus (Acari: Ixodidae) in Field Conditions.

Science.gov (United States)

Aktas, M; Özübek, S

2017-07-01

This study investigated possible transovarial and transstadial transmission of Hepatozoon canis by Rhipicephalus sanguineus (Latreille) ticks collected from naturally infected dogs in a municipal dog shelter and the grounds of the shelter. Four hundred sixty-five engorged nymphs were collected from 16 stray dogs that were found to be infected with H. canis by blood smear and PCR analyses and maintained in an incubator at 28 °C for moulting. Four hundred eighteen nymphs moulted to adults 14-16 d post collection. Unfed ticks from the shelter grounds comprised 1,500 larvae, 2,100 nymphs, and 85 adults; were sorted according to origin, developmental stage, and sex into 117 pools; and screened by 18S rRNA PCR for Hepatozoon infection. Of 60 adult tick pools examined, 51 were infected with H. canis. The overall maximum likelihood estimate (MLE) of infection rate was calculated as 21.0% (CI 15.80-28.21). Hepatozoon canis was detected in 31 out of 33 female pools (MLE 26.96%, CI 17.64-44.33) and 20 out of 27 male pools (MLE 14.82%, CI 20.15-46.41). Among 42 unfed nymph pools collected from the shelter, 26 were infected with H. canis, and MLE of infection was calculated as 1.9% (CI 1.25-2.77). No H. canis DNA was detected in any of the gDNA pools consisting of larva specimens. Partial sequences of the 18S rRNA gene shared 99-100% similarity with the corresponding H. canis isolates. Our results revealed the transstadial transmission of H. canis by R. sanguineus, both from larva to nymph and from nymph to adult, in field conditions. However, there were no evidence of transovarial transmission. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Molecular detection of Hepatozoon canis in dogs from Kerala.

Science.gov (United States)

Lakshmanan, Bindu; Jose, K Jain; George, Arun; Usha, N P; Devada, K

2018-06-01

India has a wide range of agro-climatic zones which is highly conducive for a diverse range of vectors and canines are continuously exposed to the risk of spectrum of tick borne protozoan diseases. The brown dog tick, Rhipicephalus sanguineus is widely prevalent among dogs in Kerala and there is a high prevalence of this tick transmitted Babesia and Ehrlichia spp. infection. However, the incidence of Hepatozoon canis transmitted by the same tick species had not been reported in the state since 2004. Preliminary screening of client owned dogs revealed six dogs to be positive for typical gelatin capsule shaped gamonts of H. canis within neutrophils in blood smear by microscopic examination. A PCR assay was standardized to amplify a specific 737 bp fragment of 18S rRNA gene of H. canis. Phylogenetic analysis revealed closest relationship with West Indies isolate deposited at GenBank database. The present study records the molecular detection of this haemoparasite in the state, for the first time.
Sensitisation to aeroallergens among asthmatic and non-asthmatic adolescents living in a poor region in the Northeast of Brazil.

Science.gov (United States)

Sarinho, E C S; Mariano, J; Sarinho, S W; Medeiros, D; Rizzo, J A; Almerinda R, S; Solé, D

2009-01-01

To assess the kind and frequency of sensitisation to aeroallergens (skin prick test - SPT) of asthmatic and non-asthmatic adolescents (13-14 years old) living in the city of Caruaru, Northeast of Brazil, and to analyse their exposure to some environmental factors. A case-control study was conducted with asthmatic (50) and non-asthmatic (150) adolescents diagnosed by the International Study of Asthma and Allergies in Childhood (ISAAC) written questionnaire. All were submitted to SPT with aeroallergens (house dust mites, cat and dog epithelium, cockroaches, moulds and grass) and completed a questionnaire to evaluate their environmental exposure. There were no significant differences between groups regarding gender, age, number of siblings and environmental exposure. Asthmatic subjects exhibited a higher frequency of positive SPTs than non-asthmatic subjects (54.0% vs 33.3%, p=0.009) mainly due to Periplaneta americana (34.0% vs 12.7%, p=0.0007 respectively) and Canis familiaris (20.0% vs 8.7%, p=0.029). Although sensitisation to aeroallergens was high among non-asthmatic adolescents, asthma was associated with parental history of atopic disease and sensitisation to P. americana and Canis familiaris but not to D. pteronyssinus showing that local studies are mandatory for the tailoring of appropriate management of allergic diseases.
Trichoderma virens as a biocontrol of Toxocara canis: In vivo evaluation.

Science.gov (United States)

de Souza Maia Filho, Fernando; da Silva Fonseca, Anelise Oliveira; Persici, Beatriz Maroneze; de Souza Silveira, Julia; Braga, Caroline Quintana; Pötter, Luciana; de Avila Botton, Sônia; Brayer Pereira, Daniela Isabel

Microorganisms have been widely studied as biological control agents of parasites of medical and veterinary importance. Coprophagous arthropods, bacteria and fungi are among the different organisms evaluated as potential biological control agents. Nematophagous fungi capture and digest the free forms of nematodes in the soil. Due to its zoonotic potential, Toxocara canis have been brought to the attention of researchers. The aim of the present study was to determine whether the administration of embryonated T. canis eggs exposed to the nematophagous fungus Trichoderma virens reduces parasite infection in experimental animals. Embryonated T. canis eggs were exposed to T. virens mycelium for 15 days at 25°C. Subsequently, 100 fungus-exposed eggs were orally administered to 20 Swiss mice. As a positive control, another 20 mice received 100 embryonated eggs that were not exposed to the fungus. After 48h, the animals were killed, and heart, lungs and liver were harvested for the recovery of larvae. The organs of the animals that received embryonated T. canis eggs exposed to the fungus showed a lower mean larval recovery when compared with the animals that received embryonated eggs without fungus exposure (p<0.05). The exposure of T. canis eggs to T. virens reduces the experimental infection, demonstrating the potential of this nematophagous fungus as a biocontrol agent. Copyright © 2016 Asociación Española de Micología. Publicado por Elsevier España, S.L.U. All rights reserved.
Size‐assortative choice and mate availability influences hybridization between red wolves (Canis rufus) and coyotes (Canis latrans)

Science.gov (United States)

Hinton, Joseph W.; Gittleman, John L.; van Manen, Frank T.; Chamberlain, Michael J.

2018-01-01

Anthropogenic hybridization of historically isolated taxa has become a primary conservation challenge for many imperiled species. Indeed, hybridization between red wolves (Canis rufus) and coyotes (Canis latrans) poses a significant challenge to red wolf recovery. We considered seven hypotheses to assess factors influencing hybridization between red wolves and coyotes via pair‐bonding between the two species. Because long‐term monogamy and defense of all‐purpose territories are core characteristics of both species, mate choice has long‐term consequences. Therefore, red wolves may choose similar‐sized mates to acquire partners that behave similarly to themselves in the use of space and diet. We observed multiple factors influencing breeding pair formation by red wolves and found that most wolves paired with similar‐sized conspecifics and wolves that formed congeneric pairs with nonwolves (coyotes and hybrids) were mostly female wolves, the smaller of the two sexes. Additionally, we observed that lower red wolf abundance relative to nonwolves and the absence of helpers increased the probability that wolves consorted with nonwolves. However, successful pairings between red wolves and nonwolves were associated with wolves that maintained small home ranges. Behaviors associated with territoriality are energetically demanding and behaviors (e.g., aggressive interactions, foraging, and space use) involved in maintaining territories are influenced by body size. Consequently, we propose the hypothesis that size disparities between consorting red wolves and coyotes influence positive assortative mating and may represent a reproductive barrier between the two species. We offer that it may be possible to maintain wild populations of red wolves in the presence of coyotes if management strategies increase red wolf abundance on the landscape by mitigating key threats, such as human‐caused mortality and hybridization with coyotes. Increasing red wolf abundance would
Description of dogs naturally infected with Hepatozoon canis in the Aegean region of Turkey

OpenAIRE

PAŞA, Serdar; KIRAL, Funda; KARAGENÇ, Tülin; ATASOY, Abidin; SEYREK, Kamil

2009-01-01

Clinical and laboratory findings recorded in 10 dogs naturally infected with Hepatozoon canis in the Aegean region of Turkey were reported. The diagnosis was made by finding H. canis gamonts within leucocytes in Giemsa-stained blood smears. H. canis parasitaemia level was calculated manually by counting 500 neutrophils in blood smears. Parasitaemia varied from 1% to 23% of the circulating neutrophils. Anorexia, fever, depression, weight loss, and lymphadenopathy are the main clinical signs in...
Investigation of tick vectors of Hepatozoon canis in Brazil.

Science.gov (United States)

Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena

2013-12-01

Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil. Copyright © 2013 Elsevier GmbH. All rights

Trophic cascades linking wolves (Canis lupus), coyotes (Canis latrans), and small mammals

Science.gov (United States)

Miller, B.J.; Harlow, H.J.; Harlow, T.S.; Biggins, D.; Ripple, W.J.

2012-01-01

When large carnivores are extirpated from ecosystems that evolved with apex predators, these systems can change at the herbivore and plant trophic levels. Such changes across trophic levels are called cascading effects and they are very important to conservation. Studies on the effects of reintroduced wolves in Yellowstone National Park have examined the interaction pathway of wolves (Canis lupus L., 1758) to ungulates to plants. This study examines the interaction effects of wolves to coyotes to rodents (reversing mesopredator release in the absence of wolves). Coyotes (Canis latrans Say, 1823) generally avoided areas near a wolf den. However, when in the proximity of a den, they used woody habitats (pine or sage) compared with herbaceous habitats (grass or forb or sedge)- when they were away from the wolf den. Our data suggested a significant increase in rodent numbers, particularly voles (genus Microtus Schrank, 1798), during the 3-year study on plots that were within 3 km of the wolf den, but we did not detect a significant change in rodent numbers over time for more distant plots. Predation by coyotes may have depressed numbers of small mammals in areas away from the wolf den. These factors indicate a top-down effect by wolves on coyotes and subsequently on the rodents of the area. Restoration of wolves could be a powerful tool for regulating predation at lower trophic levels.
A paper radioimmunosorbent test (PRIST) for the detection of larva-specific antibodies to Toxocara canis in human sera

International Nuclear Information System (INIS)

Smith, H.V.; Quinn, R.; Bruce, R.G.; Girdwood, R.W.A.

1980-01-01

A paper radioimmunosorbent test (PRIST) was shown to be sensitive and reproducible when used with excretory/secretory antigen of Toxocara canis second stage larvae. Whatman No. 50 filter paper (5 mm discs) gave the most consistent and clear results with antigen at a concentration of 100 μg/ml, and could be stored for up to 3 weeks in vacuo at -70 0 C. Antigen coated discs were incubated with test sera at 1 : 10 dilution for 3 h at room temperature (21 0 C), reacted with [ 125 I]anti-human IgG for 1 h and counts determined in a gamma counter. Sera from patients with fascioliasis, taeniasis, schistosomiasis, oxyuriasis, trichinellosis and ancyclostomiasis gave counts similar to cord serum controls. Sera from patients with ascariasis gave counts of up to twice as great as controls, but sera from patients with toxicariasis produced counts of 7,000-13,000, a 4-6 fold increase. (Auth.)
Acquisition and transmission of Hepatozoon canis (Apicomplexa: Hepatozoidae) by the tick Amblyomma ovale (Acari: Ixodidae).

Science.gov (United States)

Rubini, A S; Paduan, K S; Martins, T F; Labruna, M B; O'Dwyer, L H

2009-10-14

The present study aimed to evaluate under controlled conditions the acquisition of Hepatozoon canis by Amblyomma ovale after feeding on infected dogs, and the subsequent induction of infection in uninfected dogs that ingested the experimentally infected ticks. Two H. canis naturally infected dogs were infested with A. ovale adult ticks derived from an uninfected laboratory tick colony. After feeding, two A. ovale females presented H. canis oocysts in the hemolymph at the first and fourth days after removal of ticks from dogs. The oocysts had an average size of 244.34 microm x 255.46 microm. Three uninfected dogs were fed with ticks previously fed on the infected dogs. Only one dog became infected 32 days after oral inoculation, presenting circulating gametocytes, parasitemia less than 1%, and positive PCR confirmed to be H. canis by DNA sequencing. The results obtained indicated A. ovale ticks as potential vector of H. canis in rural areas of Brazil.
Spatial distribution of Anaplasma phagocytophilum and Hepatozoon canis in red foxes (Vulpes vulpes) in Hungary.

Science.gov (United States)

Tolnai, Z; Sréter-Lancz, Z; Sréter, T

2015-07-01

In recent years, Ehrlichia canis and Hepatozoon canis transmitted by Rhipicephalus sanguineus were reported from Hungary. The aim of the present study was to reveal the spatial distribution pattern of pathogens transmitted by R. sanguineus in a sentinel species, red fox (Vulpes vulpes) in Hungary and to analyse the relationship of these patterns with landscape and climate by geographical information systems. Fox carcasses, representing 0.5% of the total fox population were randomly selected out of all the foxes of Hungary. The spleen samples of the animals were tested by real-time PCR for Anaplasma platys, Babesia vogeli, E. canis and H. canis infection. Positive results were confirmed by conventional PCR followed by sequencing. The prevalence of H. canis infection was 22.2% (95% CI=18.4-26.4%), and this parasite was detected in all areas including the mountain regions of Hungary. These findings indicate that other tick species or other transmission routes (oral and transplacental) might be in the background of the countrywide distribution of H. canis. Anaplasma platys was not found; nevertheless, the prevalence of Anaplasma phagocytophilum infection transmitted by Ixodes ricinus was 12.5% (95% CI=9.7-16.1%) in foxes. B. vogeli and E. canis infection was not detected. There was no correlation between environmental parameter values in the home range of foxes and A. phagocytophilum or H. canis infection, which is in line with that observed in the case of tick species infesting foxes in Hungary. The results of this study indicate that R. sanguineus, if present, might be rare in Hungary. Our baseline study can be used for future evaluation of the effect of climate change on the spreading and emergence of R. sanguineus transmitted pathogens in Hungary. Copyright © 2015 Elsevier GmbH. All rights reserved.
Molecular Survey of Hepatozoon canis in Red Foxes (Vulpes vulpes) from Romania.

Science.gov (United States)

Imre, Mirela; Dudu, Andreea; Ilie, Marius S; Morariu, Sorin; Imre, Kálmán; Dărăbuş, Gheorghe

2015-08-01

Blood samples of 119 red foxes, originating from 44 hunting grounds of 3 western counties (Arad, Hunedoara, and Timiş) of Romania, have been examined for the presence of Hepatozoon canis infection using the conventional polymerase chain reaction (PCR) of the fragment of 18S rRNA gene. Overall, 15 (12.6%) samples were found to be PCR-positive. Of the sampled hunting grounds, 29.5% (13/44) were found positive. Positive samples were recorded in all screened counties with the prevalence of 14.8% (9/61) in Arad, 9.8% (5/51) in Timiş, and 14.3% (1/7) in Hunedoara, respectively. No correlation was found (P > 0.05) between H. canis positivity and gender or territorial distribution of the infection. To confirm PCR results, 9 randomly selected amplicons were sequenced. The obtained sequences were identical to each other, confirmed the results of the conventional PCR, and showed 98-100% homology to other H. canis sequences. The results of the current survey support the role of red foxes as sylvatic reservoirs of H. canis in Romania.
Space Use and Habitat Selection by Resident and Transient Red Wolves (Canis rufus.

