WorldWideScience

Sample records for canis familiaris gastric

  1. CanisOme--The protein signatures of Canis lupus familiaris diseases.

    Science.gov (United States)

    Fernandes, Mónica; Rosa, Nuno; Esteves, Eduardo; Correia, Maria José; Arrais, Joel; Ribeiro, Paulo; Vala, Helena; Barros, Marlene

    2016-03-16

    Although the applications of Proteomics in Human Biomedicine have been explored for some time now, in animal and veterinary research, the potential of this resource has just started to be explored, especially when companion animal health is considered. In the last years, knowledge on the Canis lupus familiaris proteome has been accumulating in the literature and a resource compiling all this information and critically reviewing it was lacking. This article presents such a resource for the first time. CanisOme is a database of all proteins identified in Canis lupus familiaris tissues, either in health or in disease, annotated with information on the proteins present on the sample and on the donors. This database reunites information on 549 proteins, associated with 63 dog diseases and 33 dog breeds. Examples of how this information may be used to produce new hypothesis on disease mechanisms is presented both through the functional analysis of the proteins quantified in canine cutaneous mast cell tumors and through the study of the interactome of C. lupus familiaris and Leishmania infantum. Therefore, the usefulness of CanisOme for researchers looking for protein biomarkers in dogs and interested in a comprehensive analysis of disease mechanisms is demonstrated. This paper presents CanisOme, a database of proteomic studies with relevant protein annotation, allowing the enlightenment of disease mechanisms and the discovery of novel disease biomarkers for C. lupus familiaris. This knowledge is important not only for the improvement of animal health but also for the use of dogs as models for human health studies. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. [Diphyllobothrium pacificum (Nybelin,1931) margolis, 1956 in Canis familiaris from Chincha city, Peru].

    Science.gov (United States)

    Cabrera, R; Tantaleán, M; Rojas, R

    2001-01-01

    In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast.

  3. Diphyllobothrium pacificum (Nybelin, 1931) Margolis, 1956 en Canis familiaris de la ciudad de Chincha, Perú

    OpenAIRE

    Cabrera, Ch; Tantaleán V, Manuel; Rojas M, Ricardo

    2001-01-01

    In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast

  4. Cross-sectional study of object permanence in domestic puppies (Canis familiaris).

    Science.gov (United States)

    Gagnon, S; Doré, F Y

    1994-09-01

    Visual accommodation and object permanence tests were administered to 70 puppies (Canis familiaris), aged 4 weeks to 9 months. The results showed that understanding of visible displacement problems emerged at the 5th weeks and developed rapidly until the 8th week. Although the search behaviors of older puppies were more flexible, no further significant development was observed between 8 weeks and 9 months. The results on invisible displacement tests suggest that understanding of invisible displacement problems appears around the 1st year in dogs' development.

  5. Life cycle of Hepatozoon canis (Apicomplexa: Adeleorina: Hepatozoidae) in the tick Rhipicephalus sanguineus and domestic dog (Canis familiaris).

    Science.gov (United States)

    Baneth, Gad; Samish, Michael; Shkap, Varda

    2007-04-01

    The life cycle of the apicomplexan protozoon Hepatozoon canis in its natural hosts Rhipicephalus sanguineus (tick) and Canis familiaris (domestic dog) was studied in an experimental infection. Tick nymphs were fed on a naturally infected dog, or they were infected by percutaneous injection of blood. Dogs were inoculated by ingestion of adult ticks containing mature oocysts. Gamonts were in syzygy 24 hr after percutaneous injection of ticks. Early oocysts were detected 96 hr after nymph repletion, and mature oocysts in adult ticks were infective to dogs 40 days postmolt. Merogony was detected in dog bone marrow from 13 days postinoculation (PI) and included meronts containing 20-30 micromerozoites, and a second type with 2-4 macromerozoites. Monozoic cysts were observed in the spleen in conjunction with merogony. Gamontogony with infection of leukocytes by micromerozoites occurred from 26 days PI, and gamont parasitemia, which completed the life cycle, was detected 28 days PI. The length of the life cycle from nymphal attachment to parasitemia in dogs was 81 days. Increased body temperatures were evident from 16 to 27 days PI and paralleled the time of intensive bone marrow merogony. Skeletal pain and recumbency were manifested in 2 dogs. This study further elucidates the life cycle of H. canis and provides a sequential morphologic description of H. canis merogony, gamontogony, and sporogony.

  6. Canis familiaris As a Model for Non-Invasive Comparative Neuroscience.

    Science.gov (United States)

    Bunford, Nóra; Andics, Attila; Kis, Anna; Miklósi, Ádám; Gácsi, Márta

    2017-07-01

    There is an ongoing need to improve animal models for investigating human behavior and its biological underpinnings. The domestic dog (Canis familiaris) is a promising model in cognitive neuroscience. However, before it can contribute to advances in this field in a comparative, reliable, and valid manner, several methodological issues warrant attention. We review recent non-invasive canine neuroscience studies, primarily focusing on (i) variability among dogs and between dogs and humans in cranial characteristics, and (ii) generalizability across dog and dog-human studies. We argue not for methodological uniformity but for functional comparability between methods, experimental designs, and neural responses. We conclude that the dog may become an innovative and unique model in comparative neuroscience, complementing more traditional models. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. The role of oxytocin in the ability of domestic dogs (Canis familiaris) to use human social cues and bond with humans.

    OpenAIRE

    Oliva, Jessica Lee

    2017-01-01

    The domestic dog (Canis familiaris) demonstrates attachment/bonding behaviour towards humans, whilst wolves (Canis lupus) do not. Domestic dogs also use humans’ non-verbal social cues to solve problems better than wolves do, even wolves raised in the same manner as domestic dogs. The neuropeptide oxytocin has been implicated in mammalian bonding and non-verbal intelligence and therefore the oxytocinergic system may have evolved in the dog during domestication in such a manner as to enable the...

  8. Production, crystallization and preliminary X-ray diffraction analysis of the allergen Can f 2 from Canis familiaris

    International Nuclear Information System (INIS)

    Madhurantakam, Chaithanya; Nilsson, Ola B.; Jönsson, Klas; Grönlund, Hans; Achour, Adnane

    2009-01-01

    The recombinant form of the allergen Can f 2 from C. familiaris was produced, isolated and crystallized in two different forms. Preliminary X-ray diffraction analyses are reported for the two crystal forms of Can f 2. The allergen Can f 2 from dog (Canis familiaris) present in saliva, dander and fur is an important cause of allergic sensitization worldwide. Here, the production, isolation, crystallization and preliminary X-ray diffraction analysis of two crystal forms of recombinant Can f 2 are reported. The first crystal form belonged to space group C222, with unit-cell parameters a = 68.7, b = 77.3, c = 65.1 Å, and diffracted to 1.55 Å resolution, while the second crystal form belonged to space group C2, with unit-cell parameters a = 75.7, b = 48.3, c = 68.7 Å, β = 126.5°, and diffracted to 2.1 Å resolution. Preliminary data analysis indicated the presence of a single molecule in the asymmetric unit for both crystal forms

  9. Hyperhidrosis in naïve purpose-bred beagle dogs (Canis familiaris).

    Science.gov (United States)

    Carrier, Catherine A; Seeman, Jennifer L; Hoffmann, Guenther

    2011-05-01

    This case study details the unusual clinical findings in a unique paw-pad disorder that recently emerged among 2 male and 1 female naïve purpose-bred beagle dogs (Canis familiaris) newly received into our facility. During acclimation period physical examinations, the affected dogs demonstrated constantly moist, soft paw pads on all 4 feet. No information was available regarding the epidemiology and pathogenesis of this pad condition in beagle dogs. Here, we report the results of physical examination, clinical chemistry analysis, hematology, histopathology, detailed observations, and novel testing techniques performed during the acclimation period. Histopathology of several sections of affected footpads was compared with that of an age-matched dog with clinically normal paw pads. We describe the morphologic features of a distinctive cutaneous canine footpad condition and discuss the possible differential diagnoses. The histologic and clinical features were most consistent with those of hyperhidrosis; to our knowledge, this report is the first description of hyperhidrosis as a distinct condition in purpose-bred beagle dogs.

  10. [Dog (Canis familiaris) infectivity to Lutzomyia youngi in Trujillo, Venezuela].

    Science.gov (United States)

    Hernández, Dalila; Rojas, Elina; Scorza, José Vicente; Jorquera, Alicia

    2006-10-01

    In Trujillo, Venezuela the prevalence for American tegumentary leishmaniasis (ATL) is 38 per 100,000 inhabitants. In a periurban, rural settlement of the capital city Trujillo, we studied the potential capability of the domestic dog (Canis familiaris) as a source of infection for Lutzomyia youngi, a phlebotomine sand fly species abundant in the study area and whose domestic vectorial activity has been proven. Dogs with dermal lesions suggestive of ATL and parasitological confirmation of infection, were selected for xenodiagnosis by allowing sylvatic phlebotomines from a ATL free area, to feed ad libitum over each animal's entire body surface. The insects' intestinal tracts were dissected 5 days after the blood meal in order to look for flagellate forms. When these were found, parasitological identification was performed by the multiplex-PCR technique. Four hundred and fifty five sand flies engorged over two dogs in three different assays; promastigotes were found in 4 (0.88%) of the specimens on only one occasion. PCR identified DNA of the Leishmania Viannia subgenus. The household dog has the potential of being a domestic risk factor in the ATL transmission cycle.

  11. Communication between domestic dogs (Canis familiaris) and humans: dogs are good learners.

    Science.gov (United States)

    Elgier, Angel M; Jakovcevic, Adriana; Barrera, Gabriela; Mustaca, Alba E; Bentosela, Mariana

    2009-07-01

    Communication involves a wide range of behaviours that animals emit in their daily lives and can take place between different species, as is the case of domestic dogs (Canis familiaris) and humans. Dogs have shown to be successful at following human cues to solve the object choice task. The question is what are the mechanisms involved in these communicative abilities. This article presents a review of studies about the communicative capacities of domestic dogs emphasizing the ones that considered the effect of associative learning upon these skills. In addition, evidence about differences in dogs' performance in following physical or social cues is summarized and two studies where both signals compete are presented here. The obtained results suggest that the training of a colour cue reverses the dogs' preference for the social one. These results are discussed in light of the findings that gave importance to the learning effect, concluding that the dogs fundamentally follow those cues that allowed them to obtain reinforcers in their previous learning history.

  12. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette

    2014-01-01

    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six...

  13. Comparison between lamellar keratoplasties produced by conjunctival pedicle and free corneal autografts. Experimental study in the dog (Canis familiaris - LINNAEUS, 1758

    Directory of Open Access Journals (Sweden)

    José Luiz Laus

    1996-03-01

    Full Text Available A comparative study of conjunctival pedicle and corneal autografts, for experimental healing of superficial keratectomies in dogs (Canis familiaris was performed. It was carried out by using 24 animals, and the technical procedures were analysed according to clinical, histologic and scanning electron microscopy parameters, in early and late postoperative periods. The obtained results are believed to represent feasible methods of proteresis, applied to the healing ophthalmic surgery. There were few, irrelevant differences between the two tested techniques.

  14. Search behavior in various breeds of adult dogs (Canis familiaris): object permanence and olfactory cues.

    Science.gov (United States)

    Gagnon, S; Doré, F Y

    1992-03-01

    Human analog tests of object permanence were administered to various breeds of adult dogs (Canis familiaris). Experiment 1 showed that the performance of terriers, sporting, and working dogs did not differ. Dogs succeeded in solving invisible displacement problems, but performance was lower than in visible displacement tests. Familiarity with the task had some influence because invisible displacement tests were more successful if they were preceded by visible displacement tests. In Experiment 2, odor cues from the target object and the hiding screens were available or were masked. Results confirmed that success was lower in invisible than in visible displacement tests and that these problems were solved on the basis of representation of visual information rather than on the basis of olfactory cues or of local rule learning. Dogs are compared with other species that display Stage 6 object permanence.

  15. Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

    Directory of Open Access Journals (Sweden)

    Llanos Mariana

    2010-10-01

    Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.

  16. Association, inhibition, and object permanence in dogs' (Canis familiaris) spatial search.

    Science.gov (United States)

    Ashton, Rebecca L; De Lillo, Carlo

    2011-05-01

    The relative role of associative processes and the use of explicit cues about object location in search behavior in dogs (Canis familiaris) was assessed by using a spatial binary discrimination reversal paradigm in which reversal conditions featured: (1) a previously rewarded location and a novel location, (2) a previously nonrewarded location and a novel location, or (3) a previously rewarded location and a previously nonrewarded location. Rule mediated learning predicts a similar performance in these different reversal conditions whereas associative learning predicts the worst performance in Condition 3. Evidence for an associative control of search emerged when no explicit cues about food location were provided (Experiment 1) but also when dogs witnessed the hiding of food in the reversal trials (Experiment 2) and when they did so in both the prereversal and the reversal trials (Experiment 3). Nevertheless, dogs performed better in the prereversal phase of Experiment 3 indicating that their search could be informed by the knowledge of the food location. Experiment 4 confirmed the results of Experiments 1 and 2, under a different arrangement of search locations. We conclude that knowledge about object location guides search behavior in dogs but it cannot override associative processes. 2011 APA, all rights reserved

  17. Length of time domestic dogs (Canis familiaris) spend smelling urine of gonadectomised and intact conspecifics.

    Science.gov (United States)

    Riach, Anna C; Asquith, Rachel; Fallon, Melissa L D

    2017-09-01

    Domestic dogs (Canis familiaris) use urine to communicate among themselves, however, it is unknown whether the gonadectomy (neutering or spaying) of a dog affects this communication in anyway. Urine samples from 10 intact and 10 gonadectomised, unfamiliar dogs were presented to 12 tester dogs to sniff under controlled conditions in a pilot study. The amount of time the tester dogs spent sniffing each sample was recorded. Overall, tester dogs were recorded smelling the urine of gonadectomised individuals for a longer time. In addition to the type of urine sample, the result is likely to have been influenced by the sex and status (gonadectomised or intact) of the tester dogs. The observed increase in the length of time spent sniffing urine from gonadectomised individuals could be explained by the tester dogs experiencing more difficulty in gaining information from the urine or facing more confusion while analysing the urine compared to the intact urine they have evolved to smell. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Infectividad del perro (Canis familiaris para Lutzomyia youngi en Trujillo, Venezuela

    Directory of Open Access Journals (Sweden)

    Dalila Hernández

    2006-10-01

    Full Text Available Introducción. En Trujillo, Venezuela, la prevalencia de leishmaniasis tegumentaria americana (LTA es de 38 por 100.000 habitantes. Objetivo. En una localidad periurbana, rural, de la ciudad capital, estudiamos a los perros caseros (Canis familiaris para investigar mediante la técnica de xenodiagnóstico la eventual capacidad para infectar a Lutzomyia youngi, especie flebotomina con actividad vectorial intradomiciliaria comprobada y abundante en el área de estudio. Materiales y métodos. Los perros con lesiones sugestivas de LTA, parasitológicamente diagnosticados, fueron seleccionados para el xenodiagnóstico permitiendo a flebótomos silvestres de una zona libre de LTA alimentarse ad libitum sobre toda la superficie corporal de cada animal, y evidenciar, en disecciones efectuadas a los 5 días post-ingesta, la posible presencia de flagelados en sus tractos digestivos, en cuyo caso, fueron evaluados por la técnica PCR-Multiplex para determinar la identidad del parásito. Resultados. Un total de 455 flebótomos se ingurgitaron sobre dos perros en tres evaluaciones distintas; en una única ocasión, se observaron promastigotes en 4 (0,88% insectos, cuya identificación molecular reveló pertenecían al subgénero Viannia. Conclusión. El perro casero constituye un potencial factor de riesgo intradomiciliario en el ciclo de la LTA.

  19. Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus)

    Science.gov (United States)

    Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...

  20. Diphyllobothrium sp. in Canis familiaris from the subtropical area of Argentina (Puerto Iguazú, Misiones).

    Science.gov (United States)

    Rivero, María R; Motta, Carlos E; Salas, Martín M; Chiaretta, Alicia; Salomón, Oscar D

    2015-01-01

    This paper reports the first finding of Diphyllobothrium sp. eggs in Canis familiaris (domestic dog) from Puerto Iguazú, a subtropical city of Misiones province, Argentina. In 2013, two positive cases of Diphyllobothrium sp. eggs were detected during an annual parasitological survey of dogs. Dog feces were collected in vials containing 10% formalin and processed using Telemann's sedimentation and Sheather's flotation techniques. The two cases were detected in rural areas of the municipality. Since Misiones is not a part of the endemic area of diphyllobothriasis and given the fact that it is located in the three-border area of Argentina, Brazil and Paraguay, we consider this finding of great importance to public health. We stress the need for updating the current knowledge about the life cycle of these parasites considering the range of intermediate and definitive hosts, their zoonotic potential, and the epidemiological situation in non-endemic areas. Copyright © 2015 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  1. Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, M.; Sonne, C.; Jakobsen, Jette

    2010-01-01

    The aim of this study was to examine the plasma, liver, and kidney status of vitamin A (retinol) and vitamin E (-tocopherol) in two groups of Greenland sled dogs (Canis familiaris), with a total number of 16 bitches and 8 pups. The dogs were fed either minke whale (Balaenoptera acuterostrata...... polychlorinated biphenyls [PCB]). Retinol was approximately 18% and -tocopherol 22% higher in the diet of the exposed dogs compared to controls. In adipose tissue, mean of sigma OHC was 92 ng/g lipid weight (lw) and 5005 ng/g lw for all control (n = 12) and exposed dogs (n = 10), respectively. Hepatic retinol...... correlated negatively with sigma-dichlorodiphenyldichloroethane (sigma DDT) and and sigma-polybrominated diphenyl ethers (sigma PBDE) for all exposed animals. A negative correlation between kidney -tocopherol and sigma PCB concentrations was observed, whereas two positive significant correlations were...

  2. The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

    Science.gov (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

    2016-05-01

    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills.