Directory of Open Access Journals (Sweden)

Joseph W Hinton

Full Text Available Recovery of large carnivores remains a challenge because complex spatial dynamics that facilitate population persistence are poorly understood. In particular, recovery of the critically endangered red wolf (Canis rufus has been challenging because of its vulnerability to extinction via human-caused mortality and hybridization with coyotes (Canis latrans. Therefore, understanding red wolf space use and habitat selection is important to assist recovery because key aspects of wolf ecology such as interspecific competition, foraging, and habitat selection are well-known to influence population dynamics and persistence. During 2009-2011, we used global positioning system (GPS radio-telemetry to quantify space use and 3rd-order habitat selection for resident and transient red wolves on the Albemarle Peninsula of eastern North Carolina. The Albemarle Peninsula was a predominantly agricultural landscape in which red wolves maintained spatially stable home ranges that varied between 25 km2 and 190 km2. Conversely, transient red wolves did not maintain home ranges and traversed areas between 122 km2 and 681 km2. Space use by transient red wolves was not spatially stable and exhibited shifting patterns until residency was achieved by individual wolves. Habitat selection was similar between resident and transient red wolves in which agricultural habitats were selected over forested habitats. However, transients showed stronger selection for edges and roads than resident red wolves. Behaviors of transient wolves are rarely reported in studies of space use and habitat selection because of technological limitations to observed extensive space use and because they do not contribute reproductively to populations. Transients in our study comprised displaced red wolves and younger dispersers that competed for limited space and mating opportunities. Therefore, our results suggest that transiency is likely an important life-history strategy for red wolves that
Space use and habitat selection by resident and transient red wolves (Canis rufus)

Science.gov (United States)

Hinton, Joseph W.; Proctor, Christine; Kelly, Marcella J.; van Manen, Frank T.; Vaughan, Michael R.; Chamberlain, Michael J.

2016-01-01

Recovery of large carnivores remains a challenge because complex spatial dynamics that facilitate population persistence are poorly understood. In particular, recovery of the critically endangered red wolf (Canis rufus) has been challenging because of its vulnerability to extinction via human-caused mortality and hybridization with coyotes (Canis latrans). Therefore, understanding red wolf space use and habitat selection is important to assist recovery because key aspects of wolf ecology such as interspecific competition, foraging, and habitat selection are well-known to influence population dynamics and persistence. During 2009–2011, we used global positioning system (GPS) radio-telemetry to quantify space use and 3rd-order habitat selection for resident and transient red wolves on the Albemarle Peninsula of eastern North Carolina. The Albemarle Peninsula was a predominantly agricultural landscape in which red wolves maintained spatially stable home ranges that varied between 25 km2 and 190 km2. Conversely, transient red wolves did not maintain home ranges and traversed areas between 122 km2 and 681 km2. Space use by transient red wolves was not spatially stable and exhibited shifting patterns until residency was achieved by individual wolves. Habitat selection was similar between resident and transient red wolves in which agricultural habitats were selected over forested habitats. However, transients showed stronger selection for edges and roads than resident red wolves. Behaviors of transient wolves are rarely reported in studies of space use and habitat selection because of technological limitations to observed extensive space use and because they do not contribute reproductively to populations. Transients in our study comprised displaced red wolves and younger dispersers that competed for limited space and mating opportunities. Therefore, our results suggest that transiency is likely an important life-history strategy for red wolves that facilitates
Oligotyping reveals differences between gut microbiomes of free-ranging sympatric Namibian carnivores (Acinonyx jubatus, Canis mesomelas) on a bacterial species-like level

Czech Academy of Sciences Publication Activity Database

Menke, S.; Wasimuddin, Wasimuddin; Meier, M.; Melzheimer, J.; Mfune, J. K. E.; Heinrich, S.; Thalwitzer, S.; Wachter, B.; Sommer, S.

2014-01-01

Roč. 5, č. 526 (2014), s. 526 ISSN 1664-302X R&D Projects: GA MŠk EE2.3.20.0303 Institutional support: RVO:68081766 Keywords : gut microbiome * bacteria * oligotyping * carnivores * cheetah (Acinonyx jubatus) * black-backed jackal (Canis mesomelas) * Namibia Subject RIV: EG - Zoology Impact factor: 3.989, year: 2014
Demodicosis caused by Demodex canis and Demodex cornei in dogs

OpenAIRE

Sivajothi, S.; Sudhakara Reddy, B.; Rayulu, V. C.

2013-01-01

Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears ...
Pathology of dogs in Campo Grande, MS, Brazil naturally co-infected with Leishmania infantum and Ehrlichia canis

Directory of Open Access Journals (Sweden)

Gisele Braziliano Andrade

2014-12-01

Full Text Available Different parasites that commonly occur concomitantly can influence one another, sometimes with unpredictable effects. We evaluated pathological aspects of dogs naturally co-infected with Leishmania infantum and Ehrlichia canis. The health status of the dogs was investigated based on histopathological, hematological and biochemical analyses of 21 animals infected solely with L. infantum and 22 dogs co- infected with L. infantum and E. canis. The skin of both groups showed chronic, predominantly lymphohistioplasmacytic inflammatory reaction. The plasmacytosis in the lymphoid tissues was likely related with the hypergammaglobulinemia detected in all the dogs. The disorganization of extracellular matrix found in the reticular dermis of the inguinal region and ear, characterized by the substitution of thick collagen fibers for thin fibers, was attributed to the degree of inflammatory reaction, irrespective of the presence of parasites. In addition, the histopathological analysis revealed that twice as many dogs in the co-infected group presented Leishmania amastigotes in the ear skin than those infected solely with Leishmania, increasing the possibility of becoming infected through sand fly vectors. Our findings highlight the fact that the health of dogs infected concomitantly with L. infantum and E. canis is severely compromised due to their high levels of total plasma protein, globulins, alkaline phosphatase and creatine kinase, and severe anemia.
Survey of Ehrlichia canis, Babesia spp. and Hepatozoon spp. in dogs from a semiarid region of Brazil

Directory of Open Access Journals (Sweden)

Tereza Emmanuelle de Farias Rotondano

Full Text Available This study assessed the occurrence of Ehrlichia spp., Babesia spp. and Hepatozoon spp. infections in 100 tick-harboring dogs from a semiarid region of the State of Paraíba, Northeastern Brazil. Blood samples and ticks were collected from the animals, and a questionnaire was submitted to dog owners to obtain general data. Blood samples were used to perform hemogram, direct blood smear and immunological and molecular hemoparasite detection. The 1,151 ticks collected were identified as Rhipicephalus sanguineus; direct smears revealed E. canis-like morulae in the monocytes of 4% (4/100 of the non-vaccinated female dogs, and 34% and 25% of the dogs tested positive for Ehrlichia canis by indirect immunofluorescence assay (IFA and polymerase chain reaction (PCR, respectively. Blood smear examination revealed Babesia-suggestive merozoites in the erythrocytes of 2% (2/100 of the animals. Babesia vogeli was detected by PCR in ten animals (10% and was correlated with young age (p = 0.007 and thrombocytopenia (p = 0.01. None of the animals showed Hepatozoon spp. positivity. These results indicate that E. canis is the main tick-borne canine pathogen in the study area and provide the first report of B. vogeli infection in dogs from Paraiba State.
Survey of Ehrlichia canis, Babesia spp. and Hepatozoon spp. in dogs from a semiarid region of Brazil.

Science.gov (United States)

Rotondano, Tereza Emmanuelle de Farias; Almeida, Herta Karyanne Araújo; Krawczak, Felipe da Silva; Santana, Vanessa Lira; Vidal, Ivana Fernandes; Labruna, Marcelo Bahia; de Azevedo, Sérgio Santos; Ade lmeida, Alzira Maria Paiva; de Melo, Marcia Almeida

2015-01-01

This study assessed the occurrence of Ehrlichia spp., Babesia spp. and Hepatozoon spp. infections in 100 tick-harboring dogs from a semiarid region of the State of Paraíba, Northeastern Brazil. Blood samples and ticks were collected from the animals, and a questionnaire was submitted to dog owners to obtain general data. Blood samples were used to perform hemogram, direct blood smear and immunological and molecular hemoparasite detection. The 1,151 ticks collected were identified as Rhipicephalus sanguineus; direct smears revealed E. canis-like morulae in the monocytes of 4% (4/100) of the non-vaccinated female dogs, and 34% and 25% of the dogs tested positive for Ehrlichia canis by indirect immunofluorescence assay (IFA) and polymerase chain reaction (PCR), respectively. Blood smear examination revealed Babesia-suggestive merozoites in the erythrocytes of 2% (2/100) of the animals. Babesia vogeli was detected by PCR in ten animals (10%) and was correlated with young age (p = 0.007) and thrombocytopenia (p = 0.01). None of the animals showed Hepatozoon spp. positivity. These results indicate that E. canis is the main tick-borne canine pathogen in the study area and provide the first report of B. vogeli infection in dogs from Paraiba State.
Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

Directory of Open Access Journals (Sweden)

Manuel Graziani

2014-03-01

Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.
First evidence of Anaplasma platys and Hepatozoon canis co-infection in a dog from Romania--a case report.

Science.gov (United States)

Andersson, Martin; Turcitu, Mihai A; Stefanache, Mircea; Tamba, Paula; Barbuceanu, Florica; Chitimia, Lidia

2013-06-01

Anaplasma platys was first identified and described in North America as a Rickettsia-like, platelet-specific organism in dogs with infectious canine cyclic thrombocytopenia. In Europe, A. platys has so far mainly been described for some Mediterranean countries. Here, we describe a case of A. platys infection in a dog from Romania, confirmed by PCR. Additionally, the dog had a co-infection with Hepatozoon canis. To the best of our knowledge, this is the first case of A. platys infection in Romania and the first case of a co-infection with A. platys and H. canis altogether. Both pathogens should be considered as possible disease agents in dogs suffering from disease associated with tick bite in south-eastern Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.
First isolation and molecular characterization of Ehrlichia canis in Costa Rica, Central America.

Science.gov (United States)

Romero, L E; Meneses, A I; Salazar, L; Jiménez, M; Romero, J J; Aguiar, D M; Labruna, M B; Dolz, G

2011-08-01

The present study investigated Ehrlichia species in blood samples from dogs suspected of clinical ehrlichiosis, using molecular and isolation techniques in cell culture. From a total of 310 canine blood samples analyzed by 16S rRNA nested PCR, 148 (47.7%) were positive for Ehrlichia canis. DNA from Ehrlichia chaffeensis or Ehrlichia ewingii was not detected in any sample using species-specific primers in separated reactions. Leukocytes from five PCR-positive dogs were inoculated into DH82 cells; successful isolation of E. canis was obtained in four samples. Partial sequence of the dsb gene of eight canine blood samples (including the five samples for in vitro isolation) was obtained by PCR and their analyses through BLAST showed 100% of identity with the corresponding sequence of E. canis in GenBank. This study represents the first molecular diagnosis, isolation, and molecular characterization of E. canis in dogs from Costa Rica. Copyright © 2010 Elsevier Ltd. All rights reserved.
Hepatozoon canis (James, 1905 in dogs from Uberlândia, Minas Gerais. Reports of two cases.

Directory of Open Access Journals (Sweden)

Antonio Vicente Mundim

1992-12-01

Full Text Available Hepatozoon canis gametocytes, measuring 9,56 µm x 5,60 µm were identified in circulating leukocytes of two dogs admitted to the Veterinary Hospital of the Universidade Federal de Uberlândia. Morulae of Ehrlichia canis were also found in circulating monocytes. The authors report the first occurrence of H. canis in Uberlândia, Minas Gerais state.
Large dust grains in the wind of VY Canis Majoris

Science.gov (United States)

Scicluna, P.; Siebenmorgen, R.; Wesson, R.; Blommaert, J. A. D. L.; Kasper, M.; Voshchinnikov, N. V.; Wolf, S.

2015-12-01

Massive stars live short lives, losing large amounts of mass through their stellar wind. Their mass is a key factor determining how and when they explode as supernovae, enriching the interstellar medium with heavy elements and dust. During the red supergiant phase, mass-loss rates increase prodigiously, but the driving mechanism has proven elusive. Here we present high-contrast optical polarimetric-imaging observations of the extreme red supergiant VY Canis Majoris and its clumpy, dusty, mass-loss envelope, using the new extreme-adaptive-optics instrument SPHERE at the VLT. These observations allow us to make the first direct and unambiguous detection of submicron dust grains in the ejecta; we derive an average grain radius ~0.5 μm, 50 times larger than in the diffuse ISM, large enough to receive significant radiation pressure by photon scattering. We find evidence for varying grain sizes throughout the ejecta, highlighting the dynamical nature of the envelope. Grains with 0.5 μm sizes are likely to reach a safe distance from the eventual explosion of VY Canis Majoris; hence it may inject upwards of 10-2 M⊙ of dust into the ISM. Based on observations made with European Southern Observatory (ESO) telescopes at the La Silla Paranal Observatory under program 60.A-9368(A).Appendix A is available in electronic form at http://www.aanda.org
Recurrent patent infections with Toxocara canis in household dogs older than six months

NARCIS (Netherlands)

Nijsse, Rolf; Mughini-Gras, Lapo; Wagenaar, Jaap A.; Ploeger, Harm W.

2016-01-01

Background: To reduce environmental contamination with Toxocara canis eggs, the current general advice is to deworm all dogs older than six months on average four times a year. However, only a small proportion of non-juvenile household dogs actually shed T. canis eggs, and some dogs shed eggs
An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris) in a Food Choice Task.

Science.gov (United States)

Abdai, Judit; Gergely, Anna; Petró, Eszter; Topál, József; Miklósi, Ádám

2015-01-01

The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO) can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1) Helper UMO and (2) Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3) Non-helper UMO and (4) Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.
An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris in a Food Choice Task.

Directory of Open Access Journals (Sweden)

Judit Abdai

Full Text Available The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1 Helper UMO and (2 Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3 Non-helper UMO and (4 Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

Energy Technology Data Exchange (ETDEWEB)

Ramadinha, L S

1988-12-31

The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.
Barking and mobbing.

Science.gov (United States)

Lord, Kathryn; Feinstein, Mark; Coppinger, Raymond

2009-07-01

Barking is most often associated with the domestic dog Canis familiaris, but it is a common mammalian and avian vocalization. Like any vocalization, the acoustic character of the bark is likely to be a product of adaptation as well as an expression of the signaler's internal motivational state. While most authors recognize that the bark is a distinct signal type, no consistent description of its acoustic definition or function is apparent. The bark exhibits considerable variability in its acoustic form and occurs in a wide range of behavioral contexts, particularly in dogs. This has led some authors to suggest that dog barking might be a form of referential signaling, or an adaptation for heightened capability to communicate with humans. In this paper we propose a general 'canonical' acoustic description of the bark. Surveying relevant literature on dogs, wild canids, other mammals and birds, we explore an alternative functional hypothesis, first suggested by [Morton, E.S., 1977. On the occurrence and significance of motivation-structural rules in some bird and mammal sounds. Am. Nat. 111, 855-869] and consistent with his motivational-structural rules theory: that barking in many animals, including the domestic dog, is associated with mobbing behavior and the motivational states that accompany mobbing.
Sarcoptic-mange detector dogs used to identify infected animals during outbreaks in wildlife

OpenAIRE

Alasaad, Samer; Permunian, Roberto; Gakuya, Francis; Mutinda, Matthew N.; Soriguer, Ramón C.; Rossi, Luca

2012-01-01

Abstract Background One of the main aims of forensic investigation is the detection and location of people and substances of interest, such as missing people and illegal drugs. Dogs (Canis lupus var. familiaris) have had an important role in legal and forensic investigations for decades; nonetheless canines’ keen sense of smell has never been utilized in either the surveillance or control of wildlife diseases. The rapid removal and treatment of infected carcasses and/or sick animals is a key ...
Molecular characterization of Hepatozoon canis in dogs from Colombia.