  3. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available dog Canis lupus familiaris Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Canis_lupus..._familiaris_L.png Canis_lupus_familiaris_NL.png Canis_lupus_familiaris_S.png Canis_lupus_familiari...s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp.../taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/tax...onomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...

  4. The status of Demodex cornei: description of the species and developmental stages, and data on demodecid mites in the domestic dog Canis lupus familiaris.

    Science.gov (United States)

    Izdebska, J N; Rolbiecki, L

    2018-03-30

    Demodecosis canina is one of the most important dog parasitoses, but its aetiology is still not well known. There are currently two known species of demodecid mite specific to the domestic dog Canis lupus familiaris Linnaeus, 1758 (Carnivora: Canidae). These are Demodex canis Leydig, 1859 (Acariformes: Demodecidae) and Demodex injai Desch & Hillier, 2003. There have also been many reports of the so-called 'short form', considered to be a separate species functioning under the name Demodex cornei nomen nudum, for which, however, no formal valid description has been documented. Taxonomic analysis of short forms of dog demodecid mites, associated with the stratum corneum, was performed, in line with the taxonomic criteria of Demodecidae systematics. This form was found to be a distinct species with features that differ from those of the other known species of this family. The species, including the adult and immature stages, is described. It is likely that different Demodex species parasitizing the domestic dog may be responsible for differentiated symptoms and different courses of demodecosis. However, the basis for clarifying this issue should be the correct, unambiguous identification of the species causing parasitosis. © 2018 The Royal Entomological Society.

  5. Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species

    DEFF Research Database (Denmark)

    Sonne, Christian; Gustavson, Kim; Eulaers, Igor

    2016-01-01

    The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First...... quotients (RQDD: DD/CDD; RQBR: BR/CBR; ≥1 indicates risk). The results showed that risk quotients for reproductive, immunotoxic and liver histopathological effects were significantly lowest in the control group (p... on body residues (RQBR) (all preproductive and immunotoxic effects while those for liver histopathological effects ranged from 0.7-3.0. PCBs (polychlorinated biphenyls) and chlordanes were the dominant driver behind high immune and reproductive RQs...

  6. Genome-wide identification and analysis of basic helix-loop-helix domains in dog, Canis lupus familiaris.

    Science.gov (United States)

    Wang, Xu-Hua; Wang, Yong; Liu, A-Ke; Liu, Xiao-Ting; Zhou, Yang; Yao, Qin; Chen, Ke-Ping

    2015-04-01

    The basic helix-loop-helix (bHLH) domain is a highly conserved amino acid motif that defines a group of DNA-binding transcription factors. bHLH proteins play essential regulatory roles in a variety of biological processes in animal, plant, and fungus. The domestic dog, Canis lupus familiaris, is a good model organism for genetic, physiological, and behavioral studies. In this study, we identified 115 putative bHLH genes in the dog genome. Based on a phylogenetic analysis, 51, 26, 14, 4, 12, and 4 dog bHLH genes were assigned to six separate groups (A-F); four bHLH genes were categorized as ''orphans''. Within-group evolutionary relationships inferred from the phylogenetic analysis were consistent with positional conservation, other conserved domains flanking the bHLH motif, and highly conserved intron/exon patterns in other vertebrates. Our analytical results confirmed the GenBank annotations of 89 dog bHLH proteins and provided information that could be used to update the annotations of the remaining 26 dog bHLH proteins. These data will provide good references for further studies on the structures and regulatory functions of bHLH proteins in the growth and development of dogs, which may help in understanding the mechanisms that underlie the physical and behavioral differences between dogs and wolves.

  7. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

    Science.gov (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

    2015-10-01

    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.

  8. Dogs' (Canis familiaris) attention to human perception: Influence of breed groups and life experiences.

    Science.gov (United States)

    Heberlein, Marianne T E; Turner, Dennis C; Manser, Marta B

    2017-02-01

    Attending to the perception of others may help individuals gaining information from conspecifics, or help in competitive situations. Dogs (Canis familiaris) are attentive to humans' signals and their attentional state. We investigated whether dogs of different breed groups differ in their ability to pay attention to human's perception, first according to the genetic relatedness between dog breeds, and second according to working style differences. Once dogs had learned to leave forbidden food on the floor, they were confronted with 2 food items to which only they had unrestricted visual access. The owners saw either none or 1 food item through a transparent barrier. Our results showed that dogs pay attention to the perception of humans, whereby differences between breed groups became obvious. Within different genetic groups, ancient and hunting type dogs performed similarly, they were more attentive to their owners' perception than shepherd and the mastiff type dogs. When comparing dogs classified according to their working style, independent workers and family dogs were attentive to the owner's perception, while cooperative workers seemed not. The dogs' choice could not be explained by a general or training induced preference for eating behind an opaque screen, or by an influence of the owner's possible intention to prevent the dog from taking the food item he could see. Our study confirms that dogs are attentive/sensitive to human's perception, but genetic and working style differences among the breeds, as well as dog sport experiences explain part of the variation seen in their performance. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  9. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

    Science.gov (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

    2016-01-01

    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.

  10. Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands.

    Science.gov (United States)

    Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston

    2014-03-01

    Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history.

  11. Quantity discrimination in wolves (Canis lupus

    Directory of Open Access Journals (Sweden)

    Ewelina eUtrata

    2012-11-01

    Full Text Available Quantity discrimination has been studied extensively in different non-human animal species. In the current study, we tested eleven hand-raised wolves (Canis lupus in a two-way choice task. We placed a number of food items (one to four sequentially into two opaque cans and asked the wolves to choose the larger amount. Moreover, we conducted two additional control conditions to rule out non-numerical properties of the presentation that the animals might have used to make the correct choice. Our results showed that wolves are able to make quantitative judgments at the group, but also at the individual level even when alternative strategies such as paying attention to the surface area or time and total amount are ruled out. In contrast to previous canine studies on dogs (Canis familiaris and coyotes (Canis latrans, our wolves’ performance did not improve with decreasing ratio, referred to as Weber’s law. However, further studies using larger quantities than we used in the current setup are still needed to determine whether and when wolves’ quantity discrimination conforms to Weber’s law.

  12. Molecular structure, bioinformatics analysis, expression and bioactivity of BAFF (TNF13B) in dog (Canis familiaris).

    Science.gov (United States)

    Shen, Yuefen; Wang, Shule; Ai, Hongxin; Min, Cui; Chen, Yuqing; Zhang, Shuangquan

    2011-07-15

    B cell activating factor (BAFF), belonging to the tumor necrosis factor (TNF) family, plays an important role in B cell survival, proliferation and differentiation. In the present study, we amplified the cDNA of dog (Canis familiaris) BAFF (designated doBAFF) from spleen by reverse transcription-PCR (RT-PCR) and rapid amplification of cDNA ends (RACE) strategies. The open reading frame (ORF) of doBAFF covers 879 bp encoding 292 amino acids, with a 152-aa mature peptide. The soluble mature part of doBAFF (dosBAFF) shares 91.5%, 72.1%, 96.7%, 94.0% and 91.5% identity with the human, mouse, cattle, pig and rabbit counterparts, respectively. The predicted three-dimensional (3D) structural analysis of dosBAFF analyzed by "comparative protein modeling" revealed that it was very similar to its human counterpart. Real-time quantitative PCR analysis revealed that doBAFF was mainly expressed in spleen. Two fusion proteins SUMO-dosBAFF and GFP/dosBAFF were efficiently expressed in Escherichia coli BL21 (DE3) and purified using metal chelate affinity chromatography (Ni-NTA). Laser scanning confocal microscopy analysis showed that GFP/dosBAFF could bind to the mouse splenic B-cell. In vitro, SUMO-dosBAFF and GFP/dosBAFF were able to promote the survival/proliferation of dog lymphocytes or mouse splenic B cells with/without anti-IgM. Therefore, BAFF may be a potential immunologic factor for enhancing immunological efficacy in dog. Copyright © 2011 Elsevier B.V. All rights reserved.

  13. Aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus- PI e região metropolitana do Recife- PE, Brasil.

    OpenAIRE

    Jamile Prado dos Santos

    2010-01-01

    A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania infantum a qual é relatada em várias regiões. O objetivo desta pesquisafoi verificar aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus PI e Região Metropolitana de Recife - PE, Brasil. Cães do município de Bom Jesus, Piauí, e do bairro de Muribeca, município de Jaboatão dos Guararapes, Pernambuco...

  14. Practice makes perfect: familiarity of task determines success in solvable tasks for free-ranging dogs (Canis lupus familiaris).

    Science.gov (United States)

    Bhattacharjee, Debottam; Dasgupta, Sandipan; Biswas, Arpita; Deheria, Jayshree; Gupta, Shreya; Nikhil Dev, N; Udell, Monique; Bhadra, Anindita

    2017-07-01

    Domestic dogs' (Canis lupus familiaris) socio-cognitive faculties have made them highly sensitive to human social cues. While dogs often excel at understanding human communicative gestures, they perform comparatively poorly in problem-solving and physical reasoning tasks. This difference in their behaviour could be due to the lifestyle and intense socialization, where problem solving and physical cognition are less important than social cognition. Free-ranging dogs live in human-dominated environments, not under human supervision and are less socialized. Being scavengers, they often encounter challenges where problem solving is required in order to get access to food. We tested Indian street dogs in familiar and unfamiliar independent solvable tasks and quantified their persistence and dependence on a novel human experimenter, in addition to their success in solving a task. Our results indicate that free-ranging dogs succeeded and persisted more in the familiar task as compared to the unfamiliar one. They showed negligible amount of human dependence in the familiar task, but showed prolonged gazing and considerable begging behaviour to the human experimenter in the context of the unfamiliar task. Cognitive abilities of free-ranging dogs thus play a pivotal role in determining task-associated behaviours based on familiarity. In addition to that, these dogs inherently tend to socialize with and depend on humans, even if they are strangers. Our results also illustrate free-ranging dogs' low competence at physical cognitive tasks.

  15. Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris?

    Directory of Open Access Journals (Sweden)

    Sara C Owczarczak-Garstecka

    Full Text Available Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts. There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as 'relaxed' across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect.

  16. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  17. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  18. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  20. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme

    2016-06-01

    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  1. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  2. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  4. NCBI nr-aa BLAST: CBRC-TTRU-01-1025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1025 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 95% ...

  5. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  6. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  7. "Wolves (Canis lupus) and dogs (Canis familiaris) differ in following human gaze into distant space but respond similar to their packmates' gaze": Correction to Werhahn et al. (2016).

    Science.gov (United States)

    2017-02-01

    Reports an error in "Wolves ( Canis lupus ) and dogs ( Canis familiaris ) differ in following human gaze into distant space but respond similar to their packmates' gaze" by Geraldine Werhahn, Zsófia Virányi, Gabriela Barrera, Andrea Sommese and Friederike Range ( Journal of Comparative Psychology , 2016[Aug], Vol 130[3], 288-298). In the article, the affiliations for the second and fifth authors should be Wolf Science Center, Ernstbrunn, Austria, and Comparative Cognition, Messerli Research Institute, University of Veterinary Medicine Vienna/ Medical University of Vienna/University of Vienna. The online version of this article has been corrected. (The following abstract of the original article appeared in record 2016-26311-001.) Gaze following into distant space is defined as visual co-orientation with another individual's head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills

  8. Arterial supply to the stomach of indigenous dog (Canis familiaris) in Bangladesh.

    Science.gov (United States)

    Awal, M A; Asaduzzaman, M; Anam, M K; Prodhan, M A; Kurohmaru, M

    2001-07-01

    Arterial supply to the stomach of dogs indigenous to Bangladesh was investigated by using latex. The hepatic, left gastric and splenic arteries sent their major branches to the stomach. The cranial and caudal branches of the left gastric artery supplied the lesser curvature of the stomach. The right gastric, and right and left gastroepiploic arteries also sent their branches to both the lesser and greater curvatures. Six or seven short gastric arteries from the splenic artery supplied the greater curvature. Anastomoses between the left and right gastric, between the left and right gastroepiploic, and between short gastric arteries and left gastric arteries were observed.

  9. Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris)

    Science.gov (United States)

    Dubey, J. P.; Sykes, J. E.; Shelton, G. D.; Sharp, N.; Verma, S. K.; Calero-Bernal, R.; Viviano, J.; Sundar, N.; Khan, A.; Grigg, M. E.

    2014-01-01

    There are several reports of Sarcocystis sarcocysts in muscles of dogs but these species have not been named. Additionally, there are 2 reports of Sarcocystis neurona in dogs. Here, we propose 2 new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in 4 domestic dogs (Canis familiaris), 1 each from Montana and Colorado in the USA, and 2 from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy, and PCR. Based on collective results 2 new species, Sarcocystis caninum and Sarcocystis svanai were designated. Sarcocystis caninum and Sarcocystis svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By transmission electron microscopy (TEM), the sarcocyst wall “type 9”, 1–2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7–9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were “type 1”, thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multi-locus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to S. canis or S. arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica

  10. Physiological, physical and behavioural changes in dogs (Canis familiaris) when kennelled: testing the validity of stress parameters.

    Science.gov (United States)

    Part, C E; Kiddie, J L; Hayes, W A; Mills, D S; Neville, R F; Morton, D B; Collins, L M

    2014-06-22

    Domestic dogs (Canis familiaris) housed in kennelling establishments are considered at risk of suffering poor welfare. Previous research supporting this hypothesis has typically used cortisol:creatinine ratios (C/Cr) to measure acute and chronic stress in kennelled dogs. However, the value of C/Cr as a welfare indicator has been questioned. This study aimed to test the validity of a range of physiological, physical and behavioural welfare indicators and to establish baseline values reflecting good dog welfare. Measurements were taken from 29 privately-owned dogs (14 males, 15 females), ranging in age and breed, in their own home and in a boarding kennel environment, following a within-subjects, counterbalanced design. Pairwise comparisons revealed that C/Cr and vanillylmandelic acid:creatinine ratios (VMA/Cr) were higher in the kennel than home environment (P=0.003; P=0.01, respectively) and were not associated with differences in movement/exercise between environments. Dogs' surface temperature was lower in kennels (P=0.001) and was not associated with ambient temperature. No association with age, or effects of kennel establishment, kennelling experience, sex or source were found. Dogs were generally more active in kennels, but showed considerable individual variability. C/Cr and 5-HIAA:creatinine ratios (5-HIAA/Cr) were negatively correlated with lip licking in kennels. Baseline values for each parameter are presented. The emotional valence of responses was ambiguous and no definitive evidence was found to suggest that dogs were negatively stressed by kennelling. It was concluded that C/Cr and, particularly, VMA/Cr and surface temperature provide robust indicators of psychological arousal in dogs, while spontaneous behaviour might be better used to facilitate interpretation of physiological and physical data on an individual level. Copyright © 2014 Elsevier Inc. All rights reserved.

  11. NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...

  12. Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

    Science.gov (United States)

    Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

    2017-04-01

    Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.

    2013-07-01

    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  14. Pathogenic strains of Yersinia enterocolitica isolated from domestic dogs (Canis familiaris) belonging to farmers are of the same subtype as pathogenic Y. enterocolitica strains isolated from humans and may be a source of human infection in Jiangsu Province, China.

    Science.gov (United States)

    Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

    2010-05-01

    We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections.

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-1644 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1644 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-89 51% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0057 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 3e-50 57% ...

  17. NCBI nr-aa BLAST: CBRC-GACU-23-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0003 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 5e-27 29% ...

  18. NCBI nr-aa BLAST: CBRC-PMAR-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0195 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-82 63% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-1330 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1330 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-11 37% ...

  20. NCBI nr-aa BLAST: CBRC-TSYR-01-0849 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0849 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-1207 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1207 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...

  2. NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...

  3. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-2527 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2527 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 1e-165 73% ...

  5. NCBI nr-aa BLAST: CBRC-GGOR-01-1250 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1250 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-119 80% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  8. Pathogenic Strains of Yersinia enterocolitica Isolated from Domestic Dogs (Canis familiaris) Belonging to Farmers Are of the Same Subtype as Pathogenic Y. enterocolitica Strains Isolated from Humans and May Be a Source of Human Infection in Jiangsu Province, China ▿ ‡

    Science.gov (United States)

    Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

    2010-01-01

    We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections. PMID:20181899

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-1145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1145 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 93% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-01-0341 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0341 ref|NP_001121658.1| zinc finger protein, multitype 2 [Canis lupus... familiaris] gb|ACD67898.1| zinc finger multitype protein 2 [Canis lupus familiaris] NP_001121658.1 1.8 24% ...

  11. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-02-0484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0484 ref|NP_001003250.1| fucosidase, alpha-L-1, tissue [Canis lupus fa...miliaris] gb|AAB17403.1| alpha-L-fucosidase [Canis lupus familiaris] NP_001003250.1 2e-52 67% ...

  13. NCBI nr-aa BLAST: CBRC-MDOM-08-0152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0152 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-108 63% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-2639 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2639 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 2e-99 60% ...

  15. NCBI nr-aa BLAST: CBRC-TSYR-01-1218 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1218 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-126 70% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  17. NCBI nr-aa BLAST: CBRC-PVAM-01-1620 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1620 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 0.0 82% ...

  18. NCBI nr-aa BLAST: CBRC-ETEL-01-0643 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0643 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-131 95% ...

  19. NCBI nr-aa BLAST: CBRC-FCAT-01-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0019 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-121 96% ...

  20. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-08-0147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0147 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-108 63% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-0228 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0228 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 7e-79 54% ...

  3. NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0391 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-79 50% ...

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2734 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2734 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-164 80% ...

  5. NCBI nr-aa BLAST: CBRC-MMUR-01-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0046 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 5e-46 41% ...

  6. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1165 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-101 60% ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0554 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0554 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-117 67% ...

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-0608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0608 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 7e-64 52% ...

  10. NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0278 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 8e-55 51% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-0170 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0170 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 3e-78 54% ...

  12. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  13. NCBI nr-aa BLAST: CBRC-MLUC-01-0328 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0328 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-129 75% ...

  14. NCBI nr-aa BLAST: CBRC-VPAC-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1055 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 74% ...

  15. NCBI nr-aa BLAST: CBRC-VPAC-01-1382 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1382 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-137 80% ...

  16. NCBI nr-aa BLAST: CBRC-GGOR-01-0684 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0684 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-170 84% ...

  17. NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0131 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 3e-69 47% ...

  18. NCBI nr-aa BLAST: CBRC-MEUG-01-2581 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2581 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-156 78% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-08-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0130 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-66 45% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-1474 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1474 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 0.0 96% ...

  1. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-0718 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0718 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 3e-76 59% ...

  3. NCBI nr-aa BLAST: CBRC-PCAP-01-1451 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1451 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-109 62% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-1789 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1789 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-48 36% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0058 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-118 75% ...

  6. NCBI nr-aa BLAST: CBRC-MDOM-08-0126 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0126 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-64 45% ...

  7. NCBI nr-aa BLAST: CBRC-STRI-01-1421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1421 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 6e-85 54% ...

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-08-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0135 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 2e-80 52% ...

  10. NCBI nr-aa BLAST: CBRC-VPAC-01-1389 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1389 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-125 71% ...

  11. NCBI nr-aa BLAST: CBRC-OPRI-01-0578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0578 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-85 53% ...

  12. NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0391 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-83 50% ...

  13. NCBI nr-aa BLAST: CBRC-PCAP-01-0158 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0158 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-69 61% ...

  14. NCBI nr-aa BLAST: CBRC-VPAC-01-1534 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1534 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-126 75% ...

  15. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  16. NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0278 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-77 66% ...

  17. NCBI nr-aa BLAST: CBRC-OPRI-01-0830 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0830 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 1e-105 76% ...

  18. NCBI nr-aa BLAST: CBRC-PVAM-01-1154 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1154 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-151 85% ...

  19. NCBI nr-aa BLAST: CBRC-GGOR-01-0152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0152 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 4e-57 49% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-2514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2514 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 6e-61 42% ...

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1005 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-104 64% ...

  2. NCBI nr-aa BLAST: CBRC-MMUR-01-0468 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0468 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-51 49% ...

  3. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  4. NCBI nr-aa BLAST: CBRC-MMUR-01-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0025 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 3e-72 67% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0943 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0943 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-92 59% ...

  7. NCBI nr-aa BLAST: CBRC-MEUG-01-1669 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1669 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-70 48% ...

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-0906 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0906 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-122 76% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-1197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1197 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-48 50% ...

  10. NCBI nr-aa BLAST: CBRC-MMUR-01-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0048 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-136 85% ...

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  12. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  13. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  16. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  18. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  2. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  3. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  8. NCBI nr-aa BLAST: CBRC-GGOR-01-0806 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0806 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-175 99% ...

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-1301 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1301 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-180 92% ...

  10. Helminths parasites of stray dogs (Canis lupus familiaris from Cuiabá, Midwestern of Brazil

    Directory of Open Access Journals (Sweden)

    Dirceu Guilherme de Souza Ramos

    2015-04-01

    Full Text Available Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest region of Brazil. A total of 100 animals, from the Center for Zoonosis Control of Cuiabá were euthanized and necropsied for helminth searching. Overall 8,217 helminths were found in 85 animals identified in six species: Ancylostoma caninum, Ancylostoma. braziliense, Trichuris vulpis, Toxocara canis, Dirofilaria immitis and Dipylidium caninum. It was evidenced the wide distribution of helminths pathogenic to domestic dogs and especially with zoonotic potential as A. caninum, T. canis, D. caninum and D. immitis. The presence of D. immitis is an important finding, since it is a potentially zoonotic agent, however, this finding is considered sporadic.

  11. NCBI nr-aa BLAST: CBRC-ETEL-01-0405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ters), member 2 [Canis lupus familiaris] gb|ABV32554.1| solute carrier family 23 member 2 [Canis lupus familiaris] NP_001103426.1 1e-177 91% ... ...CBRC-ETEL-01-0405 ref|NP_001103426.1| solute carrier family 23 (nucleobase transpor

  12. NCBI nr-aa BLAST: CBRC-CFAM-21-0168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-21-0168 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 0.0 99% ...

  13. [Genetic analysis and estimation of genetic diversity in east-European breeds of swift hounds (Canis familiaris L.) based on the data of genomic studies using RAPD markers].

    Science.gov (United States)

    Semenova, S K; Illarionova, N A; Vasil'ev, V A; Shubkina, A V; Ryskov, A P

    2002-06-01

    The method of polymerase chain reaction with a set of arbitrary primers (RAPD-PCR) was used to describe genetic variation and to estimate genetic diversity in East-European swift hounds, Russian Psovyi and Hortyi Borzois. For comparison, swift hounds of two West-European breeds (Whippet and Greyhound) and single dogs of other breed groups (shepherd, terriers, mastiffs, and bird dogs) were examined. For all dog groups, their closest related species, the wolf Canis lupus, was used as an outgroup. Variation of RAPD markers was studied at several hierarchic levels: intra- and interfamily (for individual families of Russian Psovyi and Hortyi Borzois), intra- and interbreed (for ten dog breeds), and interspecific (C. familiaris-C. lupus). In total, 57 dogs and 4 wolfs were studied. Using RAPD-PCR with three primers, 93 DNA fragments with a length of 150-1500 bp were detected in several Borzoi families with known filiation. These fragments were found to be inherited as dominant markers and to be applicable for estimation of genetic differences between parents and their offspring and for comparison of individuals and families with different level of inbreeding. A high level of intra- and interbreed variation was found in Russian Psovyi and Hortyi Borzois. In these dog groups, genetic similarity indices varied in a range of 72.2 to 93.4% (parents-offspring) and 68.0 to 94.5 (sibs). Based on the patterns of RAPD markers obtained using six primers, a dendrogram of genetic similarity between the wolf and different dog breeds was constructed, and indices of intragroup diversity were calculated. All studied breeds were found to fall into two clusters, swift hounds (Borzoi-like dogs) and other dogs. Russian Borzois represent a very heterogeneous group, in which the Russian Psovyi Borzoi is closer to Greyhound than the Russian Hortyi Borzoi. All studied wolfs constituted a separate cluster. Significant differences were found between the wolf and dogs by the number of RAPD markers

  14. NCBI nr-aa BLAST: CBRC-DNOV-01-1669 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1669 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 82% ...

  15. NCBI nr-aa BLAST: CBRC-VPAC-01-1462 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1462 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-156 91% ...

  16. NCBI nr-aa BLAST: CBRC-BTAU-01-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0139 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  17. NCBI nr-aa BLAST: CBRC-CFAM-21-0167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-21-0167 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 81% ...

  18. NCBI nr-aa BLAST: CBRC-TBEL-01-1358 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1358 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 4e-78 82% ...

  19. NCBI nr-aa BLAST: CBRC-FCAT-01-0606 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0606 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-169 90% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  1. NCBI nr-aa BLAST: CBRC-PABE-12-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-12-0119 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-151 81% ...

  2. NCBI nr-aa BLAST: CBRC-MMUS-07-0511 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0511 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 77% ...

  3. NCBI nr-aa BLAST: CBRC-MMUR-01-0982 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0982 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-159 86% ...

  4. NCBI nr-aa BLAST: CBRC-CPOR-01-1299 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1299 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-108 63% ...

  5. NCBI nr-aa BLAST: CBRC-OGAR-01-1197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-162 85% ...

  6. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  7. NCBI nr-aa BLAST: CBRC-DNOV-01-0947 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0947 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  8. NCBI nr-aa BLAST: CBRC-LAFR-01-3219 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3219 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  9. NCBI nr-aa BLAST: CBRC-TSYR-01-0801 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0801 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 79% ...

  10. NCBI nr-aa BLAST: CBRC-PHAM-01-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0106 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-142 80% ...

  11. NCBI nr-aa BLAST: CBRC-BTAU-01-2138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2138 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-121 68% ...

  12. NCBI nr-aa BLAST: CBRC-CFAM-21-0169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-21-0169 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-170 91% ...

  13. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  14. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  15. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  16. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  18. Image collection: 19 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 19 Canis_lupus_familiaris_NL.png イエイヌ Domestic dogs Canis lupus familiaris 9615 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,ネコ目

  19. NCBI nr-aa BLAST: CBRC-STRI-01-2590 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2590 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 3e-44 56% ...

  20. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  1. NCBI nr-aa BLAST: CBRC-MLUC-01-0191 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0191 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 2e-87 75% ...

  2. NCBI nr-aa BLAST: CBRC-DNOV-01-2463 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2463 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-163 76% ...

  3. NCBI nr-aa BLAST: CBRC-CFAM-32-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-32-0002 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-129 69% ...

  4. First molecular identification of Echinococcus vogeli and Echinococcus granulosus (sensu stricto) G1 revealed in feces of domestic dogs (Canis familiaris) from Acre, Brazil.

    Science.gov (United States)

    das Neves, Leandro Batista; Teixeira, Paulo Eduardo Ferlini; Silva, Sidnei; de Oliveira, Fernanda Bittencourt; Garcia, Daniel Daipert; de Almeida, Fernanda Barbosa; Rodrigues-Silva, Rosângela; Machado-Silva, José Roberto

    2017-01-14

    Echinococcus granulosus (sensu lato) (s.l.) and Echinococcus vogeli are causative agents of chronic zoonotic diseases such as cystic and polycystic echinococcosis, respectively. In Brazil, polycystic echinococcosis has a restricted geographical distribution in the North Region, while cystic echinococcosis is observed in the South Region. Domestic dogs (Canis familiaris) fed with raw viscera represent a risk factor for E. granulosus (s.l.) infection in the South Region. Although this practice is frequent, it remains unclear whether domestic dogs are infected with E. vogeli in the state of Acre, located in the Amazon basin in the North Region of Brazil. The aim of this study was to investigate this gap in the polycystic echinococcosis epidemiology. Sixty-five fecal samples were collected from the ground in five municipalities (Sena Madureira, n = 14; Rio Branco, n = 06; Bujari, n = 06; Xapuri, n = 30; and Epitaciolândia, n = 09) located in the state of Acre, northern Brazil. The samples were screened for parasites by copro-PCR using the cox1 gene associated with automated sequencing. Echinococcus vogeli was molecularly confirmed in a sample from Sena Madureira and E. granulosus (sensu stricto) (s.s.) (G1) in a sample from Rio Branco. These findings indicate that molecular assays are useful in typing Echinococcus taxa from fecal samples of dogs in northern Brazil. The present study is the first molecular record of E. vogeli in domestic dogs found in the state of Acre, reinforcing their role as a source of infection for humans. Because E. granulosus (s.s.) (G1) was detected for the first time in the North Region, from the epidemiological standpoint this finding is highly relevant, because it expands the known geographical distribution, which was previously restricted to the South Region of Brazil.

  5. Molecular detection of Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli in stray dogs in Mahasarakham province, Thailand.

    Science.gov (United States)

    Piratae, Supawadee; Pimpjong, Kiattisak; Vaisusuk, Kotchaphon; Chatan, Wasupon

    2015-01-01

    Canine tick borne diseases showing distribution worldwide have caused morbidity and mortality in dogs. This study observed the mainly tick borne pathogens described for dogs in Thailand, Ehrlichia canis, Hepatozoon canis and Babesia canis vogeli. From May to July 2014, blood samples were collected from 79 stray dogs from 7 districts of Mahasarakham province to molecular surveyed for 16s rRNA gene of E. canis and 18s rRNA gene of H. canis and B. canis vogeli. Twenty eight (35.44%) of stray dogs showed the infection with tick borne pathogens. The prevalence of E. canis infection was the highest with 21.5% (17/79). DNA of H. canis and B. canis vogeli were detected at the prevalence of 10.1% (8/79) and 6.3% (5/79), respectively. Co-infection between E. canis and B. canis vogeli were identified in 2 (2.5%) dogs. The results indicated that a wide range of tick borne pathogens are circulation in the canine population in Mahasarakham province. This study is the first report on prevalence of E. canis, H. canis and B. canis vogeli in stray dogs in Mahasarakham, a province in northern part of Thailand. This data providing is important to understand the prevalence of E. canis, H. canis and B. canis vogeli infection in stray dogs in this region, which will assist in the management of these blood parasite.

  6. Evaluation of a rapid immunochromatographic dipstick test for detection of antibodies to Trypanosoma cruzi in dogs experimentally infected with isolates obtained from opossums (Didelphis virginiana), armadillos (Dasypus novemcinctus), and dogs (Canis familiaris) from the United States.

    Science.gov (United States)

    Rosypal, Alexa C; Hill, Roderick; Lewis, Samantha; Barr, Stephen C; Valadas, Samantha; Gennari, Solange Maria; Lindsay, David S

    2011-02-01

    Dogs are reservoir hosts for Trypanosoma cruzi , the causative agent of American trypanosomiasis. A rapid immunochromatographic dipstick test (ICT) is available commercially for canine serological testing. The ICT was developed with the use of sera from South American dogs, but it is not routinely used in the United States. We evaluated the utility of the ICT in detecting anti-T. cruzi antibodies in dogs from the United States. Dogs (N  =  64) were experimentally infected with United States' isolates of T. cruzi from an opossum (Didelphis virginiana), an armadillo (Dasypus novemcinctus), and a domestic dog (Canis familiaris), and were tested after experimental infection. Sera from uninfected United States dogs (n  =  79; hemaculture negative) were used as negative controls. In a blind study, sera were tested by the ICT and compared to the indirect immunofluorescent antibody test with the use of Brazil-strain epimastigotes as antigen. The sensitivity of the ICT was 91% and the specificity was 98% in dogs experimentally infected with United States isolates. Our study indicates that the ICT could be a useful screening tool for serological surveillance of canine T. cruzi exposure in the United States.

  7. Memory-Based Quantity Discrimination in Coyotes (Canis latrans

    Directory of Open Access Journals (Sweden)

    Salif Mahamane

    2014-08-01

    Full Text Available Previous research has shown that the ratio between competing quantities of food significantly mediates coyotes‘ (Canis latrans ability to choose the larger of two food options. These previous findings are consistent with predictions made by Weber‘s Law and indicate that coyotes possess quantity discrimination abilities that are similar to other species. Importantly, coyotes‘ discrimination abilities are similar to domestic dogs (Canis lupus familiaris, indicating that quantitative discrimination may remain stable throughout certain species‘ evolution. However, while previously shown in two domestic dogs, it is unknown whether coyotes possess the ability to discriminate visual quantities from memory. Here, we address this question by displaying different ratios of food quantities to 14 coyotes before placing the choices out of sight. The coyotes were then allowed to select one of either non-visible food quantities. Coyotes‘ discrimination of quantity from memory does not follow Weber‘s Law in this particular task. These results suggest that working memory in coyotes may not be adapted to maintain information regarding quantity as well as in domestic dogs. The likelihood of a coyote‘s choosing the large option increased when it was presented with difficult ratios of food options first, before it was later presented with trials using more easily discriminable ratios, and when the large option was placed on one particular side. This suggests that learning or motivation increased across trials when coyotes experienced difficult ratios first, and that location of food may have been more salient in working memory than quantity of food.

  8. 'Candidatus mycoplasma haemodidelphidis' sp. nov., 'Candidatus mycoplasma haemolamae' sp. nov. and Mycoplasma haemocanis comb. nov., haemotrophic parasites from a naturally infected opossum (Didelphis virginiana), alpaca (Lama pacos) and dog (Canis familiaris): phylogenetic and secondary structural relatedness of their 16S rRNA genes to other mycoplasmas.

    Science.gov (United States)

    Messick, Joanne B; Walker, Pamela G; Raphael, William; Berent, Linda; Shi, Xun

    2002-05-01

    The 16S rRNA sequence of newly characterized haemotrophic bacteria in an opossum (Didelphis virginiana) and alpaca (Lama pacos) was determined. In addition, the 16S rRNA sequence of a haemotrophic parasite in the dog (Canis familiaris) was determined. Sequence alignment and evolutionary analysis as well as secondary structural similarity and signature nucleotide sequence motifs of their 16S rRNA genes, positioned these organisms in the genus Mycoplasma. The highest scoring sequence similarities were 16S rRNA genes from haemotrophic mycoplasma species (Haemobartonella and Eperythrozoon spp.). However, the lack of several higher-order structural idiosyncrasies used to define the pneumoniae group, suggests that these organisms and related haemotrophic mycoplasmas represent a new group of mycoplasmas. It is recommended that the organisms be named 'Candidatus Mycoplasma haemodidelphidis', 'Candidatus Mycoplasma haemolamae' and Mycoplasma haemocanis comb. nov., to provide some indication of the target cell and host species of these parasites, and to reflect their phylogenetic affiliation.

  9. Immunological inquiry for the epidemiology of leptospirosis in Canis familiaris in Salvador, Bahia, Brazil.

    Science.gov (United States)

    Caldas, E M; Doria, J D; Martins, M A

    1977-12-01

    A total of 430 dogs were immunologically examined in Salvador, Bahia, Brazil, and 21.6% of them were positive. The animals were selected through an aleatory pattern, according to the division of the City in 18 residential zones a division which had been established by the vaccination campaign against canis hydrophobia. The serotypes icterohemorrhagiae and canicola were the most frequently registered. Between the sexes, the male presented the highest index of positivity, though the difference wasn't statistically significant. The period of age ranging from 12 to 48 months comprised 67.7% of the investigations. Mestizo dogs presented a higher frequency of positivity than any other race and the areas of Nordeste de Amaralina, Liberdade and Quintas showed the greatest percentages of positive dogs.

  10. Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, em cães de Minas Gerais, Brasil Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, in dogs of Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Walter dos Santos Lima

    1985-06-01

    Full Text Available Foi identificado Angiostrongylus vasorum (Baillet, 1866 colhido da artéria pulmonar de dois cães (Canis familiaris procedentes do município de Caratinga, Estado de Minas Gerais, Brasil. É apresentada a descrição morfológicas do parasita. Esta é a primeira referência desse parasita no Estado de Minas Gerais.For the first time Angiostrongylus vasorum in Canis familiaris in Minas Gerais State, Brazil, is described. The description and measurements of three males and ten females are presented together with a diagram of the parasite.