Science.gov (United States)

Vargas-Hernandez, Giovanni; André, Marcos R; Munhoz, Thiago D; Faria, Joice M L; Machado, Rosangela Z; Tinucci-Costa, Mirela

2012-01-01

Hepatozoonosis is a tick-borne disease whose transmission to dogs occurs by ingestion of oocysts infected ticks or feeding on preys infested by infected ticks. Until now, there is no previous report of molecular characterization of Hepatozoon sp. in dogs from Colombia. EDTA blood samples were collected from 91 dogs from central-western region of Colombia (Bogotá, Bucaramanga, and Villavicencio cities) and submitted to 18S rRNA Hepatozoon sp. PCR and blood smears confection. Phylogenetic analysis was used to access the identity of Hepatozoon species found in sampled dogs. From 91 sampled dogs, 29 (31.8%) were positive to Hepatozoon sp. (25 dogs were only positive in PCR, 1 was positive only in blood smears, and 3 were positive in both blood smears and PCR). After sequencing, the found Hepatozoon sp. DNA showed 100% of identity with Hepatozoon canis DNA isolates. The phylogenetic tree supported the identity of the found Hepatozoon sp. DNA, showing that the isolates from Colombia were placed in the same clade than other H. canis isolates from Venezuela, Spain, and Taiwan. This is the first molecular detection of H. canis in dogs from Colombia.
Genetic and Antigenic Evidence Supports the Separation of Hepatozoon canis and Hepatozoon americanum at the Species Level

OpenAIRE

Baneth, Gad; Barta, John R.; Shkap, Varda; Martin, Donald S.; Macintire, Douglass K.; Vincent-Johnson, Nancy

2000-01-01

Recognition of Hepatozoon canis and Hepatozoon americanum as distinct species was supported by the results of Western immunoblotting of canine anti-H. canis and anti-H. americanum sera against H. canis gamonts. Sequence analysis of 368 bases near the 3′ end of the 18S rRNA gene from each species revealed a pairwise difference of 13.59%.
The in vitro effect of prolactin on the growth, motility and expression of prolactin receptors in larvae of Toxocara canis.

Science.gov (United States)

Chávez-Güitrón, L E; Morales-Montor, J; Muñoz-Guzmán, M A; Nava-Castro, K E; Ramírez-Álvarez, H; Moreno-Méndoza, N A; Hernández-Cervantes, R; Alba-Hurtado, F

2016-07-15

The in vitro effect of prolactin (PRL) on the growth and motility of Toxocara canis larvae was assessed. Additionally, the expression and location of prolactin receptors (PRL-Rs) were determined in the larvae. Larvae of T. canis were incubated with different concentrations of PRL for different periods of time. The stimulated larvae accelerated their enlargement and increased their motility. The mean percentage of PRL-R+ cells in non-stimulated larvae, measured by flow cytometry was 7.3±0.3%. Compared with non-stimulated larvae, the mean fluorescence intensity (pPCR. The sequence of this fragment showed 99% similarity with the gene fragment that codes for the PRL-R of the domestic dog. A high concentration of PRL-Rs was immune-located in the posterior region of the larval intestine; therefore, the intestinal cells in this region were most likely the targets for this hormone. Based on these results, PRL-Rs were identified in T. canis larvae, and the in vitro stimulation with PRL increased the number of these receptors, accelerated the growth and modified the activity of larvae. All of the above suggest that T. canis larvae are evolutionarily adapted to recognize the PRL of their definitive host and furthermore might explain the reactivation of tissue-arrested larvae during the gestation of bitches, which does not occur in gestating females of other species. Copyright © 2016 Elsevier B.V. All rights reserved.
The dog mite, Demodex canis: prevalence, fungal co-infection, reactions to light, and hair follicle apoptosis.

Science.gov (United States)

Tsai, Yu-Jen; Chung, Wen-Cheng; Wang, Lian-Chen; Ju, Yu-Ten; Hong, Chin-Lin; Tsai, Yu-Yang; Li, Yi-Hung; Wu, Ying-Ling

2011-01-01

Infection rate, reaction to light, and hair follicle apoptosis are examined in the dogmite, Demodex canis Leydig (Prostigmata: Demodicidae), in dogs from the northern area of Taiwan. An analysis of relevant samples revealed 7.2% (73/1013) prevalence of D. canis infection. Infection during the investigation peaked each winter, with an average prevalence of 12.5% (32/255). The infection rates significantly varied in accordance with month, sex, age, and breed (p canis Bodin (Onygenales: Arthrodermataceae) and Trichophyton mentagrophyte Robin (Blanchard) on the D. canis infected dogs revealed prevalence rates of 4.4% (2/45) and 2.2% (1/45), respectively. Observations demonstrated that D. canis slowly moved from a light area to a dark area. Skin samples were examined for cellular apoptosis by activated caspase3 immunohistochemical staining. Cells that surrounded the infected hair follicles were activated caspase3-positive, revealing cell apoptosis in infected follicles via the activation of caspase3.
Urinary creatinine to serum creatinine ratio and renal failure index in dogs infected with Babesia canis.

Science.gov (United States)

Zygner, Wojciech; Gójska-Zygner, Olga; Wesołowska, Agnieszka; Wędrychowicz, Halina

2013-09-01

Urinary creatinine to serum creatinine (UCr/SCr) ratio and renal failure index (RFI) are useful indices of renal damage. Both UCr/SCr ratio and RFI are used in differentiation between prerenal azotaemia and acute tubular necrosis. In this work the authors calculated the UCr/SCr ratio and RFI in dogs infected with Babesia canis and the values of these indices in azotaemic dogs infected with the parasite. The results of this study showed significantly lower UCr/SCr ratio in dogs infected with B. canis than in healthy dogs. Moreover, in azotaemic dogs infected with B. canis the UCr/SCr ratio was significantly lower and the RFI was significantly higher than in non-azotaemic dogs infected with B. canis. The calculated correlation between RFI and duration of the disease before diagnosis and treatment was high, positive and statistically significant (r = 0.89, p caused by B. canis in Poland acute tubular necrosis may develop.
We Detected Phenomena, Like Africa's Dogon, that Speak of Stellar Gravitational Neutrino Interactions

Science.gov (United States)

McLeod, David Matthew; McLeod, Roger David

2009-05-01

Stick figure equivalents of Kokopelli/Pele/Pamola/Thor/Orion/Osiris, Canis Major/Anubis/Wolf/Fox, Leo/Bird Tailed Jaguar/Beaver Tailed Mountain Lion, were detected by us. They figure heavily in the spiritual/scientific world view of many traditional societies, and their cultural respect for the information such figures convey. Scientific instruments from the past were our laboratories, and theirs. All string/stick figure equivalents may represent types of longitudinally aligned neutrino flux between certain stellar pairs. Neutrino beams from distant pulsars, quasars, or other neutrino sources, cannot penetrate these graviton-like strings. They do pass through sectors of Earth, projecting stick figures within instruments like the Watch House at America's Stonehenge, and perhaps the chamber beneath the Great Pyramid. Sirius B, as the heaviest object in ``our'' universe for the Dogon, means it shares a profound graviton-like neutrino highway to our sun, as Sirius B/A do within Canis Major. It is possibly projected by a source within the Canis Major dwarf galaxy at about 3,000 times as distant as Sirius B/A at 8.7 ly.
Molecular characterization and transcriptional analysis of the female-enriched chondroitin proteoglycan 2 of Toxocara canis.

Science.gov (United States)

Ma, G X; Zhou, R Q; Hu, L; Luo, Y L; Luo, Y F; Zhu, H H

2018-03-01

Toxocara canis is an important but neglected zoonotic parasite, and is the causative agent of human toxocariasis. Chondroitin proteoglycans are biological macromolecules, widely distributed in extracellular matrices, with a great diversity of functions in mammals. However, there is limited information regarding chondroitin proteoglycans in nematode parasites. In the present study, a female-enriched chondroitin proteoglycan 2 gene of T. canis (Tc-cpg-2) was cloned and characterized. Quantitative real-time polymerase chain reaction (qRT-PCR) was employed to measure the transcription levels of Tc-cpg-2 among tissues of male and female adult worms. A 485-amino-acid (aa) polypeptide was predicted from a continuous 1458-nuleotide open reading frame and designated as TcCPG2, which contains a 21-aa signal peptide. Conserved domain searching indicated three chitin-binding peritrophin-A (CBM_14) domains in the amino acid sequence of TcCPG2. Multiple alignment with the inferred amino acid sequences of Caenorhabditis elegans and Ascaris suum showed that CBM_14 domains were well conserved among these species. Phylogenetic analysis suggested that TcCPG2 was closely related to the sequence of chondroitin proteoglycan 2 of A. suum. Interestingly, a high level of Tc-cpg-2 was detected in female germline tissues, particularly in the oviduct, suggesting potential roles of this gene in reproduction (e.g. oogenesis and embryogenesis) of adult T. canis. The functional roles of Tc-cpg-2 in reproduction and development in this parasite and related parasitic nematodes warrant further functional studies.
76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus...

Science.gov (United States)

2011-12-28

... Wolf (Canis lupus) in the Western Great Lakes; Final rule #0;#0;Federal Register / Vol. 76, No. 249... (Canis lupus) in the Western Great Lakes AGENCY: Fish and Wildlife Service, Interior. ACTION: Final rule... Minnesota population of gray wolves (Canis lupus) to conform to current statutory and policy requirements...
Serological survey of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Ehrlichia canis infections in rural and urban dogs in Central Italy

Directory of Open Access Journals (Sweden)

Valentina Virginia Ebani

2014-11-01

Full Text Available [b]Introduction[i][/i][/b][i]. Borrelia burgdorferi [/i]sensu lato (s.l. and Anaplasma phagocytophilum are well known zoonotic pathogens, whereas[i] Ehrlichia canis[/i] is usually considered to be of veterinary concern, although on the basis of recent reports it also seems to be able to infect humans. [b]objective[/b]. The aim of the study was to determine the seroprevalence of [i]B. burgdorferi [/i]s.l., A. phagocytophilum and [i]E. canis[/i] in an Italian canine population, and to verify if there are differences between dogs living in urban areas and those from a rural environment. [b]materials and method.[/b] Blood sera of 1,965 dogs, 1,235 from cities and 730 from rural areas, were tested by indirect immunofluorescent assay (IFAT. [b]results[/b]. The overall seroprevalence was highest for E. canis (7.07%, followed by [i]A. phagocytophilum[/i] (4.68%, and [i]B. burgdorferi[/i] s.l. (1.47%. Rural dogs showed the highest seroprevalence to [i]B. burgdorferi[/i] s.l. and [i]A. phagocytophilum[/i]. No significant differences were observed between rural and urban [i]E. canis[/i]-positive dogs. A low percentage (1.32% of dogs with dual seropositivity was detected, and no triple positive reactions were observed. No significant differences were detected in the seroprevalence of the three agents in relationship to the age and gender of the dogs. Seroprevalence in the five years considered were not statistically different, except for the lowest rate for [i]E. canis[/i] observed in 2012. [b]conclusions[/b]. The results confirm the presence of [i]B. burgdorferi[/i] s.l., [i]A. phagocytophilum[/i] and [i]E. canis[/i] in Italian dogs in both urban and rural areas. Monitoring pet dogs, which share the same environment with their owners, is useful for identifying the presence of tick-borne disease agents of both veterinary and public health significance
The genome of obligately intracellular Ehrlichia canis revealsthemes of complex membrane structure and immune evasion strategies

Energy Technology Data Exchange (ETDEWEB)

Mavromatis, K.; Kuyler Doyle, C.; Lykidis, A.; Ivanova, N.; Francino, P.; Chain, P.; Shin, M.; Malfatti, S.; Larimer, F.; Copeland,A.; Detter, J.C.; Land, M.; Richardson, P.M.; Yu, X.J.; Walker, D.H.; McBride, J.W.; Kyrpides, N.C.

2005-09-01

Ehrlichia canis, a small obligately intracellular, tick-transmitted, gram-negative, a-proteobacterium is the primary etiologic agent of globally distributed canine monocytic ehrlichiosis. Complete genome sequencing revealed that the E. canis genome consists of a single circular chromosome of 1,315,030 bp predicted to encode 925 proteins, 40 stable RNA species, and 17 putative pseudogenes, and a substantial proportion of non-coding sequence (27 percent). Interesting genome features include a large set of proteins with transmembrane helices and/or signal sequences, and a unique serine-threonine bias associated with the potential for O-glycosylation that was prominent in proteins associated with pathogen-host interactions. Furthermore, two paralogous protein families associated with immune evasion were identified, one of which contains poly G:C tracts, suggesting that they may play a role in phase variation and facilitation of persistent infections. Proteins associated with pathogen-host interactions were identified including a small group of proteins (12) with tandem repeats and another with eukaryotic-like ankyrin domains (7).
Molecular Detection and Prevalence of Hepatozoon canis in Dogs from Punjab (Pakistan) and Hematological Profile of Infected Dogs.

Science.gov (United States)

Qamar, Muhammad; Malik, Muhammad Irfan; Latif, Muhammad; Ain, Qurat Ul; Aktas, Munir; Shaikh, Rehan Sadiq; Iqbal, Furhan

2017-03-01

The intraleukocytic parasite, Hepatozoon canis, causes the sometimes fatal tick borne disease canine hepatozoonosis. In this study, dogs from Islamabad, Lahore, and Multan Districts of the Punjab region of Pakistan were surveyed to investigate the presence and prevalence of H. canis infection and to determine the effects of the parasite on hematological parameters. Blood samples were collected from 151 domestic dogs (149 pet, 2 stray) of both sexes and varying ages. Data on sex, age, tick infestation, and clinical factors (body temperature, mucous membrane status, and presence of hematuria and vomiting) were collected. Using PCR, 18 dogs (11.9%) were found positive for the presence of H. canis DNA. Partial sequences of the 18S rRNA gene shared 99-100% similarity with the corresponding H. canis isolates. This epidemiological survey revealed higher prevalence of H. canis in Islamabad (11/49, 22.4%) compared to Lahore (3/52, 5.8%) and Multan (4/50, 8%) in Pakistan. No investigated epidemiological or clinical factors were found to be associated with the presence of H. canis (p > 0.05) in dogs. H. canis positive dogs exhibited higher minimum inhibitory dilution (p = 0.04), mixed inclusion (p = 0.008) and relative distribution width of red blood cells (p = 0.02), and lower hematocrit (p = 0.03) and mean hemoglobin content (p = 0.03) than did dogs in which H. canis was not detected. We are recommending this PCR-based protocol to the veterinary practitioners for the detection and/or confirmation of H. canis in dogs suspected for hepatozoonosis to improve their health status.
Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

Directory of Open Access Journals (Sweden)

Valéria Dutra

2012-06-01

Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.
Genetic and Antigenic Evidence Supports the Separation of Hepatozoon canis and Hepatozoon americanum at the Species Level

Science.gov (United States)

Baneth, Gad; Barta, John R.; Shkap, Varda; Martin, Donald S.; Macintire, Douglass K.; Vincent-Johnson, Nancy

2000-01-01

Recognition of Hepatozoon canis and Hepatozoon americanum as distinct species was supported by the results of Western immunoblotting of canine anti-H. canis and anti-H. americanum sera against H. canis gamonts. Sequence analysis of 368 bases near the 3′ end of the 18S rRNA gene from each species revealed a pairwise difference of 13.59%. PMID:10699047
Efficacy of Zingiber officinale ethanol extract on the viability, embryogenesis and infectivity of Toxocara canis eggs.

Science.gov (United States)

El-Sayed, Nagwa Mostafa

2017-12-01

This study evaluated the effect of Zingiber officinal e ( Z. officinal e) ethanol extract on the viability, embryogenesis and infectivity Toxocara canis ( T. canis ) eggs. It was carried out both in vitro and in vivo. In the in vitro experiment, unembryonated T. canis eggs were incubated with 25, 50 and 100 mg/mL Z. officinal e extract at 25 °C for 6, 12, and 24 h to assess the effect of Z. officinal e on their viability and for two weeks to assess the effect of Z. officinal e on their embryogenesis. In vivo experiment was performed to assess the effect of Z. officinal e on infectivity of T. canis eggs. Treated embryonated eggs by Z. officinale extract at concentrations of 25, 50 and 100 mg/mL for 24 h were inoculated into mice and their livers were examined for the presence of T. canis larvae on the 7th day after infection and for histopathological evaluation at 14th day post-infection. Z. officinal e showed a significant ovicidal activity on T. canis eggs. The best effect was observed with 100 mg/mL concentration after 24 h with an efficacy of 98.2%. However, the treated eggs by 25, 50 mg/mL of Z. officinale extract after 24 h showed ovicidal activity by 59.22 and 82.5% respectively. Moreover, this extract effectively inhibited T. canis eggs embryogenesis by 99.64% and caused their degeneration at the concentration of 100 mg/mL after 2 weeks of treatment. However, the lower concentrations, 25 and 50 mg/mL inhibited embryogenesis by 51.19 and 78.57% respectively. The effect of Z. officinal e on the infectivity T. canis eggs was proven by the reduction of larvae recovery in the livers by 35.9, 62.8 and 89.5% in mice groups inoculated by Z. officinale treated eggs at concentrations of 25, 50 and 100 mg/mL respectively. Histopathologically, the liver tissues of mice infected with Z. officinale treated eggs at the concentration of 100 mg/mL appeared healthy with slight degenerative changes of hepatocytes, opposite to that recorded in the infected mice
Didelphis albiventris naturally infected with Hepatozoon canis in southeastern Brazil.