  11. Spatially-explicit modelling model for assessing wild dog control strategies in Western Australia

    Science.gov (United States)

    Large predators can significantly impact livestock industries. In Australia, wild dogs (Canis lupus familiaris, Canis lupus dingo, and hybrids) cause economic losses of more than AUD $40M annually. Landscape-scale exclusion fencing coupled with lethal techniques is a widely pract...

  12. Prevalence of Ehrlichia canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, Bartonella vinsonii berkhoffii, and Rickettsia spp. in dogs from Grenada.

    Science.gov (United States)

    Yabsley, Michael J; McKibben, John; Macpherson, Calum N; Cattan, Peggy F; Cherry, Natalie A; Hegarty, Barbara C; Breitschwerdt, Edward B; O'Connor, Tom; Chandrashekar, Ramaswamy; Paterson, Tara; Perea, Marta Lanza; Ball, Geoffrey; Friesen, Stanley; Goedde, Jill; Henderson, Brooke; Sylvester, Wayne

    2008-02-14

    To identify the tick-borne pathogens in dogs from Grenada, we conducted a serologic survey for Ehrlichia canis in 2004 (104 dogs) and a comprehensive serologic and molecular survey for a variety of tick-borne pathogens in 2006 (73 dogs). In 2004 and 2006, 44 and 32 dogs (42.3% and 43.8%) were seropositive for E. canis, respectively. In 2006, several tick-borne pathogens were identified by serology and PCR. DNA of E. canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, and Bartonella sp. were identified in 18 (24.7%), 14 (19.2%), 5 (7%), 5 (7%), and 1 (1.4%) dogs, respectively. Six (8.2%) dogs were seropositive for Bartonella vinsonii subsp. berkhoffii. All dogs were seronegative and PCR-negative for Rickettsia spp. Coinfection with two or three pathogens was observed in eight dogs. Partial 16S rRNA E. canis and A. platys sequences were identical to sequences in GenBank. Partial 18S rRNA gene sequences from the Grenadian H. canis were identical to each other and had one possible mismatch (ambiguous base) from H. canis detected from Spain and Brazil. Grenadian B. c. vogeli sequences were identical to B. c. vogeli from Brazil and Japan. All of the detected pathogens are transmitted, or suspected to be transmitted, by Rhipicephalus sanguineus. Results of this study indicate that dogs from Grenada are infected with multiple tick-borne pathogens; therefore, tick-borne diseases should be included as differentials for dogs exhibiting thrombocytopenia, leukopenia, fever, or lethargy. One pathogen, E. canis, is also of potential public health significance.

  13. La gender diversity nelle aziende familiari italiane: Una risorsa da valorizzare

    OpenAIRE

    D. Montemerlo; P. Profeta

    2009-01-01

    Questo articolo ha per oggetto la diversity relazionale di genere nelle imprese familiari italiane di medie e grandi dimensioni, misurata in termini di presenza femminile. Qual è lo stato effettivo della diversity di genere nelle aziende familiari medie e grandi, con riguardo non solo alle posizioni di imprenditore – capo azienda ma anche agli altri ruoli chiave della proprietà, del consiglio di amministrazione e del top management? La diversity di genere varia in funzione di caratteris...

  14. Mixed Ehrlichia canis, Hepatozoon canis, and presumptive Anaplasma phagocytophilum infection in a dog.

    Science.gov (United States)

    Mylonakis, Mathio E; Koutinas, Alex F; Baneth, Gad; Polizopoulou, Zoe; Fytianou, Anna

    2004-01-01

    A 5-month-old, female, mongrel dog was admitted to the Clinic of Companion Animal Medicine, Aristotle University of Thessaloniki, Greece, with depression, anorexia, fever, peripheral lymphadenopathy, splenomegaly, oculonasal discharge, nonregenerative anemia, and mild thrombocytopenia. Cytology of Giemsa-stained buffy coat, bone marrow, and lymph node aspiration smears revealed numerous morulae in mononuclear leukocytes and in neutrophils, and Hepatozoon canis gamonts in neutrophils. The dog was seropositive to Ehrlichia canis (immunofluorescence assay [IFA]) and Hepatozoon canis (ELISA) but not to Anaplasma phagocytophilum (IFA). A nested polymerase chain reaction performed on bone marrow aspirates was positive for E canis. This method was not applied for the detection of A phagocytophilum. Treatment with doxycycline and imidocarb dipropionate resulted in both clinical and parasitologic cure. This is the first reported case of a mixed infection with E canis, H canis, and presumptive A phagocytophilum. The findings emphasize the value of cytology in offering a quick and inexpensive diagnosis in mixed tick-borne infections of dogs.

  15. Canine vector-borne co-infections: Ehrlichia canis and Hepatozoon canis in the same host monocytes.

    Science.gov (United States)

    Baneth, Gad; Harrus, Shimon; Gal, Arnon; Aroch, Itamar

    2015-02-28

    The protozoon Hepatozoon canis and the rickettsia Ehrlichia canis are tick-borne pathogens, transmitted by Rhipicephalus sanguineus, which cause canine hepatozoonosis and canine monocytic ehrlichiosis, respectively. Co-infection of the same host monocytes with H. canis and E. canis confirmed by molecular characterization of the infecting agents and quantitative assessment of co-infected cells is described for the first time in three naturally-infected dogs. Blood smear evaluation indicated that at least 50% of the leukocytes infected with H. canis gamonts contained E. canis morulae. Co-infection of the same host cell demonstrated in this report suggests that infection with one pathogen may permit or enhance invasion or prolonged cellular survival of the other. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris).

    Science.gov (United States)

    Meyers-Wallen, Vicki N; Boyko, Adam R; Danko, Charles G; Grenier, Jennifer K; Mezey, Jason G; Hayward, Jessica J; Shannon, Laura M; Gao, Chuan; Shafquat, Afrah; Rice, Edward J; Pujar, Shashikant; Eggers, Stefanie; Ohnesorg, Thomas; Sinclair, Andrew H

    2017-01-01

    Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD) remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens) and dogs (C. familiaris). Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1) a variant associated with XX DSD in the canine model and 2) gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS) and whole genome sequencing (WGS), we identified a variant on C. familiaris autosome 9 (CFA9) that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq) in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.

  17. XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris.

    Directory of Open Access Journals (Sweden)

    Vicki N Meyers-Wallen

    Full Text Available Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens and dogs (C. familiaris. Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1 a variant associated with XX DSD in the canine model and 2 gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS and whole genome sequencing (WGS, we identified a variant on C. familiaris autosome 9 (CFA9 that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.

  18. Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog.

    Science.gov (United States)

    Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M

    2013-12-01

    A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles. © 2013 American Society for Veterinary Clinical Pathology.

  19. Demodex canis: redescription and reevaluation.

    Science.gov (United States)

    Nutting, W B; Desch, C E

    1978-04-01

    A brief review of the taxonomy of Demodex canis is followed by a complete redescription. Demodex canis is diagnosed with D. odocoilei of the white-tailed deer. In view of the continued speculation that dogs and man share the same demodicid, simple morphological characters are noted which distinguish D. canis from D. folliculorum and D. brevis in all stages of their life cycles.

  20. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  1. Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

    Index Scriptorium Estoniae

    Häniläne,, pseud.

    2008-01-01

    Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

  2. Gene : CBRC-EEUR-01-0576 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID

  3. Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in dogs in a village of eastern Sudan by using a screening PCR and sequencing methodologies.

    Science.gov (United States)

    Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

    2005-11-01

    Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis.

  4. Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in Dogs in a Village of Eastern Sudan by Using a Screening PCR and Sequencing Methodologies

    OpenAIRE

    Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

    2005-01-01

    Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis.

  5. Detection of Babesia canis rossi, B. canis vogeli, and Hepatozoon canis in Dogs in a Village of Eastern Sudan by Using a Screening PCR and Sequencing Methodologies

    Science.gov (United States)

    Oyamada, Maremichi; Davoust, Bernard; Boni, Mickaël; Dereure, Jacques; Bucheton, Bruno; Hammad, Awad; Itamoto, Kazuhito; Okuda, Masaru; Inokuma, Hisashi

    2005-01-01

    Babesia and Hepatozoon infections of dogs in a village of eastern Sudan were analyzed by using a single PCR and sequencing. Among 78 dogs, 5 were infected with Babesia canis rossi and 2 others were infected with B. canis vogeli. Thirty-three dogs were positive for Hepatozoon. Hepatozoon canis was detected by sequence analysis. PMID:16275954

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3294 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-134 48% ...

  7. NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0762 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 2e-98 40% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0695 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-107 43% ...

  9. An analysis of osteological material from the late Funnel Beaker culture settlement in Brozany, northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2013-01-01

    Roč. 65, č. 3 (2013), s. 504-534 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : archaeozoology * Eneolithic * puppies (Canis familiaris) * human newborns * fox * bird * fish * Apodemus * Unio * bone artefacts Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Molecular detection of Hepatozoon canis and Babesia canis vogeli in domestic dogs from Cuiabá, Brazil.

    Science.gov (United States)

    Spolidorio, Mariana Granziera; Torres, Mariana de Medeiros; Campos, Wilma Neres da Silva; Melo, Andréia Lima Tomé; Igarashi, Michelle; Amude, Alexandre Mendes; Labruna, Marcelo Bahia; Aguiar, Daniel Moura

    2011-01-01

    The objective of this study was to report for the first time infection by Hepatozoon spp. and Babesia spp. in 10 dogs from the city of Cuiabá, State of Mato Grosso, central-western Brazil. A pair of primers that amplifies a 574 bp fragment of the 18S rRNA of Hepatozoon spp., and a pair of primers that amplifies a 551 bp fragment of the gene 18S rRNA for Babesia spp. were used. Six dogs were positive for Babesia spp., and 9 were positive for Hepatozoon spp. Co‑infection of Babesia spp. and Hepatozoon spp. was seen in 5 dogs. Sequenced samples revealed 100% identity with B. canis vogeli, and H. canis. This is the first molecular detection of H. canis in domestic dogs from Cuiabá. Additionally, it is described for the first time the presence of B. canis vogeli circulating among dogs in Cuiabá.

  11. Molecular detection of Hepatozoon canis and Babesia canis vogeli in domestic dogs from Cuiabá, Brazil Detecção molecular de Hepatozoon canis e Babesia canis vogeli em cães domésticos de Cuiabá, Brasil

    Directory of Open Access Journals (Sweden)

    Mariana Granziera Spolidorio

    2011-09-01

    Full Text Available The objective of this study was to report for the first time infection by Hepatozoon spp. and Babesia spp. in 10 dogs from the city of Cuiabá, State of Mato Grosso, central-western Brazil. A pair of primers that amplifies a 574 bp fragment of the 18S rRNA of Hepatozoon spp., and a pair of primers that amplifies a 551 bp fragment of the gene 18S rRNA for Babesia spp. were used. Six dogs were positive for Babesia spp., and 9 were positive for Hepatozoon spp. Co-infection of Babesia spp. and Hepatozoon spp. was seen in 5 dogs. Sequenced samples revealed 100% identity with B. canis vogeli, and H. canis. This is the first molecular detection of H. canis in domestic dogs from Cuiabá. Additionally, it is described for the first time the presence of B. canis vogeli circulating among dogs in Cuiabá.O objetivo deste estudo foi relatar pela primeira vez a infecção por Hepatozoon spp. e Babesia spp. em cães domésticos provenientes da cidade de Cuiabá, estado de Mato Grosso. Foram utilizados pares de primers que amplificam um fragmento de 574 pb do gene 18S rRNA de Hepatozoon spp., e 551 pb do gene 18S rRNA para Babesia spp. Dos 10 cães amostrados, 6 apresentaram-se positivos para Babesia spp., e 9 foram positivos para Hepatozoon spp. pela PCR. Co-infecção entre Babesia spp. e Hepatozoon spp. ocorreu em 5 cães. As amostras revelaram 100% de identidade com B. canis vogeli, e as amostras que foram positivas para Hepatozoon spp. foram 100% idênticas a H. canis. Esta é a primeira identificação molecular de H. canis em cães domésticos em Cuiabá. Adicionalmente, descrevemos pela primeira vez a presença de B. canis vogeli circulando entre cães em Cuiabá.

  12. NCBI nr-aa BLAST: CBRC-CINT-01-0147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0147 ref|XP_547405.2| PREDICTED: similar to Feline leukemia virus subg...roup C receptor-related protein 1 (Feline leukemia virus subgroup C receptor) (hFLVCR) [Canis familiaris] XP_547405.2 2e-76 47% ...

  13. Development of multiplex polymerase chain reaction for detection of Ehrlichia canis, Babesia spp and Hepatozoon canis in canine blood.

    Science.gov (United States)

    Kledmanee, Kan; Suwanpakdee, Sarin; Krajangwong, Sakranmanee; Chatsiriwech, Jarin; Suksai, Parut; Suwannachat, Pongpun; Sariya, Ladawan; Buddhirongawatr, Ruangrat; Charoonrut, Phingphol; Chaichoun, Kridsada

    2009-01-01

    A multiplex polymerase chain reaction (PCR) has been developed for simultaneous detection of canine blood parasites, Ehrlichia canis, Babesia spp and Hepatozoon canis, from blood samples in a single reaction. The multiplex PCR primers were specific to E. canis VirB9, Babesia spp 16S rRNA and H. canis 16S rRNA genes. Specificity of the amplicons was confirmed by DNA sequencing. The assay was evaluated using normal canine and infected blood samples, which were detected by microscopic examination. This multiplex PCR offers scope for simultaneous detection of three important canine blood parasites and should be valuable in monitoring parasite infections in dogs and ticks.

  14. Estructura comunitaria de helmintos de perros vagabundos de San Juan de Lurigancho, Lima, Perú Community structure of helminths in stray dogs from San Juan de Lurigancho, Lima, Peru

    Directory of Open Access Journals (Sweden)

    José O. Iannacone

    2001-07-01

    Full Text Available Thirty stray dogs Canis familiaris Linnaeus, 1758 were collected in San Juan de Lurigancho, Lima, Peru, between January and March 1997 and necropsied for helminths. Three species were collected: the cestodes Dipylidium caninum (Linnaeus, 1758 Railliet, 1892 and Taenia pisiformis (Bloch, 1780 and the nematode Toxocara canis (Werner, 1782 Stiles, 1905. Fifty per cent of the examined dogs showed one or two parasites. A total of 303 (0-116 helminths were recovered and the intensity of infection was 30,3. The Simpson index (C for all parasite species was 0,414, indicating a dominance by one species in the parasite community. The mean diversity in the infracommunities of C. familiaris was H' = 0,038 and uniformity index of Pielou J = 0,207. Dipylidium caninum, T. pisiformis, and T. canis presented a prevalence of infection of 33,30%, 10% and 16,6% respectively. Dipylidium caninum presented the highest frequency and mean intensity of infection. Dipylidium caninum was the helminth with the highest dominance (94% whereas the lowest was due to T. pisiformis (4% and T. canis (2%. Helminths were not related to the age of the hosts, prevalence and mean intensity of infection. Out of the 10 equally divided segments of the intestinal gut, D. caninum was found from the 6th to the 9th segment. T canis preferred almost exclusively the 1st segment while T. pisiformis was randomly distributed.

  15. Fatal Babesia canis canis infection in a splenectomized Estonian dog.

    Science.gov (United States)

    Tiškina, Valentina; Capligina, Valentina; Must, Külli; Berzina, Inese; Ranka, Renate; Jokelainen, Pikka

    2016-01-25

    A previously splenectomized dog from Estonia was presented with a sudden lack of appetite and discoloration of the urine. Despite supportive therapy, its condition deteriorated dramatically during 1 day. Severe thrombocytopenia and high numbers of protozoan hemoparasites were evident in blood smears, and the hematocrit dropped from 46 to 33 %. The dog was euthanized before specific antibabesial treatment was initiated. Blood samples from the dog and from two other dogs in the same household tested positive for Babesia using molecular methods, and the sequences of partial 18S rRNA gene confirmed the causative species as Babesia canis canis. The risk of severe, rapidly progressing babesiosis in splenectomized dogs merits awareness.

  16. Dog handlers' and dogs' emotional and cortisol secretion responses associated with animal-assisted therapy sessions

    NARCIS (Netherlands)

    Haubenhofer, D.K.; Kirchengast, S.

    2007-01-01

    The study investigated 13 dog handlers and 18 companion dogs (Canis familiaris) working as teams in nonhuman animal-assisted service. The handlers described in questionnaires what emotions they chose to associate with their daily life and therapeutic work. They described their emotional condition

  17. Experimental evidence against transmission of Hepatozoon canis by Ixodes ricinus.

    Science.gov (United States)

    Giannelli, Alessio; Ramos, Rafael Antonio Nascimento; Dantas-Torres, Filipe; Mencke, Norbert; Baneth, Gad; Otranto, Domenico

    2013-09-01

    Hepatozoon canis is among the most widespread tick-borne protozoa infecting domestic and wild carnivores. Its distribution is related to the occurrence of its major vector, the brown dog tick Rhipicephalus sanguineus. However, the role of Ixodes ricinus as a vector of H. canis has been hypothesized. In the present study, the development of H. canis was investigated in I. ricinus and R. sanguineus nymphs collected from a naturally infested dog. All I. ricinus ticks examined (n=133) were negative by cytological examination at days 20, 30, and 90 post collection, although H. canis DNA was detected in one nymph at day 20 and in 2 nymphs at day 30 post collection. On the other hand, H. canis sporogony was documented by cytology, and H. canis DNA was detected by PCR in R. sanguineus at day 30 post collection. These results indicate that H. canis sporogony does not occur in I. ricinus, but in R. sanguineus, suggesting that I. ricinus does not act as a vector of H. canis. Copyright © 2013 Elsevier GmbH. All rights reserved.

  18. Dicty_cDB: CHK317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

  19. 50 CFR 14.4 - What terms do I have to understand?

    Science.gov (United States)

    2010-10-01

    ... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...

  20. The retinal fascin gene 2 (FSCN2) - partial structural analysis and polymorphisms detection in dogs with progressive retinal atrophy (PRA)

    Czech Academy of Sciences Publication Activity Database

    Horák, Pavel; Knoll, Aleš; Dvořák, J.

    2006-01-01

    Roč. 47, č. 4 (2006), s. 361-364 ISSN 1234-1983 R&D Projects: GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : canis familiaris * FSCN2 gene * PCR-RFLP Subject RIV: EB - Genetics ; Molecular Biology

  1. Can f 1 levels in hair and homes of different dog breeds: Lack of evidence to describe any dog breed as hypoallergenic

    NARCIS (Netherlands)

    Vredegoor, D.W.; Willemse, T.; Chapman, M.D.; Heederik, D.J.J.; Krop, E.J.M.

    2012-01-01

    BACKGROUND Certain dog breeds are described and marketed as being "hypoallergenic" on the basis of anecdotal reports that these dogs are better tolerated by patients allergic to dogs. OBJECTIVE These observations were investigated by comparing Can f 1 (major dog [Canis familiaris] allergen) levels

  2. Rhipicephalus turanicus, a new vector of Hepatozoon canis.

    Science.gov (United States)

    Giannelli, Alessio; Lia, Riccardo Paolo; Annoscia, Giada; Buonavoglia, Canio; Lorusso, Eleonora; Dantas-Torres, Filipe; Baneth, Gad; Otranto, Domenico

    2017-05-01

    The distribution of Hepatozoon canis mainly encompasses areas where its main tick vector, Rhipicephalus sanguineus sensu lato, is present. However, the detection of this pathogen in dogs, foxes and golden jackals well outside the areas inhabited by this tick species reinforced the hypothesis that additional ixodids are involved in the life cycle and transmission of this protozoon. The present study provides, for the first time, data supporting the sporogonic development of H. canis in specimens of Rhipicephalus turanicus collected from a naturally infected fox from southern Italy. The epidemiological role of R. turanicus as a vector of H. canis is discussed, along with information on the potential use of cell cultures for the experimental infection with H. canis sporozoites. The in vitro infection of canine leucocytes by sporozoites from ticks is proposed as a potential tool for future in-depth studies on the biology of H. canis.

  3. Identification of Babesia canis genotypes in dogs from Lithuania

    OpenAIRE

    Tamoliūnaitė, Dovilė; Radzijevskaja, Jana; Paulauskas, Algimantas; Sabūnas, Vytautas; Karvelienė, Birutė; Zamokas, Gintaras

    2018-01-01

    Canine babesiosis is a widespread tick-borne disease caused by haematozoan parasites of the genus Babesia. The vast majority of clinical babesiosis cases in dogs in Europe is caused by Babesia canis. Canine babesiosis has become quite frequent in Lithuania during the past decade. Babesiosis caused by B. canis may range from mild to severe disease in dogs. Such difference in the virulence of B. canis strains is associated with genetic heterogeneity among B. canis strains. We aimed to investiga...

  4. Selenium status in adult cats and dogs fed high levels of dietary inorganic and organic selenium

    NARCIS (Netherlands)

    Todd, S.E.; Ugarte, S.E.; Thomas, D.G.; Bosch, Guido; Hendriks, W.H.

    2012-01-01

    Cats (Felis catus) maintain greater blood Se concentrations compared with dogs (Canis familiaris) and, unlike dogs, show no signs of chronic Se toxicity (selenosis) when fed dietary organic Se (selenomethionine) concentrations of 10 μg/g DM. This study investigated the response of cats and dogs to

  5. Paw Preference Correlates to Task Performance in Dogs

    NARCIS (Netherlands)

    Alphen, A. van; Bosse, T.; Frank, I.; Jonker, C.M.; Koeman, F.; Bara, B.G.; Barsalou, L.; Bucciarelli, M.

    2005-01-01

    A study involving 36 domestic dogs (Canis familiaris) in a simple search task provides evidence of a correlation between paw use and performance. The study was carried out to determine whether or not paw use is related to task performance. Different aspects of task performance were taken into

  6. A village dog is not a stray : human-dog interactions in coastal Mexico

    NARCIS (Netherlands)

    Ruiz Izaguirre, E.

    2013-01-01

    Dogs (Canis familiaris) are considered one of the most numerous carnivores worldwide. Although in the Global North dogs are popular companions, that live inside homes, about 80% of the dogs in the world are village dogs. Village dogs are typically free-roaming, scavenge refuse around

  7. Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

    NARCIS (Netherlands)

    Hassan, M.M.; Osman, O.F.; El-Raba'a, F.M.A.; Schallig, H.D.F.H.; Elnaiem, D.E.A.

    2009-01-01

    Background: The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a

  8. Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

    NARCIS (Netherlands)

    Hassan, Mo'awia M.; Osman, Omran F.; El-Raba'a, Fathi Ma; Schallig, Henk Dfh; Elnaiem, Dia-Eldin A.

    2009-01-01

    The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a reservoir host

  9. Molecular characterization of Hepatozoon canis from farm dogs in Pakistan.

    Science.gov (United States)

    Ahmad, Abdullah S; Saeed, Muhammad A; Rashid, Imran; Ashraf, Kamran; Shehzad, Wasim; Traub, Rebecca J; Baneth, Gad; Jabbar, Abdul

    2018-04-01

    Hepatozoon canis is a tick-borne pathogen of canids, which is distributed worldwide. However, very little is known about this protozoan parasite in Pakistan. This study provides the first molecular evidence of H. canis from farm dogs from three agro-ecological zones of Punjab, Pakistan. A conventional PCR targeting the 18S rRNA gene was used to characterize H. canis from farm dogs from three districts, namely Kasur, Rawalpindi, and Muzaffargarh, in Punjab. Of 341 blood samples tested, 155 (45.5%) were positive for H. canis, 73 (61.3%) from Kasur, 46 (42.5%) from Rawalpindi, and 36 (31.5%) from Muzaffargarh. Phylogenetic analyses revealed that 18S rRNA sequences of H. canis from this study clustered in three clades with those of H. canis from previously published studies to the exclusion of all other Hepatozoon spp. included in the analysis. This study provides the first insight into H. canis from farm dogs in Pakistan. Furthermore, it lays a foundation for future studies of the parasite to assess the impact of canine hepatozoonosis in dogs from various agro-ecological zones in Pakistan where pet ownership of dogs is increasing.

  10. A golden jackal (Canis aureus) from Austria bearing Hepatozoon canis--import due to immigration into a non-endemic area?

    Science.gov (United States)

    Duscher, Georg Gerhard; Kübber-Heiss, Anna; Richter, Barbara; Suchentrunk, Franz

    2013-02-01

    The protozoan Hepatozoon canis, which is transmitted via ingestion of infected ticks by canine hosts, is not endemic to mid-latitude regions in Europe. Its distribution is supposed to be linked to the occurrence of its primary tick vector Rhipicephalus sanguineus. A young male golden jackal (Canis aureus) found as road kill close to Vienna, Austria, was infected by this pathogen. Cloning and sequencing of the PCR product revealed 6 different haplotypes of H. canis. Based on the sequences, no clear relationship to the origin of infection could be traced. This is the first report of H. canis for Austria, and wild canines such as the currently found jackal may provide a source of natural spread of this parasite into non-endemic areas. This natural immigration of wild animals represents a way of pathogen introduction, which has to be considered in disease prevention in addition to human-made introduction due to animal import and export. Copyright © 2012 Elsevier GmbH. All rights reserved.

  11. Serological Surveillance for Non-Rabies Lyssaviruses among ...

    African Journals Online (AJOL)

    Out of the seven recognized and four putative genotypes of lyssaviruses, genotypes 1-3 comprising namely the classical rabies virus (RABV), Lagos bat virus (LBV) and Mokola virus (MOKV) respectively have been reported in Nigeria. The domestic dog, Canis familiaris, is recognized as the reservoir for genotype 1, and the ...

  12. Drilled teeth and shell artefacts from a grave at Prague-Březiněves and a review of decorative artefacts made from animal material from Corded Ware culture in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René; Dobeš, Miroslav; Svoboda, K.

    -, - (2017) ISSN 1866-9557 R&D Projects: GA ČR(CZ) GA16-14855S Institutional support: RVO:67985912 Keywords : tooth pendants * shell beads * solar disc * dog (Canis familiaris) * Margaritifera auricularia * Chalcolithic (Copper Age) * Bohemia * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.844, year: 2016

  13. An Attachment Perspective on the Child--Dog Bond: Interdisciplinary and International Research Findings

    Science.gov (United States)

    Jalongo, Mary Renck

    2015-01-01

    Understanding the process of attachment formation in young children has been a focal point in child development research for decades. However, young children's attachments are not only with human beings; they also form bonds with companion animals, particularly dogs ("Canis familiaris"). Given the number of dogs that are kept by families…

  14. The mitochondrial genome of Toxocara canis.

    Science.gov (United States)

    Jex, Aaron R; Waeschenbach, Andrea; Littlewood, D Timothy J; Hu, Min; Gasser, Robin B

    2008-08-06

    Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR) and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secementean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida). The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts.

  15. The mitochondrial genome of Toxocara canis.

    Directory of Open Access Journals (Sweden)

    Aaron R Jex

    2008-08-01

    Full Text Available Toxocara canis (Ascaridida: Nematoda, which parasitizes (at the adult stage the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secementean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida. The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts.

  16. The Mitochondrial Genome of Toxocara canis

    Science.gov (United States)

    Littlewood, D. Timothy J.; Hu, Min; Gasser, Robin B.

    2008-01-01

    Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provide genetic markers for investigations in these areas, but complete mitochondrial genomic data have been lacking for T. canis and its congeners. In the present study, the mitochondrial genome of T. canis was amplified by long-range polymerase chain reaction (long PCR) and sequenced using a primer-walking strategy. This circular mitochondrial genome was 14162 bp and contained 12 protein-coding, 22 transfer RNA, and 2 ribosomal RNA genes consistent for secernentean nematodes, including Ascaris suum and Anisakis simplex (Ascaridida). The mitochondrial genome of T. canis provides genetic markers for studies into the systematics, population genetics and epidemiology of this zoonotic parasite and its congeners. Such markers can now be used in prospecting for cryptic species and for exploring host specificity and zoonotic potential, thus underpinning the prevention and control of toxocariasis in humans and other hosts. PMID:18682828

  17. High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples.

    Science.gov (United States)

    Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

    2014-06-01

    Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines. Copyright © 2014 Elsevier GmbH. All rights reserved.

  18. Prevalence of Demodex canis-positive healthy dogs at trichoscopic examination.

    Science.gov (United States)

    Fondati, Alessandra; De Lucia, Michela; Furiani, Nicla; Monaco, Moira; Ordeix, Laura; Scarampella, Fabia

    2010-04-01

    Demodex canis is thought to be present in small numbers in the skin of most healthy dogs; however, available data on the prevalence of normal dogs harbouring D. canis are scarce. The purpose of this study was to investigate, using microscopic examination of plucked hairs, the prevalence of healthy dogs harbouring D. canis. Seventy-eight clinically healthy dogs with no history of dermatological problems and clinically normal skin and hair coat were included in the study. Five areas (perioral skin 2-3mm from both labial commissures, periungual skin of the third digit of both anterior paws and chin) were examined in each dog. Fifty to sixty hairs were plucked from each skin site and microscopically examined. No D. canis mites were observed and only one adult form of Demodex injai was found in the labial commissure of one dog. Based on these results, the estimated prevalence of healthy dogs harbouring D. canis in clinically normal skin should not exceed the threshold of 5.4%, with 95% confidence level. Considering our and previous findings, we propose that, although small numbers of D. canis might inhabit the skin of normal dogs, the probability of finding these mites in normal dogs is low. Consequently, in most cases, the presence of a D. canis mite in the skin should not be considered as indicative of normality.

  19. Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...

  20. A PCR-based epidemiological survey of Hepatozoon canis in dogs in Nigeria.

    Science.gov (United States)

    Sasaki, Mizuki; Omobowale, Olutayo; Ohta, Kaisaku; Tozuka, Morito; Matsuu, Aya; Hirata, Haruyuki; Nottidge, Helen Oyebukola; Ikadai, Hiromi; Oyamada, Takashi

    2008-07-01

    The prevalence of Hepatozoon canis infections in dogs in Nigeria was surveyed using molecular methods. DNA was extracted from blood samples obtained from 400 dogs. A primer set that amplified the Babesia canis 18S rRNA gene, which has high similarity to the H. canis 18S rRNA gene, was used for the PCR. As a result, samples from 81 dogs (20.3%) produced 757 bp bands, which differed from the 698 bp band that corresponded to B. canis infection. The sequence of the PCR products of 10 samples were determined, all of which corresponded with the H. canis sequence.

  1. Endocarditis caused by Streptococcus canis: an emerging zoonosis?

    Science.gov (United States)

    Lacave, Guillaume; Coutard, Aymeric; Troché, Gilles; Augusto, Sandrine; Pons, Stéphanie; Zuber, Benjamin; Laurent, Virginie; Amara, Marlène; Couzon, Brigitte; Bédos, Jean-Pierre; Pangon, Béatrice; Grimaldi, David

    2016-02-01

    We report a human case of infective endocarditis caused by Streptococcus canis. Identification was carried out from positive blood culture using mass spectrometry and SodA gene sequencing. S. canis related zoonotic invasive infections may have been previously underdiagnosed due to inadequate identification of group G Streptococcus species.

  2. Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...

  3. Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...

  4. Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...

  5. Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...

  6. Helicobacter canis bacteremia in a renal transplant patient

    NARCIS (Netherlands)

    van der Vusse, M. L.; van Son, W. J.; Ott, A.; Manson, W.

    Here we present a case report of a 41-year-old woman suffering from high fever and bacteremia due to Helicobacter canis, 11months after kidney transplantation. Identification of H.canis was achieved by 16s rDNA sequence analysis of a positive blood culture. The patient was restored fully to health

  7. Differential sensitivity to human communication in dogs, wolves, and human infants.

    Science.gov (United States)

    Topál, József; Gergely, György; Erdohegyi, Agnes; Csibra, Gergely; Miklósi, Adám

    2009-09-04

    Ten-month-old infants persistently search for a hidden object at its initial hiding place even after observing it being hidden at another location. Recent evidence suggests that communicative cues from the experimenter contribute to the emergence of this perseverative search error. We replicated these results with dogs (Canis familiaris), who also commit more search errors in ostensive-communicative (in 75% of the total trials) than in noncommunicative (39%) or nonsocial (17%) hiding contexts. However, comparative investigations suggest that communicative signals serve different functions for dogs and infants, whereas human-reared wolves (Canis lupus) do not show doglike context-dependent differences of search errors. We propose that shared sensitivity to human communicative signals stems from convergent social evolution of the Homo and the Canis genera.

  8. Book review, Amati cani, José Jorge Letria

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2008-03-01

    Full Text Available Con Amati cani ci discostiamo per una volta dalle pubblicazioni a carattere scientifico, per dare il giusto risalto ad un’interessante raccolta di narrativa che esplora il rapporto tra l'uomo e il suo miglior amico. José Jorge Latria, noto soprattutto per essere un esponente di spicco della canzone politica portoghese e per le sue opere poetiche, teatrali e di letteratura per ragazzi, nello scrivere questo libro compie un vero e proprio atto d’amore verso i cani, con il preciso intento di costringere i lettori ad eliminare dal proprio vocabolario il gratuito modo di dire ‘mondo cane’. L’Autore delinea brevi ritratti di cani che, da Argo in poi, hanno accompagnato da amici veri i loro celebri padroni nella buona e nella cattiva sorte: racconta cioè la storia di quei cani che non sono sprofondati nella voragine dell’oblio perchè i loro padroni hanno raggiunto la celebrità nel mondo della letteratura, della politica, del cinema, delle scienze o della musica. Con a fianco un amico fedele come un cane, la vita ha avuto un sapore diverso per Ernest Hemingway, Isaac Newton, Sigmund Freud, Buster Keaton, Marilyn Monroe, Pablo Picasso, John Steinbeck, Lord Byron, Tim Burton e altri ancora, tutti personaggi che sono presenti in questo libro grazie ai cani che hanno condiviso con loro la vita e le memorie. La lettura di Amati cani dà piacere poichè in ognuno di questi racconti batte, affettuoso e delicato, il cuore di un cane; ma dà anche un pò da pensare in quanto celebra in maniera molto tenera l’amore, la fedeltà e la solidarietà tra l’uomo e il suo speciale amico a quattro zampe.

  9. Another way to learn about teaching: What dogs can tell us about the evolution of pedagogy.

    Science.gov (United States)

    Johnston, Angie M; McAuliffe, Katherine; Santos, Laurie R

    2015-01-01

    Kline argues that it is crucial to isolate the respective roles of teaching and learning in order to understand how pedagogy has evolved. We argue that doing so requires testing species that learn from pedagogy but that rarely teach themselves. Here, we review how one previously neglected species - domesticated dogs (Canis familiaris) - may allow researchers to do just that.

  10. Brucella canis: inquéritos sorológico e bacteriológico em população felina Brucella canis: serological and bacteriological surveys in the feline population

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson

    1984-02-01

    Full Text Available De 134 soros de felinos domésticos examinados pela prova de soroaglutinação lenta em tubos, 4 (3% foram positivos para Brucella canis, todos com título igual a 100. Não se obteve êxito na tentativa de isolamento de Brucella canis através de hemocultura desses animais.Of the 134 feline sera tested by tube agglutination test, 4 (3% were positive for Brucella canis antibodies, all with titer 100. It was not possible to isolate Brucella canis by blood culture in the case of these animals.