Science.gov (United States)

da Silva, Maria Regina Lucas; Fornazari, Felipe; Demoner, Larissa de Castro; Teixeira, Carlos Roberto; Langoni, Helio; O'Dwyer, Lucia Helena

2017-10-01

Hepatozoon species are vector-borne pathogens that infect domestic and wild animals. Marsupials of the species Didelphis albiventris are adapted to urban and peri-urban areas and act as reservoir hosts for several parasites. The present study evaluated the occurrence of infection by Hepatozoon species in synantropic D. albiventris from Botucatu, São Paulo, Brazil. Blood samples and ectoparasites from 19 D. albiventris were collected from urban and peri-urban areas. Hepatozoon spp. detection was performed by microscopy and molecular analysis. One opossum was positive for Hepatozoon spp. in microscopy analysis and PCR, while another animal was positive only in PCR. The obtained sequences were 100% identical to Hepatozoon canis. Six species of ticks and two species of fleas were detected on D. albiventris. This is the first report of H. canis in synantropic D. albiventris. In Brazil, H. canis transmission among dog populations is not well established, which highlights the importance of investigating the role that opossums might play in the epidemiology of this protozoan. Copyright © 2017 Elsevier GmbH. All rights reserved.
Minipig and beagle animal model genomes aid species selection in pharmaceutical discovery and development

Energy Technology Data Exchange (ETDEWEB)

Vamathevan, Jessica J., E-mail: jessica.j.vamathevan@gsk.com [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom); Hall, Matthew D.; Hasan, Samiul; Woollard, Peter M. [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom); Xu, Meng; Yang, Yulan; Li, Xin; Wang, Xiaoli [BGI-Shenzen, Shenzhen (China); Kenny, Steve [Safety Assessment, PTS, GlaxoSmithKline, Ware (United Kingdom); Brown, James R. [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Collegeville, PA (United States); Huxley-Jones, Julie [UK Platform Technology Sciences (PTS) Operations and Planning, PTS, GlaxoSmithKline, Stevenage (United Kingdom); Lyon, Jon; Haselden, John [Safety Assessment, PTS, GlaxoSmithKline, Ware (United Kingdom); Min, Jiumeng [BGI-Shenzen, Shenzhen (China); Sanseau, Philippe [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom)

2013-07-15

Improving drug attrition remains a challenge in pharmaceutical discovery and development. A major cause of early attrition is the demonstration of safety signals which can negate any therapeutic index previously established. Safety attrition needs to be put in context of clinical translation (i.e. human relevance) and is negatively impacted by differences between animal models and human. In order to minimize such an impact, an earlier assessment of pharmacological target homology across animal model species will enhance understanding of the context of animal safety signals and aid species selection during later regulatory toxicology studies. Here we sequenced the genomes of the Sus scrofa Göttingen minipig and the Canis familiaris beagle, two widely used animal species in regulatory safety studies. Comparative analyses of these new genomes with other key model organisms, namely mouse, rat, cynomolgus macaque, rhesus macaque, two related breeds (S. scrofa Duroc and C. familiaris boxer) and human reveal considerable variation in gene content. Key genes in toxicology and metabolism studies, such as the UGT2 family, CYP2D6, and SLCO1A2, displayed unique duplication patterns. Comparisons of 317 known human drug targets revealed surprising variation such as species-specific positive selection, duplication and higher occurrences of pseudogenized targets in beagle (41 genes) relative to minipig (19 genes). These data will facilitate the more effective use of animals in biomedical research. - Highlights: • Genomes of the minipig and beagle dog, two species used in pharmaceutical studies. • First systematic comparative genome analysis of human and six experimental animals. • Key drug toxicology genes display unique duplication patterns across species. • Comparison of 317 drug targets show species-specific evolutionary patterns.
Minipig and beagle animal model genomes aid species selection in pharmaceutical discovery and development

International Nuclear Information System (INIS)

Vamathevan, Jessica J.; Hall, Matthew D.; Hasan, Samiul; Woollard, Peter M.; Xu, Meng; Yang, Yulan; Li, Xin; Wang, Xiaoli; Kenny, Steve; Brown, James R.; Huxley-Jones, Julie; Lyon, Jon; Haselden, John; Min, Jiumeng; Sanseau, Philippe

2013-01-01

Improving drug attrition remains a challenge in pharmaceutical discovery and development. A major cause of early attrition is the demonstration of safety signals which can negate any therapeutic index previously established. Safety attrition needs to be put in context of clinical translation (i.e. human relevance) and is negatively impacted by differences between animal models and human. In order to minimize such an impact, an earlier assessment of pharmacological target homology across animal model species will enhance understanding of the context of animal safety signals and aid species selection during later regulatory toxicology studies. Here we sequenced the genomes of the Sus scrofa Göttingen minipig and the Canis familiaris beagle, two widely used animal species in regulatory safety studies. Comparative analyses of these new genomes with other key model organisms, namely mouse, rat, cynomolgus macaque, rhesus macaque, two related breeds (S. scrofa Duroc and C. familiaris boxer) and human reveal considerable variation in gene content. Key genes in toxicology and metabolism studies, such as the UGT2 family, CYP2D6, and SLCO1A2, displayed unique duplication patterns. Comparisons of 317 known human drug targets revealed surprising variation such as species-specific positive selection, duplication and higher occurrences of pseudogenized targets in beagle (41 genes) relative to minipig (19 genes). These data will facilitate the more effective use of animals in biomedical research. - Highlights: • Genomes of the minipig and beagle dog, two species used in pharmaceutical studies. • First systematic comparative genome analysis of human and six experimental animals. • Key drug toxicology genes display unique duplication patterns across species. • Comparison of 317 drug targets show species-specific evolutionary patterns

Molecular detection of Dirofilaria immitis, Hepatozoon canis, Babesia spp., Anaplasma platys and Ehrlichia canis in dogs on Costa Rica.

Science.gov (United States)

Wei, Lanjing; Kelly, Patrick; Ackerson, Kate; El-Mahallawy, Heba S; Kaltenboeck, Bernhard; Wang, Chengming

2014-03-01

Although vector-borne diseases are important causes of morbidity and mortality in dogs in tropical areas, there is little information on these conditions in Costa Rica. In PCRs of blood from dogs in Costa Rica, we did not detect DNAs of Rickettsia (R.) felis and Coxiella (C.) burnetii but we did find evidence of infection with Dirofilaria (D.) immitis (9/40, 22.5%), Hepatozoon (H.) canis (15/40, 37.5%), Babesia spp. (10/40, 25%; 2 with B. gibsoni and 8 with B. vogeli), Anaplasma (A.) platys (3/40, 7.5%) and Ehrlichia (E.) canis (20/40, 50%). Nine dogs (22.5%) were free of any vector-borne pathogens while 14 (35%) were infected with a single pathogen, 11 (27.5%) with two, 4 (10%) with three, 1 (2.5%) with four, and 1 (2.5%) with five pathogens. Dogs in Costa Rica are commonly infected with vector-borne agents.
ANTIFUNGAL ACTIVITY OF Cymbopogon nardus (L. Rendle (CITRONELLA AGAINST Microsporum canis FROM ANIMALS AND HOME ENVIRONMENT

Directory of Open Access Journals (Sweden)

Isis Regina Grenier CAPOCI

2015-12-01

Full Text Available Dermatophytosis is a common zoonosis in urban centers. Dogs and cats have played an important role as its disseminators. Environmental decontamination is essential for the prevention of its propagation to humans and animals. However, sanitizers or disinfectants with antifungal activity, currently available, have high toxicity. The present study evaluated the in vitro effects of an extract of citronella (Cymbopogon nardus on 31 Microsporum canis isolates from animals and home environments. Susceptibility tests were performed based on document M38-A2 (2008 of the Clinical and Laboratory Standards Institute with modifications for natural products. Although susceptibility variation was observed between the fungus tested, the concentrations that inhibited the growth of 50 and 90% of the microorganisms were low (19.5 and 78 µg/mL, respectively. Thus, this citronella extract showed potent fungistatic and fungicide activities against M. canis isolated from animals and home environments. Therefore, it could be an alternative for dermatophytosis prophylaxis in the home environment.
Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea) in soil and fecal samples.

Science.gov (United States)

Durant, Jean-Francois; Irenge, Leonid M; Fogt-Wyrwas, Renata; Dumont, Catherine; Doucet, Jean-Pierre; Mignon, Bernard; Losson, Bertrand; Gala, Jean-Luc

2012-12-07

Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis) and/or Toxocara cati (T. cati), two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. A duplex quantitative real-time PCR (2qPCR) targeting the ribosomal RNA gene internal transcribed spacer (ITS2) has been developed and used for rapid and specific identification of T. canis and T. cati eggs in fecal and soil samples. The assay was set up on DNA samples extracted from 53 adult worms including T. canis, T. cati, T. leonina, Ascaris suum (A. suum) and Parascaris equorum (P. equorum). The assay was used to assess the presence of T. cati eggs in several samples, including 12 clean soil samples spiked with eggs of either T. cati or A. suum, 10 actual soil samples randomly collected from playgrounds in Brussels, and fecal samples from cats, dogs, and other animals. 2qPCR results on dogs and cats fecal samples were compared with results from microscopic examination. 2qPCR assay allowed specific detection of T. canis and T. cati, whether adult worms, eggs spiked in soil or fecal samples. The 2qPCR limit of detection (LOD) in spiked soil samples was 2 eggs per g of soil for a turnaround time of 3 hours. A perfect concordance was observed between 2qPCR assay and microscopic examination on dogs and cats feces. The newly developed 2qPCR assay can be useful for high throughput prospective or retrospective detection of T.canis and/or T. cati eggs in fecal samples as well as in soil samples from playgrounds, parks and sandpits.
Mitochondrial DNA haplogroup phylogeny of the dog: Proposal for a cladistic nomenclature.

Science.gov (United States)

Fregel, Rosa; Suárez, Nicolás M; Betancor, Eva; González, Ana M; Cabrera, Vicente M; Pestano, José

2015-05-01

Canis lupus familiaris mitochondrial DNA analysis has increased in recent years, not only for the purpose of deciphering dog domestication but also for forensic genetic studies or breed characterization. The resultant accumulation of data has increased the need for a normalized and phylogenetic-based nomenclature like those provided for human maternal lineages. Although a standardized classification has been proposed, haplotype names within clades have been assigned gradually without considering the evolutionary history of dog mtDNA. Moreover, this classification is based only on the D-loop region, proven to be insufficient for phylogenetic purposes due to its high number of recurrent mutations and the lack of relevant information present in the coding region. In this study, we design 1) a refined mtDNA cladistic nomenclature from a phylogenetic tree based on complete sequences, classifying dog maternal lineages into haplogroups defined by specific diagnostic mutations, and 2) a coding region SNP analysis that allows a more accurate classification into haplogroups when combined with D-loop sequencing, thus improving the phylogenetic information obtained in dog mitochondrial DNA studies. Copyright © 2015 Elsevier B.V. All rights reserved.
Demodex lutrae n. sp. (Acari) in European otter Lutra lutra (Carnivora: Mustelidae) with data from other demodecid mites in carnivores.

Science.gov (United States)

Izdebska, Joanna N; Rolbiecki, Leszek

2014-12-01

This article describes morphological characteristics and occurrence of Demodex lutrae n. sp., which was found on European otter Lutra lutra (Linnaeus, 1758) in Poland. The new species was found in hairy regions of otter skin, mainly in the head area. With respect to morphological features, D. lutrae is most similar to D. canis (Leydig, 1859) from the domestic dog Canis familiaris Linnaeus, 1758. The new species is a medium-sized demodecid mite (adult stages average 200 μm in length); characteristic features of these mites are hammer-shaped supracoxal spines (setae elc.p) on dorsal side of gnathosoma and palps with 3 conical spines. Demodex lutrae is the first representative of the family Demodecidae described in a host from the subfamily Lutrinae. This paper also contains a checklist of demodecid mites known from carnivores.
Importation of canid rabies in a horse relocated from Zimbabwe to South Africa : research communication

Directory of Open Access Journals (Sweden)

C.T. Sabeta

2005-09-01

Full Text Available In July 2003 a 2-year-old Thoroughbred colt was imported from Harare, Zimbabwe to the Ashburton Training Centre, Pietermaritzburg, South Africa. Five months after importation, the colt presented with clinical signs suggestive of rabies: it was uncoordinated, showed muscle tremors and was biting at itself. Brain tissue was submitted for analysis and the clinical diagnosis was confirmed by the fluorescent antibody test and reverse-transcription polymerase chain reaction (RT-PCR. Phylogenetic analysis of the nucleotide sequence of the cytoplasmic domain of the glycoprotein and the G-L intergenic region of the rabies virus confirmed it to be an infection with a canid rabies virus, originating from an area in Zimbabwe endemic for the domestic dog (Canis familiaris and side-striped jackal (Canis adustus rabies.
Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris) Affected with Hypoadrenocorticism (Addison's Disease).

Science.gov (United States)

Boag, Alisdair M; Christie, Michael R; McLaughlin, Kerry A; Syme, Harriet M; Graham, Peter; Catchpole, Brian

2015-01-01

Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD) or autoimmune polyendocrine syndrome (APS), circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH), CYP17A1 (17-hydroxylase; 17-OH), CYP11A1 (P450 side-chain cleavage enzyme; P450scc) and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD) were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation). Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016). Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037). Significant associations with breed (p = 0.015) and DLA-type (DQA1*006:01 allele; p = 0.017) were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.
Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris Affected with Hypoadrenocorticism (Addison's Disease.

Directory of Open Access Journals (Sweden)

Alisdair M Boag

Full Text Available Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD or autoimmune polyendocrine syndrome (APS, circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH, CYP17A1 (17-hydroxylase; 17-OH, CYP11A1 (P450 side-chain cleavage enzyme; P450scc and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation. Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016. Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037. Significant associations with breed (p = 0.015 and DLA-type (DQA1*006:01 allele; p = 0.017 were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.
Quantitative trait loci (QTL study identifies novel genomic regions associated to Chiari-like malformation in Griffon Bruxellois dogs.

Directory of Open Access Journals (Sweden)

Philippe Lemay

Full Text Available Chiari-like malformation (CM is a developmental abnormality of the craniocervical junction that is common in the Griffon Bruxellois (GB breed with an estimated prevalence of 65%. This disease is characterized by overcrowding of the neural parenchyma at the craniocervical junction and disturbance of cerebrospinal fluid (CSF flow. The most common clinical sign is pain either as a direct consequence of CM or neuropathic pain as a consequence of secondary syringomyelia. The etiology of CM remains unknown but genetic factors play an important role. To investigate the genetic complexity of the disease, a quantitative trait locus (QTL approach was adopted. A total of 14 quantitative skull and atlas measurements were taken and were tested for association to CM. Six traits were found to be associated to CM and were subjected to a whole-genome association study using the Illumina canine high density bead chip in 74 GB dogs (50 affected and 24 controls. Linear and mixed regression analyses identified associated single nucleotide polymorphisms (SNPs on 5 Canis Familiaris Autosomes (CFAs: CFA2, CFA9, CFA12, CFA14 and CFA24. A reconstructed haplotype of 0.53 Mb on CFA2 strongly associated to the height of the cranial fossa (diameter F and an haplotype of 2.5 Mb on CFA14 associated to both the height of the rostral part of the caudal cranial fossa (AE and the height of the brain (FG were significantly associated to CM after 10 000 permutations strengthening their candidacy for this disease (P = 0.0421, P = 0.0094 respectively. The CFA2 QTL harbours the Sall-1 gene which is an excellent candidate since its orthologue in humans is mutated in Townes-Brocks syndrome which has previously been associated to Chiari malformation I. Our study demonstrates the implication of multiple traits in the etiology of CM and has successfully identified two new QTL associated to CM and a potential candidate gene.
Fundamental characteristics of the expressed immunoglobulin VH and VL repertoire in different canine breeds in comparison with those of humans and mice.