  11. Intraoperative bleeding in dogs from Grenada seroreactive to Anaplasma platys and Ehrlichia canis.

    Science.gov (United States)

    Lanza-Perea, M; Zieger, U; Qurollo, B A; Hegarty, B C; Pultorak, E L; Kumthekar, S; Bruhl-Day, R; Breitschwerdt, E B

    2014-01-01

    Frequent exposure of Grenadian dogs to Rhipicephalus sanguineus results in Anaplasma platys, and Ehrlichia canis seroreactivity. During elective surgeries, substantial intraoperative hemorrhage occurs in some seroreactive dogs. To assess hemostatic parameters and bleeding tendencies as well as prevalence of PCR positivity in apparently healthy A. platys and E. canis seroreactive and seronegative free-roaming dogs from Grenada. Forty-seven elective surgery dogs allocated to 4 groups: Seronegative control (n = 12), A. platys (n = 10), E. canis (n = 14) and A. platys, and E. canis (n = 11) seroreactive. Preoperatively, hemostasis was assessed by platelet count, prothrombin time, activated partial thromboplastin time, and buccal mucosal bleeding time. Intra- and postoperative bleeding scores were subjectively assigned. Blood, spleen, bone marrow, and lymph node aspirates were tested by PCR. Bleeding scores in dogs coseroreactive for A. platys and E. canis were higher (P = .015) than those of seronegative dogs. A. platys DNA was amplified from 7/21 (33%) A. platys seroreactive dogs and from 1 E. canis seroreactive dog; E. canis DNA was amplified from 21/25 (84%) E. canis seroreactive dogs. E. canis DNA was amplified most often from blood, whereas A. platys DNA was amplified most often from bone marrow. Apparently healthy, free-roaming dogs coseropositive for A. platys and E. canis may have increased intraoperative bleeding tendencies despite normal hemostatic parameters. Future investigations should explore the potential for vascular injury as a cause for bleeding in these dogs. Improved tick control is needed for dogs in Grenada. Copyright © 2014 by the American College of Veterinary Internal Medicine.

  12. Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

    Directory of Open Access Journals (Sweden)

    Decaprariis Donato

    2011-04-01

    Full Text Available Abstract Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling and also by PCR for H. canis (second sampling. In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season, the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively, with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8% out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to

  13. Diagnosis of Hepatozoon canis in young dogs by cytology and PCR

    Science.gov (United States)

    2011-01-01

    Background Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. Results A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling) and also by PCR for H. canis (second sampling). In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season), the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively), with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8%) out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. Conclusions The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to blood smear evaluation

  14. Diagnosis of Hepatozoon canis in young dogs by cytology and PCR.

    Science.gov (United States)

    Otranto, Domenico; Dantas-Torres, Filipe; Weigl, Stefania; Latrofa, Maria Stefania; Stanneck, Dorothee; Decaprariis, Donato; Capelli, Gioia; Baneth, Gad

    2011-04-13

    Hepatozoon canis is a widespread tick-borne protozoan affecting dogs. The diagnosis of H. canis infection is usually performed by cytology of blood or buffy coat smears, but this method may not be sensitive. Our study aimed to evaluate the best method to achieve a parasitological diagnosis of H. canis infection in a population of receptive young dogs, previously negative by cytology and exposed to tick infestation for one summer season. A total of 73 mongrel dogs and ten beagles younger than 18 months of age, living in an animal shelter in southern Italy where dogs are highly infested by Rhipicephalus sanguineus, were included in this study. In March-April 2009 and in October 2009, blood and bone marrow were sampled from each dog. Blood, buffy coat and bone marrow were examined by cytology only (at the first sampling) and also by PCR for H. canis (second sampling). In March-April 2009, only one dog was positive for H. canis by cytological examination, whereas in October 2009 (after the summer season), the overall incidence of H. canis infection by cytological examinations was 43.9%. Molecular tests carried out on samples taken in October 2009 showed a considerably higher number of dogs positive by PCR (from 27.7% up to 51.2% on skin and buffy coat tissues, respectively), with an overall positivity of 57.8%. All animals, but one, which were positive by cytology were also PCR-positive. PCR on blood or buffy coat detected the highest number of H. canis-positive dogs displaying a sensitivity of 85.7% for both tissues that increased up to 98% when used in parallel. Twenty-six (74.8%) out of the 28 H. canis-positive dogs presented hematological abnormalities, eosinophilia being the commonest alteration observed. The results suggest that PCR on buffy coat and blood is the best diagnostic assay for detecting H. canis infection in dogs, although when PCR is not available, cytology on buffy coat should be preferred to blood smear evaluation. This study has also demonstrated

  15. Different Babesia canis isolates, different diseases.

    Science.gov (United States)

    Schetters, T P; Moubri, K; Précigout, E; Kleuskens, J; Scholtes, N C; Gorenflot, A

    1997-11-01

    Using surface immunofluorescence isolate-specific antigens were detected on the membrane of erythrocytes infected with Babesia parasites. In addition, the strains reacted differently with Plasmagel in that the European isolate (B.c. canis) could be purified on Plasmagel effectively, whereas infected erythrocytes of the South-African isolate (B.c. rossi) could not. Experimental infection of dogs with Babesia canis isolates from geographically different areas revealed different pathology. The European isolate obtained from France exhibited transient parasitaemia, usually below 1%, associated with low PCV values and congestion of internal organs. Clinical disease was correlated with an effect on the coagulation system, and not with peripheral parasitaemia. Infection of dogs with South-African-derived isolate induced high parasitaemia usually much higher than 1%, which required chemotherapeutic treatment. In these animals clinical disease was correlated with peripheral parasitaemia and not with parameters of the coagulation system. The results show that the etiology of disease caused by these isolates of B.c. canis and B.c. rossi is different. This might have implications for the development of vaccines against these infections.

  16. Anti-Hepatozoon canis serum antibodies and gamonts in naturally-occurring canine monocytic ehrlichiosis.

    Science.gov (United States)

    Mylonakis, Mathios E; Leontides, Leonidas; Gonen, Liat; Billinis, Charalambos; Koutinas, Alexander F; Baneth, Gad

    2005-05-15

    The prevalence of IgG antibodies to Hepatozoon canis and the presence of gamonts in the blood and hemolymphatic tissues were studied in dogs with canine monocytic ehrlichiosis (CME) caused by Ehrlichia canis. Both pathogens are transmitted by the tick Rhipicephalus sanguineus. Forty-five out of 69 (65.2%) dogs with CME were seropositive to H. canis by an enzyme-linked immunosorbent assay (ELISA). Intra-neutrophilic gamonts of H. canis were found in 2 out of 69 dogs (2.9%) comprising 4.5% of the seropositive dogs. The present study indicated that the prevalence of antibodies to H. canis was high among dogs with CME in an area where both infections are endemic. However, previous exposure to H. canis was not found as an important contributor to clinical or clinicopathologic abnormalities found in dogs with CME.

  17. Hepatozoon canis infection in Slovakia: imported or autochthonous?

    Science.gov (United States)

    Majláthová, Viktória; Hurníková, Zuzana; Majláth, Igor; Petko, Branislav

    2007-01-01

    Tissue samples from nine red foxes (four samples of striated muscle tissue and five samples of heart tissue) that originated from the Michalovce district (Slovakia), an area with endemic occurrence of canine babesiosis were examined by PCR method using primers amplifying a fragment of the 18S rRNA spanning the V4 region of Babesia and Theileria. An unexpected determination of 450 bp DNA fragment of Hepatozoon canis was found in four samples. Partial sequences of the 18S rRNA gene from the H. canis showed 100% similarity with the sequence from Brasil isolate of H. canis from a pampas fox (Pseudalopex gymnocercus) (AY471615) as well as from a fox in Spain (AY150067) and from a dog in Brazil (AY864677). In the present study, we report the first PCR detection of Hepatozoon canis in a naturally infected red fox from Slovakia, a Rhipicephalus sanguineus-free region. We assume that the infection was spread by infected R. sanguineus that might have been brought to Slovakia by travelers, by golden jackals, or by foxes migrating because of expansion of golden jackals and environmental and climate changes.

  18. Molecular and serological detection of Ehrlichia canis and Babesia vogeli in dogs in Colombia.

    Science.gov (United States)

    Vargas-Hernández, G; André, M R; Faria, J L M; Munhoz, T D; Hernandez-Rodriguez, M; Machado, R Z; Tinucci-Costa, M

    2012-05-25

    Ehrlichiosis and babesiosis are tick-borne diseases, caused mainly by Ehrlichia canis and Babesia canis, respectively, with a worldwide occurrence in dogs, whose main vector is the brown-dog tick, Rhipicephalus sanguineus. The present work aimed to detect the presence of E. canis and Babesia sp. in 91 dog blood samples in Colombia, by molecular and serological techniques. We also performed sequence alignment to indicate the identity of the parasite species infecting these animals. The present work shows the first molecular detection of E. canis and B. vogeli in dogs from Colombia. Immunoglobulin-G (IgG) antibodies to E. canis and Babesia vogeli were found in 75 (82.4%) and 47 (51.6%) sampled dogs, respectively. Thirty-seven (40.6%) and 5 (5.5%) dogs were positive in PCR for E. canis and Babesia sp., respectively. After sequencing, amplicons showed 99% of identity with isolates of E. canis and B. vogeli. The phylogenetic trees based on 16S rRNA-Anaplasmataceae sequences and 18S rRNA-piroplasmid sequences supported the identity of the found E. canis and B. vogeli DNAs, respectively. The present work shows the first molecular detection of E. canis and B. vogeli in dogs in Colombia. Copyright © 2011 Elsevier B.V. All rights reserved.

  19. Neutropenia associated with osteomyelitis due to Hepatozoon canis infection in a dog.

    Science.gov (United States)

    Shimokawa Miyama, Takako; Umeki, Saori; Baba, Kenji; Sada, Kumiko; Hiraoka, Hiroko; Endo, Yasuyuki; Inokuma, Hisashi; Hisasue, Masaharu; Okuda, Masaru; Mizuno, Takuya

    2011-10-01

    A 4-year-old, intact male Shiba dog was referred to Yamaguchi University Animal Medical Center, Yamaguchi, Japan, for the following complaints: anorexia, lethargy, intermittent fever, gingival bleeding and abdominal purpura. The dog presented with persistent neutropenia. Histopathological examination of a bone marrow sample revealed round to oval structures that resembled Hepatozoon micromerozoites and formed a "wheel-spoke" pattern. Furthermore, mature neutrophils were observed around these structures. PCR and sequencing using bone marrow aspirate confirmed Hepatozoon canis (H. canis) infection. These findings suggest that the neutropenia observed in this case was associated with osteomyelitis due to H. canis infection. This is the first report of neutropenia associated with H. canis infection. H. canis infection can be included in the differential diagnosis in canine cases of neutropenia in areas where the disease is endemic.

  20. Genome Sequence of Canine Polyomavirus in Respiratory Secretions of Dogs with Pneumonia of Unknown Etiology.

    Science.gov (United States)

    Delwart, Eric; Kapusinszky, Beatrix; Pesavento, Patricia A; Estrada, Marko; Seguin, M Alexis; Leutenegger, Christian M

    2017-07-20

    We report here the first canine polyomavirus genome, identified by metagenomics in respiratory secretions of two dogs with severe pneumonia, which tested negative for all canine respiratory pathogens except Mycoplasma cynos The isolate, Canis familiaris polyomavirus 1 (DogPyV-1), is a beta polyomavirus whose closest known LT antigen relatives are primate polyomaviruses. Copyright © 2017 Delwart et al.

  1. SCM-positive Streptococcus canis are predominant among pet-associated group G streptococci.

    Science.gov (United States)

    Verkühlen, Gerd-Josef; Pägelow, Dennis; Valentin-Weigand, Peter; Fulde, Marcus

    2016-01-01

    Streptococcus (S.) canis is a neglected zoonotic pathogen with increasing impor- tance. Since knowledge about its distribution in pets in Germany is scant, we designed a study and tested 335 dogs and 71 cats for colonization by S. canis. S. canis was isolated from swabs taken from the perianal region by culture and subsequent identification was performed biochemically as well as by PCR. In total, 15.8% (53) of the canine and 8.5% (six) of the feline strains grown on Staphlyo- coccus/Streptococcus Selective Agar were tested positive for the Lancefield group G antigen. The vast majority of strains expressing the Lancefield Group G carbohy- drate (56 out of 59) were further identified as S. canis underlining their outstanding role among animal-associated Group G streptococci (GGS). Furthermore, 90.0% of the canine and 83.3% of the feline S. canis strains harbour the species-specific anti- phagocytic M protein homologue SCM, which has been described as an important virulence factor. In contrast, emm-genes typically encoded by human-specific GGS could not be detected in any of the S. canis isolates. Taken together, this study provides insights into the distribution of the neglected zoonotic pathogen S. canis in a population of pets in Germany. The presence of SCM in the vast majority of strains indicates their pathogenic potential.

  2. Transstadial transmission of Hepatozoon canis from larvae to nymphs of Rhipicephalus sanguineus.

    Science.gov (United States)

    Giannelli, Alessio; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Mencke, Norbert; Dantas-Torres, Filipe; Baneth, Gad; Otranto, Domenico

    2013-09-01

    Hepatozoon canis is an apicomplexan parasite of dogs, which is known to become infected by ingesting Rhipicephalus sanguineus adult ticks. To investigate the possibility of H. canis transovarial and transstadial transmission from larvae to nymphs, engorged adult female ticks were collected from a private animal shelter in southern Italy, where H. canis infection is highly prevalent. Female ticks (n=35) and egg batches were tested by PCR for H. canis. All eggs examined were PCR-negative whereas 88.6% of females from the environment tested positive. Additionally, fed larvae (n=120) from a dog naturally infected by H. canis were dissected at different time points post collection (i.e. 0, 10, 20 and 30 days). Molted nymphs dissected at 20 days post collection revealed immature oocysts displaying an amorphous central structure in 50% of the specimens, and oocysts containing sporocysts with sporozoites were found in 53.3% of the nymphs dissected at 30 days post collection. This study demonstrates that H. canis is not transmitted transovarially, but it is transmitted transstadially from larvae to nymphs of R. sanguineus and develops sporozoites in oocysts that may infect dogs. Copyright © 2013 Elsevier B.V. All rights reserved.

  3. Sarcocystis canis associated hepatitis in a Steller sea lion (Eumetopias jubatus) from Alaska.

    Science.gov (United States)

    Welsh, Trista; Burek-Huntington, Kathy; Savage, Kate; Rosenthal, Benjamin; Dubey, J P

    2014-04-01

    Sarcocystis canis infection was associated with hepatitis in a Steller sea lion (Eumetopias jubatus). Intrahepatocellular protozoal schizonts were among areas of necrosis and inflammation. The parasite was genetically identical to S. canis and is the first report in a Steller sea lion, indicating another intermediate host species for S. canis.

  4. Digital gene expression analysis of Microsporum canis exposed to berberine chloride.

    Directory of Open Access Journals (Sweden)

    Chen-Wen Xiao

    Full Text Available Berberine, a natural isoquinoline alkaloid of many medicinal herbs, has an active function against a variety of microbial infections including Microsporum canis (M. canis. However, the underlying mechanisms are poorly understood. To study the effect of berberine chloride on M. canis infection, a Digital Gene Expression (DGE tag profiling was constructed and a transcriptome analysis of the M. canis cellular responses upon berberine treatment was performed. Illumina/Hisseq sequencing technique was used to generate the data of gene expression profile, and the following enrichment analysis of Gene Ontology (GO and Pathway function were conducted based on the data of transcriptome. The results of DGE showed that there were 8476945, 14256722, 7708575, 5669955, 6565513 and 9303468 tags respectively, which was obtained from M. canis incubated with berberine or control DMSO. 8,783 genes were totally mapped, and 1,890 genes have shown significant changes between the two groups. 1,030 genes were up-regulated and 860 genes were down-regulated (P<0.05 in berberine treated group compared to the control group. Besides, twenty-three GO terms were identified by Gene Ontology functional enrichment analysis, such as calcium-transporting ATPase activity, 2-oxoglutarate metabolic process, valine catabolic process, peroxisome and unfolded protein binding. Pathway significant enrichment analysis indicated 6 signaling pathways that are significant, including steroid biosynthesis, steroid hormone biosynthesis, Parkinson's disease, 2,4-Dichlorobenzoate degradation, and tropane, piperidine and Isoquinoline alkaloid biosynthesis. Among these, eleven selected genes were further verified by qRT-PCR. Our findings provide a comprehensive view on the gene expression profile of M. canis upon berberine treatment, and shed light on its complicated effects on M. canis.

  5. Molecular cloning and characterization of arginine kinase gene of Toxocara canis

    OpenAIRE

    Sahu, Shivani; Samanta, S.; Harish, D. R.; Sudhakar, N. R.; Raina, O. K.; Shantaveer, S. B.; Madhu, D. N.; Kumar, Ashok

    2013-01-01

    Toxocara canis is an important gastrointestinal nematode of dogs and also a causative agent of visceral larva migrans in humans. Arginine kinase (AK) gene is one of the important biomolecule of phosphagen kinase of T. canis which is emerging as an exciting novel diagnostic target in toxocarosis. The present study was carried out to clone and characterize AK gene of T. canis for future utilization as a diagnostic molecule. Total RNA was extracted from intact adult worms and reverse transcripti...

  6. Critical analysis of vector-borne infections in dogs: Babesia vogeli, Babesia gibsoni, Ehrlichia canis and Hepatozoon canis in Punjab, India.