Science.gov (United States)

Steiniger, Sebastian C J; Dunkle, William E; Bammert, Gary F; Wilson, Thomas L; Krishnan, Abhiram; Dunham, Steven A; Ippolito, Gregory C; Bainbridge, Graeme

2014-05-01

Complementarity determining regions (CDR) are responsible for binding antigen and provide substantial diversity to the antibody repertoire, with VH CDR3 of the immunoglobulin variable heavy (VH) domain playing a dominant role. In this study, we examined 1200 unique canine VH and 500 unique variable light (VL) sequences of large and small canine breeds derived from peripheral B cells. Unlike the human and murine repertoire, the canine repertoire is heavily dominated by the Canis lupus familiaris IGHV1 subgroup, evolutionarily closest to the human IGHV3 subgroup. Our studies clearly show that the productive canine repertoire of all analyzed breeds shows similarities to both human and mouse; however, there are distinct differences in terms of VH CDR3 length and amino acid paratope composition. In comparison with the human and murine antibody repertoire, canine VH CDR3 regions are shorter in length than the human counterparts, but longer than the murine VH CDR3. Similar to corresponding human and mouse VH CDR3, the amino acids at the base of the VH CDR3 loop are strictly conserved. For identical CDR positions, there were significant changes in chemical paratope composition. Similar to human and mouse repertoires, the neutral amino acids tyrosine, glycine and serine dominate the canine VH CDR3 interval (comprising 35%) although the interval is nonetheless relatively depleted of tyrosine when compared to human and mouse. Furthermore, canine VH CDR3 displays an overrepresentation of the neutral amino acid threonine and the negatively charged aspartic acid while proline content is similar to that in the human repertoire. In general, the canine repertoire shows a bias towards small, negatively charged amino acids. Overall, this analysis suggests that functional canine therapeutic antibodies can be obtained from human and mouse sequences by methods of speciation and affinity maturation. Copyright © 2014 Elsevier Ltd. All rights reserved.
Endocarditis por Brucella canis: primer caso documentado en un paciente adulto en Argentina Brucella canis endocarditis: first documented case in Argentina

Directory of Open Access Journals (Sweden)

Valeria Manias

2013-03-01

Full Text Available Se describe el primer caso documentado de endocarditis por Brucella canis en Argentina. El paciente fue un varón adulto que consultó por edemas en miembros inferiores, registros febriles aislados de 2 meses de evolución y dolor precordial opresivo que irradiaba a brazo izquierdo. Negaba contacto con animales de cría o consumo de productos sin pasteurización. Estudios cardiológicos constataron endocarditis infecciosa. Se resuelve cirugía de recambio valvular ante fracaso terapéutico empírico con cefalotina, ampicilina y gentamicina. Los hemocultivos fueron positivos (4 de 4 muestras con bacilos gram negativos. Se realizó la identificación con técnica API 20 NE (bioMérieux, el método automatizado Phoenix (BD y las pruebas bioquímicas convencionales, sin concluir género ni especie. Se derivó la cepa al departamento de Bacteriología Especial INEI-ANLIS "Dr. Carlos G. Malbrán" donde se identificó al aislamiento como Brucella canis. Se rotó el esquema terapéutico a doxiciclina, rifampicina y trimetoprima-sulfametoxazol con buena evolución. La importancia del caso radica en la posible falla del tratamiento antimicrobiano empírico administrado para endocarditis, ya que B. canis no responde a los antimicrobianos convencionales para esta patología.We herein present the case of an adult male patient who consulted for lower extremity edema, a 2- month history of fever and oppressive chest pain radiating to the left arm. He referred neither contact with breeding animals nor consumption of unpasteurized dairy products. A diagnosis of endocarditis was confirmed by cardiac studies. Since the empirical treatment with cephalotin, ampicillin and gentamicin failed, the patient underwent aortic valve replacement. A total of four blood cultures were positive with a gram-negative rod. Bacterial identification was performed using the API 20 NE technique (bioMerieux, the Phoenix automated method (BD and conventional biochemical tests which were
Joint manifestations in children infected with Ascaris lumbricoides and Toxocara canis – single centre experience

Directory of Open Access Journals (Sweden)

Marta Janicka-Szczepaniak

2016-06-01

Full Text Available Joint disorders in children are a frequent cause of parents’ concern and a reason of visiting family doctors and rheumatologists. In search for the correct diagnosis, a wide differential diagnosis should be conducted, including bacterial, parasitic, but also rheumatoid or proliferative process. However, the majority of complaints reported by children are reactive in nature. Diagnosis is based on the clinical symptoms and serology tests results. Ascaris lumbricoides or Toxocara canis infection may manifest itself not only with gastrointestinal, but also musculoskeletal symptoms, depending on the period of the disease. The aim of the paper was to assess the frequency of complaints associated with the locomotor system in children with the presence of serum antibodies against Ascaris lumbricoides and/or Toxocara canis and to analyse their relationship with selected laboratory tests (eosinophilia and the final diagnosis. Material and methods: Medical records of 86 children hospitalised in 2013–2015 at the Department of Paediatric Cardiology and Rheumatology, Medical University of Łódź, were analysed. Children with musculoskeletal symptoms and positive serum antibody titres against Ascaris lumbricoides and/or Toxocara canis were included in the study. Results: Among the infected patients, the most frequently reported complaint from the locomotor system was knee (51% and wrist (19% pain. Ascaris lumbricoides infection was the dominant human parasitosis (66%, while in 15 patients (17% Toxocara canis co-infestation was detected. Rheumatoid process was the most common suspicion (36%, but the final diagnosis of juvenile idiopathic arthritis was determined in only 12 patients (14%. Conclusions: Parasitic infections often coexist with articular symptoms reported by children and should always be excluded in the differential diagnosis. In some cases, a parasitic infection may be one of the factors that initiate the rheumatoid
Establishment of Demodex canis on canine skin engrafted onto scid-beige mice.

Science.gov (United States)

Caswell, J L; Yager, J A; Barta, J R; Parker, W

1996-12-01

A small animal model of canine demodicosis is described. Normal canine skin was engrafted onto scid (severe combined immunodeficient)-beige mice, which lack functional B and T lymphocytes and have reduced natural killer cell activity. The xenografts were later infected with Demodex canis collected from a dog with demodicosis. At 30-112 days following infection, mites were seen histologically in the canine hair follicles of the engrafted skin. Demodex canis adults, nymphs, larvae, and eggs were present in samples macerated in sodium hydroxide. Mite infestations could not be demonstrated in the mouse skin, nor were mites passed from the infected graft to uninfected skin grafts on in-contact mice. This model may be utilized to assess the efficacy of miticidal treatments, to evaluate the importance of specific components of the immune response, and to study the biology of D. canis.
High frequency of visceral leishmaniasis in dogs under veterinary clinical care in an intense transmission area in the state of Tocantins, Brazil

OpenAIRE

Santos, Helcileia Dias; Galvão, Samara Rocha; Dias, Francisca Elda Ferreira; Ribeiro, Taiã Mairon Peixoto; Negreiros Filho, Osmar; Sousa, Sebastiana Adriana Pereira; Minharro, Silvia

2017-01-01

ABSTRACT: A direct search for parasites were used as the diagnostic test to determine the frequency of Leishmania spp. infection in dogs ( Canis lupus familiaris ) under veterinary clinical care in the city of Araguaína, Tocantins, Brazil. For this approach, lymph node cell samples were collected using needle aspiration from 649 dogs of different breeds and ages. Two hundred and sixty four (40.7%) dogs tested positive for amastigote forms of Leishmania spp. Furthermore, 202 (76.5%) dogs tha...
First Case of Natural Infection in Pigs: Review of Trypanosoma cruzi Reservoirs in Mexico

Directory of Open Access Journals (Sweden)

Paz María Salazar-Schettino

1997-07-01

Full Text Available An epidemiological research project was performed in the State of Morelos including collection of samples for blood smears and culture, serological tests, and xenodiagnoses from a total of 76 domestic and peridomestic mammals. Two strains of Trypanosoma cruzi were isolated by haemocultures; one from a pig (Sus scrofa, the first case of natural infection reported in Mexico, and the other from a dog (Canis familiaris. This study summarizes current information in Mexico concerning confirmed reservoirs of T. cruzi
Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs

Directory of Open Access Journals (Sweden)

Maurício Franco Zanette

2014-01-01

Full Text Available Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA, indirect immunofluorescent antibody test (IFAT and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tested, 24 (42.1% tested positive using one of the three serological methods: 10/57 (17.5% for ELISA, 11/57 (19.3% for IFAT and 3/57 (5.3% for Kalazar Detect™. Conclusions: Our results demonstrated that the presence of other infectious agents may lead to cross-reactivity on leishmaniasis serological tests.
Morphometric variations in gametocytes of Hepatozoon canis from naturally infected dogs.

Science.gov (United States)

Eljadar, Mohamed S M; Singla, L D; Mustafa, Radya A A; Uppal, S K

2013-04-01

This study presents the morphometric characteristic of canine haemoprotozoan, Hepatozoon canis, using software DP2-BSW (OLYMPUS). The gametocytes of H. canis found inside the neutrophils were characteristic in shape and size and varied from 9.50 to 11.80 μm × 5.10-6.00 μm. Parasitaemia ranged from 1.00 to 39.00 %. Few gametocytes without nuclei and of abnormal shapes were also observed. The results were compared with the measurements done by using ocular micrometer.
Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

Directory of Open Access Journals (Sweden)

Jennifer B Nagashima

Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.
Serology, molecular detection and risk factors of Ehrlichia canis infection in dogs in Costa Rica.

Science.gov (United States)

Barrantes-González, Alexander V; Jiménez-Rocha, Ana E; Romero-Zuñiga, Juan José; Dolz, Gaby

2016-10-01

A cross-sectional study combining different serological and molecular techniques for the detection of Ehrlichia species in dogs and their ticks was carried out with data from all regions of Costa Rica. A seroprevalence of 32.1% (131/408), and infection with E. canis of 3.2% (13/407) was found, whereas 6.9% (9/130) of ticks attached to the dogs were PCR positive to E. canis. Higher prevalences were found outside the Greater Metropolitan Area (GMA). Risk factors associated with E. canis seropositivity were age, between 2 and 7 years (RR: 1.6, 95% CI: 1.2-2.2) and 8-15 years (RR: 1.8, 95% CI: 1.2-3.0), number of dogs/total of households [Dogs per Household Ratio (DHR) ≥3.1 (RR: 2.0; 95% CI: 1.4-3.0)], number of dogs infested with at least one tick/total of dogs sampled [Tick Infestation Prevalence (TIP)≥31% (RR: 2.1; 95% CI:1.3-3.3)] and living outside the GMA (RR: 1.7; 95% CI: 1.2-2.4) and being a mixed-breed dog (RR: 1.5; 95% CI: 1.1-2.1). Risk factors for E. canis PCR positive dogs were a depressive attitude (OR: 11.2; 95% CI: 1.1-115.9), fever (OR:4.8; 95% CI:1.2-19.3), DHR≥3.1 (OR: 5.7; 95% CI:1.7-19.2)], number of ticks/total of dogs sampled [Tick Distribution Ratio (TDR) ≥2.1 (OR: 6.5; 95% CI: 1.3-31.8)], and TIP≥40% (OR: 5.7; 95% CI: 1.7-19.2). This paper describes E. canis seroprevalence, PCR prevalence and tick analysis in dogs from Costa Rica, with associated clinical signs and owner perceptions. In summary, most of the E. canis infections in dogs in our country seemed to pass unnoticed by owners. Since most of the seropositive dogs (97.7%, 131/134) were negative for E. canis DNA in their blood, it is important to determine in future studies if these dogs recovered from the E. canis infection without any medication, or are persistently infected, and will develop chronic disease. Copyright © 2016 Elsevier GmbH. All rights reserved.
Questing Dermacentor reticulatus harbouring Babesia canis DNA associated with outbreaks of canine babesiosis in the Swiss Midlands.

Science.gov (United States)

Schaarschmidt, Daniel; Gilli, Urs; Gottstein, Bruno; Marreros, Nelson; Kuhnert, Peter; Daeppen, Jérôme A; Rosenberg, Gertrud; Hirt, Didier; Frey, Caroline F

2013-06-01

In 2011 and 2012, outbreaks of clinical canine babesiosis were observed in 2 areas of the Swiss Midlands that had no history of this disease so far. In one area, cases of canine babesiosis occurred over 2 consecutive tick seasons. The outbreaks involved 29 dogs, 4 of which died. All dogs were infected with large Babesia sp. as diagnosed in Giemsa-stained blood smears and/or PCR. These were identified as B. canis (formerly known as B. canis canis) by subsequent partial sequencing of the 18S rRNA gene of Babesia sp. Interestingly, the sequence indicated either a genotype with heterogeneity in the ssrRNA gene copies or double infection with different B. canis isolates. None of the dogs had a recent travel history, but one had frequently travelled to Hungary and had suffered twice from clinical babesiosis 18 and 24 months prior to the outbreak in autumn 2011. Retrospective sequencing of a stored blood DNA sample of this dog revealed B. canis, with an identical sequence to the Babesia involved in the outbreaks. For the first time in Switzerland, the partial 18S rRNA gene of B. canis could be amplified from DNA isolated from 19 out of 23 adult Dermacentor reticulatus ticks flagged in the same area. The sequence was identical to that found in the dogs. Furthermore, one affected dog carried a female D. reticulatus tick harbouring B. canis DNA. Our findings illustrate that, under favourable biogeographic and climatic conditions, the life-cycle of B. canis can relatively rapidly establish itself in previously non-endemic areas. Canine babesiosis should therefore always be a differential diagnosis when dogs with typical clinical signs are presented, regardless of known endemic areas. Copyright © 2013 Elsevier GmbH. All rights reserved.

Ultrastructure of the spermatozoon of Dipylidium caninum (Cestoda, Cyclophyllidea, Dilepididae), an intestinal parasite of Canis familiaris.

Science.gov (United States)

Miquel, J; Marchand, B

1997-01-01

We report for the first time the ultrastructure of the spermatozoon of a Dilepididae cestode. The mature spermatozoa of Dipylidium caninum is filiform and tapered at both ends and lacks mitochondria. The anterior extremity exhibits an apical cone of electron-dense material measuring about 600 nm in length and a single helicoidal crested-like body that is 150 nm thick. This single crested-like body is spiralized at an angle of about 40 degrees to the spermatozoon axis. The axoneme, showing the 9 + "l" pattern of the Platyhelminthes, lacks a periaxonemal sheath. The cortical microtubules constitute a continuous, submembranous, electron-dense material, and they are also twisted at an angle of about 40 degrees to the spermatozoon axis. Moreover, the nucleus is coiled in a helix around the axoneme, which is centrally located throughout its length. We demonstrate for the first time the presence of peripheral microtubules twisted to the spermatozoon axis up to the posterior extremity of the gamete.
Hepatozoon canis infection in ticks during spring and summer in Italy.