    Science.gov (United States)

    Singla, Lachhman Das; Sumbria, Deepak; Mandhotra, Ajay; Bal, M S; Kaur, Paramjit

    2016-12-01

    There are few published studies on various vector borne diseases of dogs in India and most depict clinical infection in dogs, diagnosed by observation of the haemopathogens in stained blood smears. This study provides the first report regarding molecular confirmation and ancestral relationship analysis of blood smears positive cases of assorted haemopathogens in Punjab province of India. On blood smear examination, haemopathogens were observed in 124 out of 778 (15.95%, 95% CI: 13.53- 18.68) blood smears. Further polymerase chain reactions (PCR) was used on bloods smear positive cases to validate the results. Out of 778 blood samples, Babesia gibsoni was most common parasite infecting dogs (15.04%, 95% CI: 12.7-17.72), followed by Ehrlichia canis (0.39%, 95% CI: 0.0-1.13), infection of Babesia vogeli and Hepatozoon canis was same (0.26%, 95% CI: 0.0-0.9). Among various risk factors studied (age, sex, season), prevalence of infection was non-significantly higher in 1-2 year of age group (19.88%, 95% CI: 14.45-26.71), regarding sex same prevalence was recorded (15.94%), and chances of infection was highest in pre-monsoon i.e. summer (18.26%, 95% CI: 14.49-22.76). Phylogenetic analysis revealed ancestral background of Ludhiana isolates of B. vogeli, B. gibsoni, H. canis, and E. canis with the isolates of Philippines, Mongolia and Tunisia.

  7. Infestivity of Demodex canis to hamster skin engrafted onto SCID mice.

    Science.gov (United States)

    Tani, Kenji; Une, Satoshi; Hasegawa, Atsuhiko; Adachi, Makoto; Kanda, Naoko; Watanabe, Shin-ichi; Nakaichi, Munekazu; Taura, Yasuho

    2005-04-01

    We demonstrated that Demodex canis was transferred to skin xenografts of a dog and a hamster onto severe combined immunodeficiency mice. After the transfer of mites, the number of eggs, larvae, nymphs and adult mites per gram of canine and hamster xenografts increased, whereas no live mites were detected on murine allograft. These results indicate that D. canis proliferates in hair follicles of dog and hamster skins but not in murine allograft. Therefore, D. canis may have host preference but not strict host-specificity.

  8. Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Éloïse C Déaux

    Full Text Available Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual or bimodal (audio-visual stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.

  9. Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

    Science.gov (United States)

    Déaux, Éloïse C; Clarke, Jennifer A; Charrier, Isabelle

    2015-01-01

    Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks) have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual) or bimodal (audio-visual) stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.

  10. MLVA and LPS Characteristics of Brucella canis Isolated from Humans and Dogs in Zhejiang, China

    Directory of Open Access Journals (Sweden)

    Dongri Piao

    2017-12-01

    Full Text Available BackgroundBrucella canis is a pathogenic bacterium that causes brucellosis in dogs, and its zoonotic potential has been increasing in recent years. B. canis is a rare source of human brucellosis in China, where Brucella melitensis has been the major pathogen associated with human brucellosis outbreaks. In late 2011, a case of a B. canis infection was detected in a human patient in Zhejiang Province, China. To compare the genotypes between strains of B. canis isolated from the patient and from dogs, a multiple-locus variable-number tandem-repeat analysis (MLVA-16 was performed. In addition, the lipopolysaccharide-synthesis-related genes were analyzed with the B. canis reference strain RM6/66.Results32 B. canis strains were divided into 26 genotypes using MLVA-16 [Hunter-Gaston Diversity Index (HGDI = 0.976]. The HGDI indexes for various loci ranged between 0.000 and 0.865. All four Hangzhou isolates were indistinguishable using panel 1 (genotype 3 and panel 2A (genotype 28. However, these strains were distinctly different from other isolates from Beijing, Jiangsu, Liaoning, and Inner Mongolia at Bruce 09. The emergence of a human B. canis infection was limited to an area. Comparative analysis indicated B. canis from canines and humans have no differences in lipopolysaccharide-synthesis locus.ConclusionThe comprehensive approaches have been used to analyze human and canine B. canis isolates, including molecular epidemiological and LPS genetic characteristics. Further detailed analysis of the whole genomic sequencing will contribute to understanding of the pathogenicity of B. canis in humans.

  11. Detecção molecular de Ehrlichia canis e Babesia canis vogeli em Rhipicephalus sanguineus sensu lato de carrapatos em Cuba

    Directory of Open Access Journals (Sweden)

    Maylin Gonzalez Navarrete

    2016-12-01

    Full Text Available Os carrapatos (Acari: Ixodidae são de importância médica e veterinária relevantes em todo o mundo por causa da variedade de agentes patogênicos que podem transmitir. No presente trabalho, foi realizada uma pesquisa para identificar Babesia spp. e Ehrlichia spp. em carrapatos coletados de cães de Cuba. Foram coletados 431 carrapatos de 378 cães, tendo sido identificados como pertencentes às espécies de Ripicephalus sanguineus sensu lato (s. 1. O DNA genômico foi extraído com protocolo usando fenol/clorofórmio. Os carrapatos foram organizados em “pools” e o DNA extraído foi testado pela reação em cadeia da polimerase (nPCR para amplificar 398 pares de bases (pb do DNA ribossômico 16S (rDNA de Ehrlichia canis e PCR para amplificar aproximadamente 560 pb do DNA ribossômico 18S (rDNA. Dos 49 pools testados, 8,16% (n = 4/49 foram positivos para o E. canis por nPCR visando o gene do 16S rDNA e apenas um pool (n = 1/49; 2,04% foi positivo para o gene 18S rDNA para Babesia canis. As quatro sequências obtidas para o fragmento de 16S rDNA foram idênticas entre si e resultaram em 100% de identidade com E. canis de diferentes países. A sequência obtida do gene do 18S rDNA para Babesia spp. apresentou semelhança de 100% com Babesia canis vogeli quando comparada às sequências depositadas no Genbank. Esta foi a primeira detecção molecular desses agentes no carrapato R. sanguineus s. l. em Cuba.

  12. Angiostrongylus vasorum in 20 cani della provincia di Chieti, Italia

    Directory of Open Access Journals (Sweden)

    Daniela Morelli

    2011-01-01

    Full Text Available A seguito di un caso di Angiostrongylus vasorum, diagnosticato all’inizio del 2008 nella provincia di Chieti, è stata organizzata una ricerca parassitologica al fine di indagare la presenza del parassita nei cani nella stessa area. Da gennaio a settembre 2008 sono stati esaminati 178 cani, 56 carcasse e 122 campioni di feci. Nelle carcasse sono stati ricercati i parassiti adulti nel ventricolo destro e nell’arteria polmonare e le forme larvali in tessuti di organi interni e cervello. Nelle feci è stata ricercata la forma larvale L1 con tre metodiche diagnostiche utilizzate correntemente per la ricerca di endoparassiti e larve di strongili broncopolmonari. Sono stati diagnosticati 20 casi (8,9% con identificazione di parassiti adulti in 5 cani e larve L1 in altri 15 soggetti. L’esame anatomopatologico delle carcasse dei cani con nematodi adulti ha evidenziato polmonite, pleurite, schiuma rossastra in trachea, versamento di liquido sieroemorragico in cavità toracica e ingrossamento di linfonodi medinici e meseraici. L’esame istologico dei tessuti ha evidenziato quadri gravi e sovrapponibili con lesioni da localizzazione dei parassiti in reni, linfonodi e cervello. Il numero cospicuo di casi riscontrati ha reso indispensabile considerare l’angiostrongilosi nelle diagnosi differenziali degli esami clinici e autoptici di cani della provincia di Chieti (Italia e dei territori confinanti.

  13. Cultural Resource Reconnaissance of U.S. Army Corps of Engineers Land Alongside Lake Sakakawea in Mountrail County, North Dakota. Volume 1. Main Report

    Science.gov (United States)

    1987-02-11

    introduced by man] (Canis familiaris), otter (Mustela lutra canadensis), badger (Taxidea taxus), porcupine (Erethizon epixanthus), beaver (Castor...grasslands to flourish, and was accompanied by an increase in the size of bison herds . The earliest European observers on the Northern Plains witnessed...Pleistocene megafauna living in herds .. .became extinct about 3000 years ago" (Hester 1960:66). 50 While present evidence from the study region is very

  14. Occurrence of Hepatozoon canis (Adeleorina: Hepatozoidae) and Anaplasma spp. (Rickettsiales: Anaplasmataceae) in black-backed jackals (Canis mesomelas) in South Africa.

    Science.gov (United States)

    Penzhorn, Barend L; Netherlands, Edward C; Cook, Courtney A; Smit, Nico J; Vorster, Ilse; Harrison-White, Robert F; Oosthuizen, Marinda C

    2018-03-20

    Domestic dogs are not native to sub-Saharan Africa, which may account for their susceptibility to Babesia rossi, of which endemic black-backed jackals (Canis mesomelas) are natural reservoirs. There is virtually no information on the occurrence of potentially pathogenic haemogregarines (e.g. Hepatozoon canis) or even rickettsial bacteria (e.g. Ehrlichia spp. and Anaplasma spp.) in indigenous canids in sub-Saharan Africa. Such organisms could pose a risk to domestic dogs, as well as to populations of endangered indigenous canid species. Genomic DNA extracted from blood samples taken from 126 free-ranging and 16 captive black-backed jackals was subjected to reverse line blot (RLB) hybridization assay; 82 (57.8%) specimens reacted only with the Ehrlichia/Anaplasma genera-specific probe. Full-length bacterial 16S rRNA gene of five of these specimens was cloned and the recombinants sequenced. The ten 16S rDNA sequences obtained were most closely related, with approximately 99% identity, to Anaplasma sp. South African Dog, various uncultured Anaplasma spp., as well as various Anaplasma phagocytophilum genotypes. Ninety-one specimens were screened for haemogregarines through PCR amplification using the 18S rRNA gene; 20 (21.9%) specimens reacted positively, of which 14 (15.4%) were confirmed positive for Hepatozoon genotypes from within H. canis. Two (2.2%) specimens were found positive for two different Hepatozoon genotypes. Sequence analyses confirmed the presence of 16S rDNA sequences closely related to A. phagocytophilum and Anaplasma sp. South African Dog as well as two H. canis genotypes in both free-ranging and captive black-backed jackals. Distinguishing between closely related lineages may provide insight into differences in pathogenicity and virulence of various Anaplasma and H. canis genotypes. By building up a more comprehensive understanding of the range and diversity of the bacteria and eukaryotic organisms (piroplasms and haemogregarines) in the blood of

  15. Molecular cloning and characterization of arginine kinase gene of Toxocara canis.

    Science.gov (United States)

    Sahu, Shivani; Samanta, S; Harish, D R; Sudhakar, N R; Raina, O K; Shantaveer, S B; Madhu, D N; Kumar, Ashok

    2015-06-01

    Toxocara canis is an important gastrointestinal nematode of dogs and also a causative agent of visceral larva migrans in humans. Arginine kinase (AK) gene is one of the important biomolecule of phosphagen kinase of T. canis which is emerging as an exciting novel diagnostic target in toxocarosis. The present study was carried out to clone and characterize AK gene of T. canis for future utilization as a diagnostic molecule. Total RNA was extracted from intact adult worms and reverse transcription was done with oligo dT primers to obtain complementary DNA (cDNA). Polymerase chain reaction (PCR) was carried out using cDNA as template with specific primers which amplified a product of 1,202 bp. The amplicon was cloned into pDrive cloning vector and clone was confirmed by colony PCR and restriction endonuclease analysis. Sequence analysis of the gene showed 99.8 and 77.9 % homology with the published AK gene of T. canis (EF015466.1) and Ascaris suum respectively. Structural analysis shown that the mature AK protein consist of 400 amino acids with a molecular wt of 45360.73 Da. Further expression studies are required for producing the recombinant protein for its evaluation in the diagnosis of T. canis infection in humans as well as in adult dogs.

  16. Object permanence in domestic dogs (Canis lupus familiaris) and gray wolves (Canis lupus).

    Science.gov (United States)

    Fiset, Sylvain; Plourde, Vickie

    2013-05-01

    Recent evidence suggests that phylogenetic constraints exerted on dogs by the process of domestication have altered the ability of dogs to represent the physical world and the displacement of objects. In this study, invisible (Experiment 1) and visible (Experiment 2) displacement problems were administered to determine whether domestic dogs' and gray wolves' cognitive capacities to infer the position of a hidden object differ. The results revealed that adult dogs and wolves performed similarly in searching for disappearing objects: Both species succeeded the visible displacement tasks but failed the invisible displacement problems. We conclude that physical cognition for finding hidden objects in domestic dogs and gray wolves is alike and unrelated to the process of domestication.

  17. Serodetection of Ehrlichia canis amongst dogs in central Namibia

    Directory of Open Access Journals (Sweden)

    Rutendo Manyarara

    2015-06-01

    Full Text Available Ehrlichia canis is a major pathogen in dogs throughout Africa, yet it has not been reported in Namibia. The aim of this study was to determine the seroprevalence of canine ehrlichiosis in central Namibia using the ImmunoComb assay (Biogal, Galed Laboratories. The study included 76 dogs that presented to the Rhino Park Veterinary Clinic in the north-western suburb of Khomasdal, Windhoek, Namibia, as well as 30 stray dogs from the Windhoek branch of the Society for the Prevention of Cruelty to Animals. Of the 106 dogs tested, 53.8% were seropositive at titres > 1:80. Dogs that presented with symptoms of E. canis infection had a significantly higher seroprevalence (86.6% compared with apparently healthy dogs (41.6% (P = 0.00. Location of habitation was significant (P < 0.017, with a high percentage of dogs exposed to E. canis living in the northern or north-western part of Windhoek. As the first study to serologically establish E. canis as a major pathogen in dogs in central Namibia, it is notable that the highest proportion of seropositive dogs came from low-income areas. Further investigation is necessary to describe the ecology of this important tick-borne pathogen of companion animals in Namibia.

  18. Comparative Foraging Efficiency of Two Sympatric Jackals, Silver-Backed Jackals (Canis mesomelas) and Golden Jackals (Canis aureus), in the Ngorongoro Crater, Tanzania

    OpenAIRE

    Temu, S. E.; Nahonyo, C. L.; Moehlman, P. D.

    2016-01-01

    The foraging efficiency of two sympatric species of jackals, silver-backed jackals (Canis mesomelas) and golden jackals (Canis aureus), was studied in the Ngorongoro crater from July 2014 through May 2015. The focal animal observation method was used and individuals of both species were followed as they foraged from morning to evening. Observations of individuals of both jackal species were made from a vehicle using binoculars and a spotting scope. Three major parameters were used for determi...

  19. Prevalence of Toxoplasma gondii and Toxocara canis among Patients with Uveitis.

    Science.gov (United States)

    Lim, Su Jin; Lee, Sang Eun; Kim, Sun Hyun; Hong, Sung-Hee; You, Yong Sung; Kwon, Oh Woong; Kim, Hyeun Seung

    2015-04-01

    To investigate the prevalence of Toxoplasma gondii and Toxocara canis in patients with uveitis. Patients with uveitis were examined. Serum antibodies to T. gondii and T. canis were tested by using the enzyme-linked immunosorbent assay. Polymerase chain reaction (PCR) was done using blood and aqueous humor (AH). Ninety-eight patients were enrolled. Mean age was 43.5 ± 13.2 years. Six patients were seropositive for T. gondii with the following pattern: anterior uveitis, 1; posterior uveitis with retinitis, 2; pan uveitis, 2. One patient had a positive PCR result for T. gondii in AH, who showed panuveitis. Twenty-three patients were positive to serum IgG for T. canis with the following clinical manifestation: granuloma, 6; pigmented scar, 3; vitritis, 6--but none were PCR positive. T. gondii and T. canis are still important causes of uveitis. Ocular toxocariasis is not an uncommon cause of uveitis, even in adults.

  20. [Characterization of the genetic variability of field strains of Brucella canis isolated in Antioquia].

    Science.gov (United States)

    Vidal Arboleda, Juana L; Ortiz Roman, Luisa F; Olivera Angel, Martha

    2017-12-22

    Brucella canis is a facultative intracellular pathogen responsible for canine brucellosis, a zoonotic disease that affects canines, causing abortions and reproductive failure; and the production of non-specific symptoms in humans. In 2005 the presence of B. canis in Antioquia was demonstrated and the strains were identified as type 2. The sequencing of the genome of a field strain denoted Brucella canis str. Oliveri, showed species-specific indel events, which led us to investigate the genomic characteristics of the B. canis strain isolated and to establish the phylogenetic relationships and the divergence time of B. canis str. Oliveri. Conventional PCR sequencing was performed in 30 field strains identifying 5 indel events recognized in B. canis str. Oliveri. ADN from Brucella suis, Brucella melitensis and vaccine strains from Brucella abortus were used as control, and it was determined that all of the studied field strains shared 4 out of the 5 indels of the sequenced Oliveri strain, indicating the presence of more than one strain circulating in the region. Phylogenetic analysis was performed with 24 strains of Brucella using concatenated sequences of genetic markers for species differentiation. The molecular clock hypothesis and Tajima's relative rate test were tested, showing that the Oliveri strain, similarly to other canis species, diverged from B. suis. The molecular clock hypothesis between Brucella species was rejected and an evolution rate and a similar genetic distance between the B. canis were demonstrated. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  1. Study of cross-reactivity in serum samples from dogs positive for Leishmania sp., Babesia canis and Ehrlichia canis in enzyme-linked immunosorbent assay and indirect fluorescent antibody test Estudo da reatividade cruzada em amostras de soro de cães positivos para Leishmania sp., Babesia canis e Ehrlichia canis, pelo ensaio imunoenzimático indireto e pela reação de imunofluorescência indireta

    Directory of Open Access Journals (Sweden)

    Trícia Maria F. de Sousa Oliveira

    2008-03-01

    Full Text Available To verify the presence of cross-reaction among leishmaniosis, ehrlichiosis and babesiosis in serological diagnostics used in human visceral leishmaniasis control programs, serum samples from leishmaniasis endemic and non-endemic areas were collected and tested by Indirect Fluorescent Antibody (IFAT and Enzyme-linked immunosorbent assay (ELISA. All serum samples from endemic areas were positive for Leishmania sp., by ELISA and IFAT, 51% positive for Babesia canis and 43% for Ehrlichia canis by IFAT. None of the serum samples from non-endemic areas were positive for Leishmania sp., by IFAT, but 67% were positive for B. canis and 78% for E. canis using the same test. When tested by ELISA for Leishmania sp., four samples from non-endemic area were positive. These dogs were then located and no clinical signs, parasites or antibody was detected in new tests for a six month period. Only one of these 4 samples was positive for B. canis by IFAT and ELISA and three for E. canis by IFAT. The results of the work suggest a co-infection in the endemic area and no serological cross-reaction among these parasites by IFAT and ELISA.Para verificar a existência de reação cruzada entre leishmaniose visceral, erliquiose e babesiose, nos testes sorológicos utilizados em programas de controle da leishmaniose visceral humana, amostras de soro canino provenientes de áreas endêmicas e não endêmicas para essa enfermidade, foram testadas pela Reação de Imunofluorescência (RIFI e Ensaio imunoenzimático (ELISA. Todos os soros provenientes de área endêmica foram positivos para Leishmania sp pelo ELISA e RIFI, 51% para Babesia canis e 43% para Ehrlichia canis pela RIFI. Pela RIFI, nenhum dos soros provenientes de área não endêmica foi positivo para Leishmania sp, sendo 67% positivos para B. canis e 78% para E. canis pelo mesmo teste. Quando testados pelo ELISA para Leishmania sp., quatro soros da área não endêmica foram positivos. Os cães foram localizados

  2. Detection of Babesia canis vogeli and Hepatozoon canis in canine blood by a single-tube real-time fluorescence resonance energy transfer polymerase chain reaction assay and melting curve analysis.