Science.gov (United States)

Dantas-Torres, Filipe; Latrofa, Maria Stefania; Weigl, Stefania; Tarallo, Viviana Domenica; Lia, Riccardo Paolo; Otranto, Domenico

2012-02-01

Hepatozoon canis is a common protozoan of dogs, being among the most prevalent tick-borne pathogens infecting dogs around the world. It is primarily transmitted by Rhipicephalus sanguineus, the brown dog tick. In this study we tested ticks collected from dogs and from the environment in order to track the origin of an outbreak of H. canis infection detected in October 2009 in a private dog shelter in southern Italy. Ticks from dogs (n = 267) were collected during the spring of 2009, whereas ticks from environment (n = 300) were found on sticky traps placed in the same shelter during the summer of 2009. All ticks were tested by PCR for the detection of a H. canis 18S ribosomal RNA gene fragment. Four (1.5%, one female and three males) ticks collected from dogs were PCR positive. None of the larvae collected from the environment were positive, but a relatively high infection rate (8.0%) was detected in nymphs. These findings point out that dogs became infected during the summer, when ticks were abundant and highly infected by H. canis. Moreover, this study suggests that castor oil sticky traps might be useful to collect engorged immature ticks in highly infested environments (e.g., dog shelters). This might be particularly interesting to evaluate the level of infection by certain pathogens in free-ranging ticks R. sanguineus, as done in the present study.
What's inside your cat's head? A review of cat (Felis silvestris catus) cognition research past, present and future.

Science.gov (United States)

Vitale Shreve, Kristyn R; Udell, Monique A R

2015-11-01

The domestic cat (Felis silvestris catus) has shared an intertwined existence with humans for thousands of years, living on our city streets and in our homes. Yet, little scientific research has focused on the cognition of the domestic cat, especially in comparison with human's other companion, the domestic dog (Canis lupus familiaris). This review surveys the current status of several areas of cat cognition research including perception, object permanence, memory, physical causality, quantity and time discrimination, cats' sensitivity to human cues, vocal recognition and communication, attachment bonds, personality, and cognitive health. Although interest in cat cognition is growing, we still have a long way to go until we have an inclusive body of research on the subject. Therefore, this review also identifies areas where future research must be conducted. In addition to the scientific value of future work in this area, future research on cat cognition could have an important influence on the management and welfare of pet and free-roaming cats, leading to improved human-cat interactions.
Genome-wide analysis of gene expression and protein secretion of Babesia canis during virulent infection identifies potential pathogenicity factors.

Science.gov (United States)

Eichenberger, Ramon M; Ramakrishnan, Chandra; Russo, Giancarlo; Deplazes, Peter; Hehl, Adrian B

2017-06-13

Infections of dogs with virulent strains of Babesia canis are characterized by rapid onset and high mortality, comparable to complicated human malaria. As in other apicomplexan parasites, most Babesia virulence factors responsible for survival and pathogenicity are secreted to the host cell surface and beyond where they remodel and biochemically modify the infected cell interacting with host proteins in a very specific manner. Here, we investigated factors secreted by B. canis during acute infections in dogs and report on in silico predictions and experimental analysis of the parasite's exportome. As a backdrop, we generated a fully annotated B. canis genome sequence of a virulent Hungarian field isolate (strain BcH-CHIPZ) underpinned by extensive genome-wide RNA-seq analysis. We find evidence for conserved factors in apicomplexan hemoparasites involved in immune-evasion (e.g. VESA-protein family), proteins secreted across the iRBC membrane into the host bloodstream (e.g. SA- and Bc28 protein families), potential moonlighting proteins (e.g. profilin and histones), and uncharacterized antigens present during acute crisis in dogs. The combined data provides a first predicted and partially validated set of potential virulence factors exported during fatal infections, which can be exploited for urgently needed innovative intervention strategies aimed at facilitating diagnosis and management of canine babesiosis.
Y-chromosome evidence supports widespread signatures of three-species Canis hybridization in eastern North America.

Science.gov (United States)

Wilson, Paul J; Rutledge, Linda Y; Wheeldon, Tyler J; Patterson, Brent R; White, Bradley N

2012-09-01

There has been considerable discussion on the origin of the red wolf and eastern wolf and their evolution independent of the gray wolf. We analyzed mitochondrial DNA (mtDNA) and a Y-chromosome intron sequence in combination with Y-chromosome microsatellites from wolves and coyotes within the range of extensive wolf-coyote hybridization, that is, eastern North America. The detection of divergent Y-chromosome haplotypes in the historic range of the eastern wolf is concordant with earlier mtDNA findings, and the absence of these haplotypes in western coyotes supports the existence of the North American evolved eastern wolf (Canis lycaon). Having haplotypes observed exclusively in eastern North America as a result of insufficient sampling in the historic range of the coyote or that these lineages subsequently went extinct in western geographies is unlikely given that eastern-specific mtDNA and Y-chromosome haplotypes represent lineages divergent from those observed in extant western coyotes. By combining Y-chromosome and mtDNA distributional patterns, we identified hybrid genomes of eastern wolf, coyote, gray wolf, and potentially dog origin in Canis populations of central and eastern North America. The natural contemporary eastern Canis populations represent an important example of widespread introgression resulting in hybrid genomes across the original C. lycaon range that appears to be facilitated by the eastern wolf acting as a conduit for hybridization. Applying conventional taxonomic nomenclature and species-based conservation initiatives, particularly in human-modified landscapes, may be counterproductive to the effective management of these hybrids and fails to consider their evolutionary potential.
Molecular and histopathological detection of Hepatozoon canis in red foxes (Vulpes vulpes) from Portugal.

Science.gov (United States)

Cardoso, Luís; Cortes, Helder C E; Eyal, Osnat; Reis, Antónia; Lopes, Ana Patrícia; Vila-Viçosa, Maria João; Rodrigues, Paula A; Baneth, Gad

2014-03-24

Hepatozoon canis is a protozoan tick-borne pathogen of dogs and wild canids. Hepatozoon spp. have been reported to infect foxes in different continents and recent studies have mostly used the polymerase chain reaction (PCR) for the detection and characterization of the infecting species. Surveying red foxes (Vulpes vulpes) may contribute to better understanding the epidemiology of canine vector-borne diseases, including hepatozoonosis caused by H. canis in domestic dogs. The present study investigated the prevalence of Hepatozoon spp. by means of histopathology and molecular analysis of different tissues in red foxes from different parts of Portugal. Blood and tissues including bone marrow, heart, hind leg muscle, jejunum, kidney, liver, lung, popliteal or axillary lymph nodes, spleen and/or tongue were collected from 91 red foxes from eight districts in northern, central and southern Portugal. Tissues were formalin-fixed, paraffin-embedded, cut and stained with hematoxylin and eosin. Polymerase chain reaction (PCR) amplified a ~650 bp fragment of the 18S rRNA gene of Hepatozoon spp. and the DNA products were sequenced. Hepatozoon canis was detected in 68 out of 90 foxes (75.6%) from all the sampled areas by PCR and sequencing. Histopathology revealed H. canis meronts similar in shape to those found in dogs in the bone marrow of 11 (23.4%) and in the spleen of two (4.3%) out of 47 foxes (p = 0.007). All the 11 foxes found positive by histopathology were also positive by PCR of bone marrow and/or blood. Positivity by PCR (83.0%) was significantly higher (p Hepatozoon canis was found to be highly prevalent in red fox populations from northern, central and southern Portugal. Detection of the parasite by histopathology was significantly less sensitive than by PCR. Red foxes are a presumptive reservoir of H. canis infection for domestic dogs.
Evidências epidemiológicas da ocorrência de escabiose, em humanos, causada pelo Sarcoptes scabiei (DeGeer, 1778 var. canis (Bourguignon, 1853 Epidemiologic evidence on the ocurrence of scabies in humans, caused by Sarcoptes scabiei (DeGeer, 1778 var. canis (Bourguignon, 1853

Directory of Open Access Journals (Sweden)

Maria Helena Matiko Akao Larsson

1978-09-01

Full Text Available A partir de 27 cães com sarna sarcóptica, envolvendo 143 pessoas expostas à infestação, observaram-se 58 (40,56% com lesões cutâneas sugestivas de escabiose. Tais lesões mostraram-se mais incidentes nas mulheres do que nos homens e indivíduos de todas as faixas etárias foram acometidos, indistintamente. Foi demonstrada a presença do agente em 3 dos 12 casos humanos observados que mantiveram contato com animais escabiosos.The human infestation with Sarcoptes scabiei var. canis was studied. From 143 humans which were in close contact with 27 infested animals, the author was able to detect 58 infested individuals (40.56%. The incidence of this zoonosis was higher among women than men and individuals of all ages were indiscriminately affected. The scabies agent was observed in 3 out of 12 pacients submitted to skin scraping.
Parasite species of the endangered Iberian wolf (Canis lupus signatus and a sympatric widespread carnivore

Directory of Open Access Journals (Sweden)

Ana Figueiredo

2016-08-01

Full Text Available Parasites have a profound impact on wildlife population dynamics. However, until some years ago, studies on the occurrence and prevalence of wildlife parasites were neglected comparatively with the studies on humans and domestic animals. In this study, we determined the parasite prevalence of two sympatric wild canids: the endangered Iberian wolf (Canis lupus signatus and the widespread red fox (Vulpes vulpes, in central Portugal. From November 2014 to July 2015, fresh fecal samples from both species were collected monthly in several transects distributed throughout the study area. All samples were submitted to several coprological techniques. In total, 6 helminth parasites (Crenosoma vulpis, Angiostrongylus vasorum, Toxocara canis, Trichuris vulpis, Ancylostomatidae, Toxascaris leonina, and a protozoa (Balantidium coli were identified based on size and morphology. The red fox was infected by seven different parasites while the Iberian wolf was infected by four. All parasites present in wolf were also present in the red fox. C. vulpis had the higher prevalence in red fox, while Ancylostomatidae were the most prevalent parasites in wolf. To our knowledge, this is the first study in this isolated subpopulation of the Iberian wolf. Our results show that both carnivores carry parasites that are of concern as they are pathogenic to humans and other wild and domestic animals. We suggest that surveillance programs must also include monitoring protocols of wildlife; particularly endangered species.
MASTICATORY MUSCLE MYOSITIS IN A GRAY WOLF (CANIS LUPUS).

Science.gov (United States)

Kent, Marc; Glass, Eric N; Castro, Fernando A; Miller, Andrew D; de Lahunta, Alexander

2017-03-01

A 10-yr-old male, neutered gray wolf ( Canis lupus ) was presented for atrophy of the temporalis and masseter muscles. Clinical signs and magnetic resonance imaging were consistent with a myopathy. Positive serology for antibody titers directed against Type 2M myofibers, and the observation of a mixed mononuclear inflammatory cell infiltrate along with eosinophils and neutrophils within the temporalis muscle, were diagnostic for masticatory muscle myositis. Importantly, protozoal myositis was excluded based on other clinicopathologic data. The case highlights the potential for immune-mediated polymyositis in canids other than the domesticated dog ( Canis lupus familaris). Additionally, awareness of a diet in which raw meat is used should prompt a thorough investigation for an underlying infectious myositis in the gray wolf.
First molecular evidence of Hepatozoon canis infection in red foxes and golden jackals from Hungary.

Science.gov (United States)

Farkas, Róbert; Solymosi, Norbert; Takács, Nóra; Hornyák, Ákos; Hornok, Sándor; Nachum-Biala, Yaarit; Baneth, Gad

2014-07-02

Recently, Hepatozoon canis infection has been detected among shepherd, hunting and stray dogs in the southern part of Hungary, which is considered to be free of Rhipicephalus sanguineus sensu lato and close to the border with Croatia. The aim of this study was to acquire information on the possibility that red foxes and/or golden jackals could play a role in the appearance and spread of H. canis in Hungary. A conventional PCR was used to amplify a 666 bp long fragment of the Hepatozoon 18S rRNA gene from blood samples collected from 334 foxes shot in 231 locations in 16 counties and 15 golden jackals shot in 9 locations in two southwestern counties close to Croatia. A second PCR assay was performed in some of the samples positive by the first PCR to amplify a larger segment (approximately 1500 bp) of the 18S rRNA gene of Hepatozoon spp. for further phylogenetic analysis. Hepatozoon infection was detected in canids shot in 30 locations and 9 counties. Altogether 26 foxes (8.0%, 95% CI: 5-11%) and 9 jackals (60%, 95% CI: 33-81%) were PCR positive. Hepatozoon canis sequences were obtained from 12 foxes and 7 jackals. DNA sequences from 16 animals were 99-100% similar to H. canis from Croatian foxes or dogs while two of the sequences were 99% similar to an Italian fox. Half (13/26) of the infected red foxes and all golden jackals were shot in the two southwestern counties. This is the first report on molecular evidence of H. canis in red foxes (Vulpes vulpes) and golden jackals (Canis aureus) from Hungary, which is considered free from the tick vector of H. canis, R. sanguineus. Although no R. sanguineus sensu lato had been found on infected or non-infected wild canids, the detection of authochnous canine hepatozoonosis in Hungary might imply that the range of R. sanguineus sensu lato has reached this country.
Anticorpos anti-Brucella canis e anti-Brucella abortus em cães de Araguaína, Tocantins

Directory of Open Access Journals (Sweden)

Elaine Maria Seles Dorneles

2011-04-01

Full Text Available The aims of the present study were to determine the seroprevalence of infection by Brucella canis and Brucella abortus and to evaluate possible risk factors for infection in dogs from Araguaína, Tocantins, Brazil. Sera from 374 dogs, of the urban zones of the municipality, from both sexes, were submitted to the agar-gel immunodiffusion for Brucella canis-antibodies and to rose Bengal test (AAT and fluorescence polarization assay (FPA for Brucella abortus-antibodies. From the 374 tested dogs, 21 reacted in the AAT, but no one was positive in the FPA. The seroprevalence of B. canis infection found in Araguaína, Tocantins, Brazil, was 44.53% (95% IC; 39.43 to 49.72. No association was found among seropositivity for B. canis and the risk factors studied. Thus, data from the present study showed that there was no infection by B. abortus among dogs in the sample and that infection by B. canis is widespread and at high prevalence in Araguaína, Tocantins, Brazil.
Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

Directory of Open Access Journals (Sweden)

Maisa Leite de Queiroz

2013-02-01

Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.
Differential effects of oxytocin on social sensitivity in two distinct breeds of dogs (Canis familiaris).

Science.gov (United States)

Kovács, Krisztina; Kis, Anna; Pogány, Ákos; Koller, Dóra; Topál, József

2016-12-01

Dogs have been proven to show several human-analogue social behaviors, and recent research raises the possibility that the oxytocin system is related to these. However, despite dogs' general tendency to excel in the domain of social cognition, there is increasing evidence that dogs' ability to utilize human signals may vary with breed. Moreover, breeds may show differences not only in their 'inborn' communicative abilities, but also in their learning skills related to these. The aim of the present study was to explore breed differences and breed-specific effects of oxytocin administration on different aspects of social responsiveness. Dogs from two markedly different breeds, Border Collies (cooperative workers) and Siberian Huskies (independent workers) were tested. After having received intranasal administration of oxytocin or placebo, subjects participated in three behavioral tests measuring social responsiveness. Our results show that there are several behavioral differences between the two breeds and also that there are differential effects of the oxytocin treatment. Border Collies were in general more susceptible to the 'social' effects of oxytocin compared to Siberian Huskies: after oxytocin administration they (1) looked more at the experimenter in the 'Unreachable food' situation, (2) looked more at the owner and shifted their gaze more between the sound source and the owner in a potentially dangerous situation, and (3) looked longer at the experimenter's eyes in the 'Tolerance of prolonged eye contact' test. These findings suggest that selection for enhanced cooperative abilities, possibly complemented by the effect of different social environments the two breeds experience, affects dogs' performance in several behavioral tests and that the neurohormonal background differently modulates social behavior in different working breeds. Copyright © 2016 Elsevier Ltd. All rights reserved.
Konsentrasi Serum Anjing yang Optimum untuk Menumbuhkan dan Memelihara Babesia canis dalam Biakan

Directory of Open Access Journals (Sweden)

Tutuk Astyawati

2010-12-01

Full Text Available The use of cultivation system in vitro is very important in the future study of Babesia canis. Theaim of this study was to cultivate B. canis in vitro using RPMI media with different concentration of dogsera. B. canis infected erythrocytes were collected from splenectomized infected dog. Parasites werecultivated with RPMI 1640 medium supplemented with normal dog sera at the concentration of 10%, 20%and 40%, the culture were then incubated in 5% CO2 , 37oC temperature for 17 days and subcultured every48 hours. The Percentage of Parasitized Erythrocytes (PPE in culture with 10% dog serum was significantlylower than those 20%, and 40% The used of 20% and 40 % sera were better than 10%. It is recommendedthat 40 % serum can be used for initiation phase of cultivation, whereas 20% concentration were used formaintenance of the culture.
Babesia canis vogeli infection in dogs and ticks in the semiarid region of Pernambuco, Brazil

Directory of Open Access Journals (Sweden)

Andreina C. Araujo

2015-05-01

Full Text Available Abstract:This study aimed to report the prevalence of Babesia canis vogeli in dogs and ticks in the urban and rural areas of Petrolina, Pernambuco. Serum and peripheral blood samples of 404 dogs were tested by indirect immunofluorescence assay (IFA and by blood smears, respectively. The presence of tick infestation was evaluated, and some specimens were submitted to DNA amplification by polymerase chain reaction (PCR. The presence of antibodies anti-B. canis vogeli was determinate in 57.9% (234/404 of dogs. The direct detection of Babesia spp was obtained in 0.5% (2/404 dogs by visualization of intraerythrocytic forms. Infestation by Rhipicephalus sanguineus sensu lato was observed in 54.5% (220/404 of dogs in both urban and rural areas. DNA of Babesia canis vogeli were obtained by PCR in 6% individual (3/50 and 8.7% of pool of ticks (7/80. The risk factors for the presence of anti-B. canis vogeli antibodies, as determined through the application of logistic regression models (P<0.05, were the following: medium breed size variables (P<0.001; contact with areas of forest (P=0.021; and access on the street (P=0.046. This study describes, for the first time, the confirmation of infection of B. canis vogeli in dogs and ticks in the semiarid region of Pernambuco, Brazil.
Prevalence of Toxocara canis infection in dogs in the Warszawa area.

Science.gov (United States)

Borecka, A; Gawor, J

2000-01-01

The evaluation of Toxocara canis infection in stray dogs from two shelters and private owners dogs in the Warszawa district was the aim of this study. In 1998 five hundred faecal samples were examined. The homeless dogs were found more infected than those kept as pets. T. canis was recorded in 3.4% and 8.8% of stray dogs from the shelters and in 0.4% of animals from flats. The higher prevalence of infection in homeless dogs was due to high density of dogs population, worse environmental condition and irregular anthelmintic treatment in the shelters when compare with housed dogs.
Persistence of specific antibody response in different experimental infections of mice with Toxocara canis larvae Persistência da resposta humoral em camundongos experimentalmente infectados com larvas de Toxocara canis

Directory of Open Access Journals (Sweden)

Pedro Paulo Chieffi

1995-06-01

Full Text Available Anti-Toxocara antibody production and persistence were studied in experimental infections of BALB/c mice, according to three different schedules: Group I (GI - 25 mice infected with 200 T. canis eggs in a single dose; Group II (GII 25 mice infected with 150 T. canis eggs given in three occasions, 50 in the 1st, 50 in the 5th and 50 in the 8th days; Group III (GIII - 25 mice also infected with 150 T. canis eggs, in three 50 eggs portions given in the 1st, 14th and 28th days. A 15 mice control group (GIV was maintained without infection. In the 30th, 50th, 60th, 75th, 105th and 180th post-infection days three mice of the GI, GII and GIII groups and two mice of the control group had been sacrificed and exsanguinated for sera obtention. In the 360th day the remainder mice of the four groups were, in the same way, killed and processed. The obtained sera were searched for the presence of anti-Toxocara antibodies by an ELISA technique, using T. canis larvae excretion-secretion antigen. In the GI and GII, but not in the GIII, anti-Toxocara antibodies had been found, at least, up to the 180th post-infection day. The GIII only showed anti-Toxocara antibodies, at significant level, in the 30th post-infection day.Estudou-se a cinética de anticorpos anti-Toxocara em camundongos BALB/c infectados experimentalmente segundo três esquemas: Grupo I (GI: 25 camundongos infectados com dose única de 200 ovos embrionados de T. canis; grupo II (GII: 25 camundongos infectados com 150 ovos embrionados de T. canis, divididos em três doses de 50 ovos, administrados no 1º, 5º e 8º dias; Grupo III (GIII: 25 camundongos infectados com 150 ovos embrionados de T. canis, administrados em três doses de 50 ovos no 1º, 14º e 28º dias. Um grupo de 15 camundongos foi mantido nas mesmas condições, porém sem infecção, constituindo o grupo controle (GIV. No 30º, 50º, 60º, 75º, 105º e 180º dias pós-infecção três camundongos dos grupos GI, GII e GIII e dois do
Ultrastructure of spermiogenesis of Dipylidium caninum (Cestoda, Cyclophyllidea, Dipylidiidae), an intestinal parasite of Canis familiaris.

Science.gov (United States)

Miquel, J; Bâ, C T; Marchand, B

1998-09-01

We describe for the first time the ultrastructure of spermiogenesis of a representative of the family Dipylidiidae, Dipylidium caninum. Spermiogenesis begins with the formation of a differentiation zone. This conical area presents two centrioles with associated striated roots. One of the centrioles develops a flagellum and posteriorly a proximodistal fusion is produced between the axoneme and a median cytoplasmic process. In a final stage of spermiogenesis a condensation of electron-dense material between cortical microtubules is observed in the anterior part of the differentiation zone. This is the origin of the crest-like body that appears at the end of spermiogenesis. The presence of striated roots associated with centrioles constitutes the first report of these structures in the spermiogenesis of a cyclophyllidean cestode.
Exposición al parásito Toxocara canis en una población escolar de la comuna 7 del distrito de Santa Marta, Colombia.

Directory of Open Access Journals (Sweden)

Dary Luz Mendoza Meza

2013-10-01

Full Text Available ResumenLa toxocariosis es una zoonosis producida por ingesta de huevos infectantes de parásitos del género Toxocara, presentes en el suelo contaminado. La infección humana por Toxocara canis es una de las causas principales del síndrome de migración visceral larvaria. La principal fuente de la enfermedad son los caninos infectados con el parásito. En el Distrito de Santa Marta la población de caninos es alta, sin embargo, no se conoce la prevalencia de la toxocariosis en estos animales ni en el humano. El propósito del presente estudio fue establecer la exposición a Toxocara canis en escolares entre 2 y 16 años de la comuna 7 del Distrito de Santa Marta. Se determinaron los niveles sanguíneos de IgG contra el antígeno de secreción/excreción de larvas L2 de Toxocara canis y los niveles de IgE total. También se evaluó la presencia de parasitismo intestinal y de factores epidemiológicos y clínicos relacionados con la toxocariosis humana. En una muestra de 133 niños, el 42,1% fueron seropositivos a Toxocara canis y 92,5% tuvo niveles sanguíneos de IgE total elevados. Los factores epidemiológicos asociados con la exposición al Toxocara fueron ausencia de agua potable (p <0,0001, ausencia de alcantarillado (p = 0,034, contacto con el suelo (p <0,0001 y presencia de mascotas (perro, p =0,013 y gato, p =0,0069. También se encontró relación estadísticamente significativa con la infección por otros helmintos (p = 0,0069 y la IgE total elevada (p = 0,0134. No se encontró relación estadísticamente significativa con la infección intestinal por protozoos, con la desnutrición aguda (WAZ ≤ -2SD o con la desnutrición crónica (HAZ ≤ -2SD. (DUAZARY 2010, 183 - 190AbstractThe toxocariosis is a zoonosis caused by ingestion of infective eggs of parasites toxocara species, present in the contaminated soil. Human infection by Toxocara canis is a major cause of visceral larva migration syndrome. The main source of the disease are
Canis mtDNA HV1 database: a web-based tool for collecting and surveying Canis mtDNA HV1 haplotype in public database.

Science.gov (United States)

Thai, Quan Ke; Chung, Dung Anh; Tran, Hoang-Dung

2017-06-26

Canine and wolf mitochondrial DNA haplotypes, which can be used for forensic or phylogenetic analyses, have been defined in various schemes depending on the region analyzed. In recent studies, the 582 bp fragment of the HV1 region is most commonly used. 317 different canine HV1 haplotypes have been reported in the rapidly growing public database GenBank. These reported haplotypes contain several inconsistencies in their haplotype information. To overcome this issue, we have developed a Canis mtDNA HV1 database. This database collects data on the HV1 582 bp region in dog mitochondrial DNA from the GenBank to screen and correct the inconsistencies. It also supports users in detection of new novel mutation profiles and assignment of new haplotypes. The Canis mtDNA HV1 database (CHD) contains 5567 nucleotide entries originating from 15 subspecies in the species Canis lupus. Of these entries, 3646 were haplotypes and grouped into 804 distinct sequences. 319 sequences were recognized as previously assigned haplotypes, while the remaining 485 sequences had new mutation profiles and were marked as new haplotype candidates awaiting further analysis for haplotype assignment. Of the 3646 nucleotide entries, only 414 were annotated with correct haplotype information, while 3232 had insufficient or lacked haplotype information and were corrected or modified before storing in the CHD. The CHD can be accessed at http://chd.vnbiology.com . It provides sequences, haplotype information, and a web-based tool for mtDNA HV1 haplotyping. The CHD is updated monthly and supplies all data for download. The Canis mtDNA HV1 database contains information about canine mitochondrial DNA HV1 sequences with reconciled annotation. It serves as a tool for detection of inconsistencies in GenBank and helps identifying new HV1 haplotypes. Thus, it supports the scientific community in naming new HV1 haplotypes and to reconcile existing annotation of HV1 582 bp sequences.

Duplex quantitative real-time PCR assay for the detection and discrimination of the eggs of Toxocara canis and Toxocara cati (Nematoda, Ascaridoidea in soil and fecal samples

Directory of Open Access Journals (Sweden)

Durant Jean-Francois

2012-12-01

Full Text Available Abstract Background Toxocarosis is a zoonotic disease caused by Toxocara canis (T. canis and/or Toxocara cati (T. cati, two worldwide distributed roundworms which are parasites of canids and felids, respectively. Infections of humans occur through ingestion of embryonated eggs of T. canis or T. cati, when playing with soils contaminated with dogs or cats feces. Accordingly, the assessment of potential contamination of these areas with these roundworms eggs is paramount. Methods A duplex quantitative real-time PCR (2qPCR targeting the ribosomal RNA gene internal transcribed spacer (ITS2 has been developed and used for rapid and specific identification of T. canis and T. cati eggs in fecal and soil samples. The assay was set up on DNA samples extracted from 53 adult worms including T. canis, T. cati, T. leonina, Ascaris suum (A. suum and Parascaris equorum (P. equorum. The assay was used to assess the presence of T. cati eggs in several samples, including 12 clean soil samples spiked with eggs of either T. cati or A. suum, 10 actual soil samples randomly collected from playgrounds in Brussels, and fecal samples from cats, dogs, and other animals. 2qPCR results on dogs and cats fecal samples were compared with results from microscopic examination. Results 2qPCR assay allowed specific detection of T. canis and T. cati, whether adult worms, eggs spiked in soil or fecal samples. The 2qPCR limit of detection (LOD in spiked soil samples was 2 eggs per g of soil for a turnaround time of 3 hours. A perfect concordance was observed between 2qPCR assay and microscopic examination on dogs and cats feces. Conclusion The newly developed 2qPCR assay can be useful for high throughput prospective or retrospective detection of T.canis and/or T. cati eggs in fecal samples as well as in soil samples from playgrounds, parks and sandpits.
First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study

Directory of Open Access Journals (Sweden)

Carolina G. Sosa-Gutiérrez

2016-09-01

Full Text Available Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed using the Maximum likelihood method, and Maximum parsimony. Results. They were positive to E. canis 25/139 (18.0% dogs and 29/139 (20.9% ticks. The clinical manifestations presented were fever, fatigue, depression and vomiting. Rhipicephalus sanguineus Dermacentor variabilis and Haemaphysalis leporis-palustris ticks were positive for E. canis. Phylogenetic analysis showed that the sequences of dogs and ticks in Mexico form a third group diverging of sequences from South America and USA. Conclusions. This is the first phylogenetic analysis of E. canis in Mexico. There are differences in the sequences of Mexico with those reported in South America and USA. This research lays the foundation for further study of genetic variability.
Tissue expression pattern of ABCG transporter indicates functional roles in reproduction of Toxocara canis.

Science.gov (United States)

Luo, Yong-Li; Ma, Guang-Xu; Luo, Yong-Fang; Kuang, Ce-Yan; Jiang, Ai-Yun; Li, Guo-Qing; Zhou, Rong-Qiong

2018-03-01

Toxocara canis is a zoonotic parasite with worldwide distribution. ATP-binding cassette (ABC) transporters are integral membrane proteins which involve in a range of biological processes in various organisms. In present study, the full-length coding sequence of abcg-5 gene of T. canis (Tc-abcg-5) was cloned and characterized. A 633 aa polypeptide containing two conserved Walker A and Walker B motifs was predicted from a continuous 1902 nt open reading frame. Quantitative real-time PCR was employed to determine the transcriptional levels of Tc-abcg-5 gene in adult male and female worms, which indicated high mRNA level of Tc-abcg-5 in the reproductive tract of adult female T. canis. Tc-abcg-5 was expressed to produce rabbit polyclonal antiserum against recombinant TcABCG5. Indirect-fluorescence immunohistochemical assays were carried out to detect the tissue distribution of TcABCG5, which showed predominant distribution of TcABCG5 in the uterus (especially in the germ cells) of adult female T. canis. Tissue transcription and expression pattern of Tc-abcg-5 indicated that Tc-abcg-5 might play essential roles in the reproduction of this parasitic nematode.
P1 and N170 components distinguish human-like and animal-like makeup stimuli.

Science.gov (United States)

Luo, Shuwei; Luo, Wenbo; He, Weiqi; Chen, Xu; Luo, Yuejia

2013-06-19

This study used event-related potentials to investigate the sensitivity of P1 and N170 components to human-like and animal-like makeup stimuli, which were derived from pictures of Peking opera characters. As predicted, human-like makeup stimuli elicited larger P1 and N170 amplitudes than did animal-like makeup stimuli. Interestingly, a right hemisphere advantage was observed for human-like but not for animal-like makeup stimuli. Dipole source analyses of 130-200-ms window showed that the bilateral fusiform face area may contribute to the differential sensitivity of the N170 component in response to human-like and animal-like makeup stimuli. The present study suggests that the amplitudes of both the P1 and the N170 are sensitive for the mouth component of face-like stimuli.
Assessment of attachment behaviour to human caregivers in wolf pups (Canis lupus lupus).

Science.gov (United States)

Hall, Nathaniel J; Lord, Kathryn; Arnold, Anne-Marie K; Wynne, Clive D L; Udell, Monique A R

2015-01-01

Previous research suggested that 16-week old dog pups, but not wolf pups, show attachment behaviour to a human caregiver. Attachment to a caregiver in dog pups has been demonstrated by differential responding to a caregiver compared to a stranger in the Ainsworth Strange Situation Test. We show here that 3-7 week old wolf pups also show attachment-like behaviour to a human caregiver as measured by preferential proximity seeking, preferential contact, and preferential greeting to a human caregiver over a human stranger in a modified and counterbalanced version of the Ainsworth Strange Situation Test. In addition, our results show that preferential responding to a caregiver over a stranger is only apparent following brief isolation. In initial episodes, wolf pups show no differentiation between the caregiver and the stranger; however, following a 2-min separation, the pups show proximity seeking, more contact, and more greeting to the caregiver than the stranger. These results suggest intensive human socialization of a wolf can lead to attachment--like responding to a human caregiver during the first two months of a wolf pup's life. Published by Elsevier B.V.
Seroprevalence of Ehrlichia canis infection in stray dogs from Serbia

Directory of Open Access Journals (Sweden)

Nataša Bogićević

2017-03-01

Full Text Available Canine Monocytic Ehrlichiosis is a zoonotic bacterial disease with worldwide distribution. With regards to the population of stray dogs, the disease is facilitated due to their lifestyle and the lack of anti-parasitic protection. The aim of this study was to provide serological data on the presence of a specific Ehrlichia canis IgG antibodies in stray dogs, originating from 7 municipalities in Serbia. During the period from April 2013 to June 2014, 217 canine sera were submitted to the laboratory of the Department of Infectious Diseases of Animals and Bees, Faculty of Veterinary Medicine in Belgrade. An immunofluorescent antibody test (IFAT was performed to detect antibodies to Ehrlichia canis (cut off, 1:50. Seropositive dogs were found in 5 out of 7 counties with a seroprevalence varying from 3.57% to 20% and an overall seroprevalence of 11.06% (24/217. There was no statistically significant difference between the prevalence of infection and the host age or gender. Results showed that stray dogs contribute to maintaining and spreading of Ehrlichia canis in Serbia. Due to the close relationship between people and dogs, it is of great importance to constantly monitor and improve prevention of this disease.
ENCUESTA EXPLORATORIA DE INFECCION POR Brucella canis EN PERROS DE

Directory of Open Access Journals (Sweden)

Ana Pardo D

2009-08-01

Full Text Available Objetivo. Determinar la presencia de anticuerpos a B. canis en perros domésticos y callejeros del municipio de Villavicencio, Colombia. Materiales y métodos. Se utilizó la prueba de aglutinación rápida en placa con antígeno menos mucoide (M- en 201 muestras de suero. En dos animales seropositivos se realizó intento de aislamiento por hemocultivo en medio selectivo para Brucella (oxoid®. En un animal seropositivo, con crecimiento bacteriano con características morfológicas sugestivas a B. canis se realizó histopatología de testículo, bazo e hígado. Resultados. La seropositividad general fue de 1.49% y correspondió a tres caninos machos, dos de los cuales presentaron signos clínicos de epididimitis y orquitis (unilateral. El cultivo y la histopatología no fueron concluyentes para el diagnostico de B. canis. Conclusiones. La seropositividad fue baja y sugiere que la población estudiada no ha estado en contacto con la bacteria. La presencia de reactores puede estar asociado con falsos positivos. El no aislamiento de la bacteria no indica que la enfermedad no exista por lo que se requiere de nuevos estudios.
Performance constraints in strength events in dogs (Canis lupus familiaris).

Science.gov (United States)

Helton, William S

2011-01-01

Ecological performance in animals is considered to be constrained by trade-offs between structural and physiological features. Some of the best anatomical and physiological data in support of this perspective are based on findings from canines, in which researchers have demonstrated skeletal shape trade-offs between running efficiency and strength. There has, however, actually been little examination of the link between these structural differences and relevant performance. In this paper I analyze the performance of six breeds of dogs in standardized weight pulling competitions. More brachycephalic shaped (broad headed) dogs are indeed significantly stronger than more dolichocephalic shaped (narrow headed) dogs even when controlling for body mass. Morphological trade-offs between power and running ability may be an important constraint on the evolution of canines and other terrestrial vertebrates. Copyright © 2010 Elsevier B.V. All rights reserved.
Hematological disorders detected in dogs infected by Hepatozoon canis in a municipality in Mato Grosso do Sul State, Brazil

Directory of Open Access Journals (Sweden)

L.M. Paiz

Full Text Available ABSTRACT A retrospective review of hematological reports of nine dogs detected with Hepatozoon canis infection by microscopic examination of blood smears in a laboratory in the municipality of Dourados, Mato Grosso do Sul, Brazil was conducted. This study aimed to evaluate the hematological profile of these infected dogs, in addition to the occurrence of coinfections with other agents that infect blood cells, since studies concerning canine hepatozoonosis in Brazil are scarce and there are some divergences regarding H. canis infection that still require a resolution. The nine cases of H. canis infection were identified among all dogs examined at the studied laboratory in 2009 and 2010, with an occurrence of 7/1,192 (0.59%; 95% CI 0.15 - 1.02% positive dogs in the first year and 2/1,313 (0.15%; 95% CI 0.02 - 0.55% cases in 2010. The analysis of the hematological reports showed an occurrence of coinfection between H. canis and other agents in two (2/9; 22.22%; 95% CI 2.81 - 60.00% dogs, one with E. canis and another with Babesia spp. (1/9; 11.11%; 95% CI 0.28 - 48.24%. Only the blood test of one dog had no alterations, based on reference values. Anemia was the most frequent hematological alteration (6/9; 66.67%; 95% CI 29.93 - 92.51%. Although the occurrence of H. canis infection was low, significative hematological alterations were observed in most infected dogs. Coinfection with Babesia spp. and E. canis was detected in two dogs and the hematological alterations cannot be attributed exclusively to H. canis in these animals. Longitudinal studies would be of fundamental importance to determine the causality of these alterations. These results highlight the importance of differential diagnosis in dogs when there is clinical suspicion of infection by hemoparasites, since the hematological changes in dogs infected by H. canis are quite variable.
Detection of Hepatozoon canis in the Brown Dog Tick and Domestic Dogs in Peninsular Malaysia.

Science.gov (United States)

Prakash, Batah Kunalan; Low, Van Lun; Tan, Tiong Kai; Vinnie-Siow, Wei Yin; Lim, Yvonne Ai-Lian; Morvarid, Akhavan Rezaei; Azman, Adzzie Shazleen; Yeong, Yze Shiuan; AbuBakar, Sazaly; Sofian-Azirun, Mohd

2018-05-17

Hepatozoon canis has been widely reported in dogs. Its prevalence in ticks, however, has not been well-established. Here we determine the occurrence of Hepatozoon DNA in the brown dog tick Rhipicephalus sanguineus (Latreille) (Acari: Ixodidae) sensu lato (s.l.) and domestic dogs from Peninsular Malaysia using a polymerase chain reaction (PCR) assay based on amplification of the 18S ribosomal RNA coding sequence. Our results revealed a relatively low prevalence of H. canis DNA in both R. sanguineus s.l. (0.7%) and dogs (3.33%). This study represents the first report of H. canis DNA in R. sanguineus s.l. in Malaysia, highlighting the risk of this infection in dogs.
Assessment of Radiation-Attenuated Vaccine or Thyme Oil Treatment on Controlling DNA Damage and Nitric Oxide Synthesis in Brain of Rat Infected with Toxocara canis

International Nuclear Information System (INIS)

Amin, M.M.; Hafez, E.N.; Abd Raboo, M.A.

2016-01-01

Toxocara canis is a worldwide zoonotic roundworm that infects a number of hosts including humans. It exhibits marked affinity to the nervous tissues. This study deals with the changes in the brain of Toxocara canis infected rats regarding parasitological, nitric oxide (NO) level and DNA damage compared to the effect of vaccination with gamma radiation-attenuated embryonated egg or thyme oil treatment. Eighty rats were classified into four groups (twenty each): GI (normal control); GII infected with 2500 T. canis infective eggs/ml/rat (infected control); GIII vaccinated with 800 Gy gamma-attenuated embryonated eggs (vaccinated group) and GIV infected with 2500 T. canis eggs and treated with thyme oil (thyme treated group). At the 14th day post-infection, ten rats from each group were sacrificed and the remaining were re-infected (challenged) with the same number of eggs. At the 14th days post challenge, brain tissues were taken for larval recovery, nitric oxide level evaluation and DNA damage using fragmentation and comet assay. The results exhibited a significant decrease in larval count and nitric oxide level with less damage in brain cells in thyme treated and gamma radiation-attenuated vaccinated groups compared to control infected group. It is also, concluded that vaccination using γ- rays is more effective in protection compared to using thyme oil.
Recurrent patent infections with Toxocara canis in household dogs older than six months : a prospective study

NARCIS (Netherlands)

Nijsse, Rolf; Mughini-Gras, Lapo; Wagenaar, Jaap A; Ploeger, Harm W

2016-01-01

BACKGROUND: To reduce environmental contamination with Toxocara canis eggs, the current general advice is to deworm all dogs older than six months on average four times a year. However, only a small proportion of non-juvenile household dogs actually shed T. canis eggs, and some dogs shed eggs more
Occurrence of Hepatozoon canis and Cercopithifilaria bainae in an off-host population of Rhipicephalus sanguineus sensu lato ticks.

Science.gov (United States)

Ramos, Rafael Antonio Nascimento; Giannelli, Alessio; Carbone, Domenico; Baneth, Gad; Dantas-Torres, Filipe; Otranto, Domenico

2014-04-01

Hepatozoon canis (Eucoccidiorida, Hepatozoidae) and the filarioid Cercopithifilaria bainae (Spirurida, Onchocercidae) are tick-transmitted infectious agents of dogs, highly prevalent in the Mediterranean basin in association with Rhipicephalus sanguineus sensu lato. Ticks were collected from the environment every 25±2 days in a confined location in southern Italy where a community of dogs lives, from August 2012 to July 2013. In order to study the occurrence of H. canis and C. bainae, 1091 tick specimens (770 adults; 271 nymphs, and 50 larvae) were dissected, and oocysts of H. canis and larvae of C. bainae were morphologically identified. Out of 1091 dissected ticks, 13.47% (n=147) were positive for H. canis, with the highest prevalence recorded in unfed adults (16.4%; 126/770), followed by nymphs collected as larvae and allowed to moult (14%; 7/50), unfed nymphs dissected immediately after collection (3%; 8/271), and adults collected as nymphs and allowed to moult (2%; 6/271). The highest number of H. canis-positive ticks (35.5%; 43/121; Pcanis and C. bainae infections in the study area seem to be dependent on the seasonality of vector tick populations. Hence, dogs living in these areas are more exposed to both pathogens during the warmer months. These findings provide new insights into the ecology of both H. canis and C. bainae. Copyright © 2014 Elsevier GmbH. All rights reserved.
Detection and molecular identification of Hepatozoon canis and Babesia vogeli from domestic dogs in Palestine.

Science.gov (United States)

Azmi, Kifaya; Al-Jawabreh, Amer; Nasereddin, Abedelmajeed; Abdelkader, Ahmad; Zaid, Taher; Ereqat, Suheir; Sawalha, Samer S; Baneth, Gad; Abdeen, Ziad

2017-04-01

Dogs serve as hosts for a great number of parasites, which may affect their health and wellbeing. This study aimed to observe tick borne pathogens in dogs from Palestine including Hepatozoon canis and Babesia species. The prevalence of both H. canis and Babesia species infections in apparently healthy dogs, from ten districts of the West Bank was surveyed. DNA was extracted from blood samples obtained from dogs (n = 362) and ticks (n = 213) collected from dogs (n = 77). A primer set that amplifies a partial sequence of the Babesia and Hepatozoon 18S rRNA gene was used for PCR and the DNA sequences of the PCR products of all samples were determined. Twenty-nine (8·0%) of the dogs were found infected including 20 with H. canis (5·5%), seven with Babesia vogeli (1·9%) and two with undefined Babesia spp. (0·6%). Twelve Rhipicephalus sanguineus s.l ticks were pathogen-positive, including ten with H. canis (4·7%), one with B. vogeli (0·5%), and one with Hepatozoon felis (0·5%). The results indicated that a wide range of tick borne pathogens is circulating in the canine population in the surveyed region. This study is the first report on the prevalence of H. canis, B. vogeli and Babesia spp. in dogs in Palestine and its results will assist in the management of diseases associated with these blood parasites.
An ontology for human-like interaction systems

OpenAIRE

Albacete García, Esperanza

2016-01-01

This report proposes and describes the development of a Ph.D. Thesis aimed at building an ontological knowledge model supporting Human-Like Interaction systems. The main function of such knowledge model in a human-like interaction system is to unify the representation of each concept, relating it to the appropriate terms, as well as to other concepts with which it shares semantic relations. When developing human-like interactive systems, the inclusion of an ontological module can be valuab...
Giardia and Cryptosporidium species and genotypes in coyotes (Canis latrans).

Science.gov (United States)

Trout, James M; Santín, Mónica; Fayer, Ronald

2006-06-01

Feces and duodenal scrapings were collected from 22 coyotes (Canis latrans) killed in managed hunts in northeastern Pennsylvania. Polymerase chain reaction (PCR) methods were used to detect Giardia and Cryptosporidium spp. PCR-amplified fragments of Giardia and Cryptosporidium spp. SSU-rRNA genes were subjected to DNA sequence analysis for species/genotype determination. Seven coyotes (32%) were positive for G. duodenalis: three assemblage C, three assemblage D, and one assemblage B. Six coyotes (27%) were positive for Cryptosporidium spp. One isolate shared 99.7% homology with C. muris, whereas five others (23%) shared 100% homology with C. canis, coyote genotype. This is the first report on multiple genotypes of Giardia spp. in coyotes and on the prevalence of Cryptosporidium spp. genotypes in coyotes.
Human conglutinin-like protein

DEFF Research Database (Denmark)

Jensenius, J C; Thiel, S; Baatrup, G

1985-01-01

The presence in human plasma of a molecule homologous to bovine conglutinin is indicated by the results of biological and immunochemical analysis. The human conglutinin-like protein shows calcium-dependent binding to complement-treated solid phase IgG and immunological cross-reaction with chicken...... anti-bovine conglutinin. The binding of the human protein to complement-treated IgG was inhibited by N-acetyl-D-glucosamine but not by other sugars. Analysis by SDS-PAGE and Western blotting showed reaction of anti-conglutinin with molecules of similar mobility to the monomer and hexamer of bovine...
Hepatozoon canis and Leishmania spp. coinfection in dogs diagnosed with visceral leishmaniasis.

Science.gov (United States)

Morgado, Fernanda Nazaré; Cavalcanti, Amanda Dos Santos; Miranda, Luisa Helena de; O'Dwyer, Lúcia Helena; Silva, Maria Regina Lucas da; Menezes, Rodrigo Caldas; Andrade da Silva, Aurea Virgínia; Boité, Mariana Côrtes; Cupolillo, Elisa; Porrozzi, Renato

2016-01-01

This study describes the occurrence of dogs naturally co-infected with Hepatozoon canis and two Leishmania species: L. infantum or L. braziliensis. Four dogs serologically diagnosed with Visceral Leishmaniasis were euthanized. Liver and spleen samples were collected for histopathological analysis and DNA isolation. H. canis meronts were observed in tissues from all four dogs. H. canis infection was confirmed by PCR followed by sequencing of a fragment of 18S rRNA gene. Leishmania detection and typing was confirmed by ITS1' PCR-RFLP and parasite burden was calculated using ssrRNA quantitative qPCR. A DPP - Dual Path platform test was performed. One out (Dog #2) of four animals was asymptomatic. Dogs #1 and #4 were infected by L. infantum and were DPP test positive. Dogs #2 and #3 were infected by L. braziliensis and were DPP test negative. Furthermore, visceral dissemination was observed in Dogs #2 and #3, since L. braziliensis was detected in liver and spleen samples. The visceral dissemination of L. braziliensis associated with systemic signs suggested that this co-infection could influence the parasite burden and disease progression.
NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0952 ref|NP_003851.1| barrier to autointegration factor 1 [Homo sapien...s] ref|NP_892033.1| barrier to autointegration factor 1 [Bos taurus] ref|XP_854776.1| PREDICTED: similar to barrier to autointegratio...n factor 1 [Canis familiaris] ref|XP_001111817.1| PREDICTED: similar to barrier to autointegration...: similar to barrier to autointegration factor 1 isoform 2 [Macaca mulatta] ref|XP_001111884.1| PREDICTED: s...imilar to barrier to autointegration factor 1 isoform 3 [Macaca mulatta] ref|XP_001111924.1| PREDICTED: similar to barrier to autoint
Polar lipid composition of mammalian hair.

Science.gov (United States)

Wix, M A; Wertz, P W; Downing, D T

1987-01-01

The types and amounts of polar lipids from the hair of monkey (Macacca fascicularis), dog (Canis familiaris), pig (Sus scrofa) and porcupine (Erethizon dorsatum) have been determined by quantitative thin-layer chromatography. The polar lipid content of the hair samples ranged from 0.6 to 1.6 wt%. Lipid compositions included ceramides (57-63% of the polar lipid by weight), glycosphingolipids (7-9%) and cholesteryl sulfate (22-29%). Several minor components (4-7%) remain unidentified. The results suggest that cholesteryl sulfate may be an important determinant of the cohesiveness of hair.

Some links on this page may take you to non-federal websites. Their policies may differ from this site.