    Science.gov (United States)

    Kongklieng, Amornmas; Intapan, Pewpan M; Boonmars, Thidarut; Thanchomnang, Tongjit; Janwan, Penchom; Sanpool, Oranuch; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

    2015-03-01

    A real-time fluorescence resonance energy transfer polymerase chain reaction (qFRET PCR) coupled with melting curve analysis was developed for detection of Babesia canis vogeli and Hepatozoon canis infections in canine blood samples in a single tube assay. The target of the assay was a region within the 18S ribosomal RNA gene amplified in either species by a single pair of primers. Following amplification from the DNA of infected dog blood, a fluorescence melting curve analysis was done. The 2 species, B. canis vogeli and H. canis, could be detected and differentiated in infected dog blood samples (n = 37) with high sensitivity (100%). The detection limit for B. canis vogeli was 15 copies of a positive control plasmid, and for H. canis, it was 150 copies of a positive control plasmid. The assay could simultaneously distinguish the DNA of both parasites from the DNA of controls. Blood samples from 5 noninfected dogs were negative, indicating high specificity. Several samples can be run at the same time. The assay can reduce misdiagnosis and the time associated with microscopic examination, and is not prone to the carryover contamination associated with the agarose gel electrophoresis step of conventional PCR. In addition, this qFRET PCR method would be useful to accurately determine the range of endemic areas or to discover those areas where the 2 parasites co-circulate. © 2015 The Author(s).

  3. Mycoplasma canis and urogenital disease in dogs in Norway

    DEFF Research Database (Denmark)

    L'Abee-Lund, T.M.; Heiene, R.; Friis, N.F.

    2003-01-01

    Mycoplasmas identified as Mycoplasma canis were isolated from nine dogs with clinical signs of urogenital disease in Norway over a period of 20 months. Some of the dogs had been treated unsuccessfully with antibiotics, and three were euthanased as a result of severe persistent disease. Seven...... of the dogs had a urinary tract infection, one had chronic purulent epididymitis and one had chronic prostatitis. Overt haematuria was frequently observed among the dogs with cystitis. M canis was isolated in pure culture from seven of the dogs and in mixed culture from the other two. In three cases...... the mycoplasma was cultivated only from urinary sediment, and it was typically obtained in smaller numbers than would be considered indicative of a urinary tract infection. In contrast with most mycoplasmas, the M canis isolated from all the dogs grew on ordinary blood agar plates used for routine...

  4. Cutaneous Hepatozoon canis infection in a dog from New Jersey.

    Science.gov (United States)

    Little, Liz; Baneth, Gad

    2011-05-01

    A 7-month-old mixed-breed intact female dog was presented to a private veterinarian with a 2 cm in diameter raised, pruritic, alopecic, subcutaneous, fluctuant swelling over the right eye. Cytology of the mass revealed many degenerate neutrophils, moderate numbers of eosinophils, moderate numbers of macrophages, rare mast cells, and few erythrocytes. Rare neutrophils contained a protozoal agent compatible with a Hepatozoon gamont. Real-time polymerase chain reaction of peripheral blood was positive for Hepatozoon canis. The complete sequence identity of the amplified 18S ribosomal RNA fragment from the dog's blood confirmed H. canis and proved it was relatively distant from the corresponding fragment sequence of Hepatozoon americanum. This case is important in documenting an unusual presentation of infection with H. canis outside of the southern United States. © 2011 The Author(s)

  5. First Case of Canine Infection with Hepatozoon canis (Apicomplexa: Haemogregarinidae) in the Republic of Korea.

    Science.gov (United States)

    Kwon, Seung-Joo; Kim, Yoon-Hee; Oh, Hyun-Hee; Choi, Ul-Soo

    2017-10-01

    This report describes a dog infected with Hepatozoon canis, the first canine infection in the Republic of Korea. A 2-year-old intact male Maltese dog presented with anorexia and depression. Physical examinations revealed mild dehydration and hyperthermia (39.8°C), and blood analysis showed pancytopenia. Diff-Quik staining of blood smear specimens showed the presence of ellipsoidal shaped structures (gamonts of H. canis) within a small number of neutrophils. Real-time PCR analysis using whole blood confirmed infection by H. canis. The clinical condition of the dog improved after symptomatic treatment and administration of doxycycline. Although a molecular epidemiologic survey in Korea showed H. canis infection of dogs, to our knowledge this is the first report of a dog infection in Korea molecularly shown to be H. canis.

  6. Neospora caninum and Ehrlichia canis co-infection in a dog with meningoencephalitis.

    Science.gov (United States)

    Aroch, Itamar; Baneth, Gad; Salant, Harold; Nachum-Biala, Yaarit; Berkowitz, Asaf; Shamir, Merav; Chai, Orit

    2018-06-01

    An 8-year-old mixed-breed dog was presented for acute, progressive weakness and ataxia, inappetence, and weight loss. The patient was mentally normal, but nonambulatory, with a right head tilt, right positional ventral strabismus, and slight head tremors. A neurologic lesion was localized to the cerebellum and right brainstem. Cerebrospinal fluid (CSF) analysis showed a markedly increased protein concentration and mixed pleocytosis, with eosinophil predominance (44%), intracytoplasmic inclusions within eosinophils, consistent with Ehrlichia canis (E canis) morulae, and Toxoplasma gondii (T gondii) or Neospora caninum (N caninum) tachyzoites within eosinophils and monocytes. A serum indirect immunofluorescent antibody test was positive for N caninum (titer 1:12 800) and negative for T gondii. Both blood and CSF PCR results were N caninum- and E canis-positive and T gondii- and Anaplasma phagocytophilum-negative, and blood PCR, but not CSF PCR, was Hepatozoon canis-positive. The dog was treated for 30 days with clindamycin, sulfamethoxazole-trimethoprim, doxycycline, prednisone, and cephalosporin, but did not improve neurologically, and was euthanized. Brain histopathology showed moderate multifocal, subacute meningoencephalitis with necrosis and gliosis. The neurologic disease was mostly attributed to central nervous system (CNS) neosporosis, with the possible contribution of ehrlichiosis, which was likely a manifestation of blood-brain barrier disruption. Hepatozoonosis was probably a result or cause of underlying immunosuppression. To our knowledge, this is the first report of CNSN caninum and E canis co-infection detected by both CSF PCR and cytology and E canis morulae identified within CSF eosinophils. © 2018 American Society for Veterinary Clinical Pathology.

  7. Transstadial Transmission of Hepatozoon canis by Rhipicephalus sanguineus (Acari: Ixodidae) in Field Conditions.

    Science.gov (United States)

    Aktas, M; Özübek, S

    2017-07-01

    This study investigated possible transovarial and transstadial transmission of Hepatozoon canis by Rhipicephalus sanguineus (Latreille) ticks collected from naturally infected dogs in a municipal dog shelter and the grounds of the shelter. Four hundred sixty-five engorged nymphs were collected from 16 stray dogs that were found to be infected with H. canis by blood smear and PCR analyses and maintained in an incubator at 28 °C for moulting. Four hundred eighteen nymphs moulted to adults 14-16 d post collection. Unfed ticks from the shelter grounds comprised 1,500 larvae, 2,100 nymphs, and 85 adults; were sorted according to origin, developmental stage, and sex into 117 pools; and screened by 18S rRNA PCR for Hepatozoon infection. Of 60 adult tick pools examined, 51 were infected with H. canis. The overall maximum likelihood estimate (MLE) of infection rate was calculated as 21.0% (CI 15.80-28.21). Hepatozoon canis was detected in 31 out of 33 female pools (MLE 26.96%, CI 17.64-44.33) and 20 out of 27 male pools (MLE 14.82%, CI 20.15-46.41). Among 42 unfed nymph pools collected from the shelter, 26 were infected with H. canis, and MLE of infection was calculated as 1.9% (CI 1.25-2.77). No H. canis DNA was detected in any of the gDNA pools consisting of larva specimens. Partial sequences of the 18S rRNA gene shared 99-100% similarity with the corresponding H. canis isolates. Our results revealed the transstadial transmission of H. canis by R. sanguineus, both from larva to nymph and from nymph to adult, in field conditions. However, there were no evidence of transovarial transmission. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Effect of Saprotrophic Soil Fungi on Toxocara canis Eggs

    Directory of Open Access Journals (Sweden)

    Ciarmela, M. L.

    2010-01-01

    Full Text Available The purpose of this work was to assess the ovicidal activity of Chrysosporium merdarium, Trichoderma harzianum, Fusarium oxysporum, F. moniliforme and F. sulphureum isolated from public areas in the city of La Plata, Argentina, on Toxocara canis eggs in vitro. Each species were cultured on water agar 2% with a suspension of immature-stage T. canis eggs. At 4, 7, 14, 21 and 28 days post-culture, they were observed by light and scanning electron microscopy. One hundred eggs were evaluated and scored according to Lỳsek’s ovicidal effect classification. These procedures were repeated three times which each fungal species. Chrysosporium merdarium and F. oxysporum showed very high ovicidal activity, F. sulphureum high ovicidal activity, F. moniliforme intermediate ovicidal activity and T. harzianum did not affect the viability of T. canis eggs. Taking into account the effects on human and animal health and the environment, the species with better prospects for studying its potential use as biological control was F. sulphureum.

  9. Molecular detection of Hepatozoon canis in dogs from Kerala.

    Science.gov (United States)

    Lakshmanan, Bindu; Jose, K Jain; George, Arun; Usha, N P; Devada, K

    2018-06-01

    India has a wide range of agro-climatic zones which is highly conducive for a diverse range of vectors and canines are continuously exposed to the risk of spectrum of tick borne protozoan diseases. The brown dog tick, Rhipicephalus sanguineus is widely prevalent among dogs in Kerala and there is a high prevalence of this tick transmitted Babesia and Ehrlichia spp. infection. However, the incidence of Hepatozoon canis transmitted by the same tick species had not been reported in the state since 2004. Preliminary screening of client owned dogs revealed six dogs to be positive for typical gelatin capsule shaped gamonts of H. canis within neutrophils in blood smear by microscopic examination. A PCR assay was standardized to amplify a specific 737 bp fragment of 18S rRNA gene of H. canis. Phylogenetic analysis revealed closest relationship with West Indies isolate deposited at GenBank database. The present study records the molecular detection of this haemoparasite in the state, for the first time.

  10. Sensitisation to aeroallergens among asthmatic and non-asthmatic adolescents living in a poor region in the Northeast of Brazil.

    Science.gov (United States)

    Sarinho, E C S; Mariano, J; Sarinho, S W; Medeiros, D; Rizzo, J A; Almerinda R, S; Solé, D

    2009-01-01

    To assess the kind and frequency of sensitisation to aeroallergens (skin prick test - SPT) of asthmatic and non-asthmatic adolescents (13-14 years old) living in the city of Caruaru, Northeast of Brazil, and to analyse their exposure to some environmental factors. A case-control study was conducted with asthmatic (50) and non-asthmatic (150) adolescents diagnosed by the International Study of Asthma and Allergies in Childhood (ISAAC) written questionnaire. All were submitted to SPT with aeroallergens (house dust mites, cat and dog epithelium, cockroaches, moulds and grass) and completed a questionnaire to evaluate their environmental exposure. There were no significant differences between groups regarding gender, age, number of siblings and environmental exposure. Asthmatic subjects exhibited a higher frequency of positive SPTs than non-asthmatic subjects (54.0% vs 33.3%, p=0.009) mainly due to Periplaneta americana (34.0% vs 12.7%, p=0.0007 respectively) and Canis familiaris (20.0% vs 8.7%, p=0.029). Although sensitisation to aeroallergens was high among non-asthmatic adolescents, asthma was associated with parental history of atopic disease and sensitisation to P. americana and Canis familiaris but not to D. pteronyssinus showing that local studies are mandatory for the tailoring of appropriate management of allergic diseases.

  11. Trichoderma virens as a biocontrol of Toxocara canis: In vivo evaluation.

    Science.gov (United States)

    de Souza Maia Filho, Fernando; da Silva Fonseca, Anelise Oliveira; Persici, Beatriz Maroneze; de Souza Silveira, Julia; Braga, Caroline Quintana; Pötter, Luciana; de Avila Botton, Sônia; Brayer Pereira, Daniela Isabel

    Microorganisms have been widely studied as biological control agents of parasites of medical and veterinary importance. Coprophagous arthropods, bacteria and fungi are among the different organisms evaluated as potential biological control agents. Nematophagous fungi capture and digest the free forms of nematodes in the soil. Due to its zoonotic potential, Toxocara canis have been brought to the attention of researchers. The aim of the present study was to determine whether the administration of embryonated T. canis eggs exposed to the nematophagous fungus Trichoderma virens reduces parasite infection in experimental animals. Embryonated T. canis eggs were exposed to T. virens mycelium for 15 days at 25°C. Subsequently, 100 fungus-exposed eggs were orally administered to 20 Swiss mice. As a positive control, another 20 mice received 100 embryonated eggs that were not exposed to the fungus. After 48h, the animals were killed, and heart, lungs and liver were harvested for the recovery of larvae. The organs of the animals that received embryonated T. canis eggs exposed to the fungus showed a lower mean larval recovery when compared with the animals that received embryonated eggs without fungus exposure (p<0.05). The exposure of T. canis eggs to T. virens reduces the experimental infection, demonstrating the potential of this nematophagous fungus as a biocontrol agent. Copyright © 2016 Asociación Española de Micología. Publicado por Elsevier España, S.L.U. All rights reserved.

  12. Description of dogs naturally infected with Hepatozoon canis in the Aegean region of Turkey

    OpenAIRE

    PAŞA, Serdar; KIRAL, Funda; KARAGENÇ, Tülin; ATASOY, Abidin; SEYREK, Kamil

    2009-01-01

    Clinical and laboratory findings recorded in 10 dogs naturally infected with Hepatozoon canis in the Aegean region of Turkey were reported. The diagnosis was made by finding H. canis gamonts within leucocytes in Giemsa-stained blood smears. H. canis parasitaemia level was calculated manually by counting 500 neutrophils in blood smears. Parasitaemia varied from 1% to 23% of the circulating neutrophils. Anorexia, fever, depression, weight loss, and lymphadenopathy are the main clinical signs in...

  13. A new PCR assay for the detection and differentiation of Babesia canis and Babesia vogeli.

    Science.gov (United States)

    Annoscia, Giada; Latrofa, Maria Stefania; Cantacessi, Cinzia; Olivieri, Emanuela; Manfredi, Maria Teresa; Dantas-Torres, Filipe; Otranto, Domenico

    2017-10-01

    Babesia spp. are globally distributed tick-borne protozoan parasites that infect the red blood cells of a wide range of vertebrate hosts, including humans. Diagnosis of babesiosis is often impeded by the transient presence of the parasites in peripheral blood, as well as by their pleomorphic nature. Given the reports of an expanding and, in some cases, sympatric geographical distribution of Babesia canis and Babesia vogeli in dogs and associated vectors, in Europe, the development of time-efficient and cost-effective diagnostic tools to detect and differentiate these two species is warranted. In this study, we designed and developed a novel polymerase chain reaction (PCR) assay targeting the parasite cytochrome c oxidase subunit 1 (cox1) gene, for the simultaneous detection and differentiation of B. canis and B. vogeli. The analytical sensitivity of the PCR was evaluated using serial dilutions of genomic DNA extracted from individual and artificially mixed canine blood samples infected by B. canis (3×10 2 infected erythrocytes/ml, ie/ml) and B. vogeli (2.1×10 1 ie/ml). The analytical specificity of the assay was assessed using blood samples positive for Hepatozoon canis, Ehrlichia canis, Anaplasma platys, Babesia microti, Babesia rossi and Theileria annae (syn. Babesia vulpes). The clinical specificity of the PCR assay was evaluated on 147 blood samples from dogs and 128 tick specimens (Dermacentor reticulatus and Rhipicephalus sanguineus sensu lato). Species-specific bands of the expected sizes (i.e., 750bp for B. canis and 450bp for B. vogeli), and two bands in the mixed blood samples were obtained. The PCR assay developed herein detected a low number of infected erythrocytes (i.e., 3×10 -2 B. canis, 2.1×10 -2 B. vogeli ie/ml). Of the 147 blood samples, nine (6.1%) were positive for B. canis and six (4.1%) for B. vogeli, whereas only one tick (D. reticulatus) was positive for B. canis. This PCR assay represents a rapid and reliable tool for the diagnosis of B

  14. FIRST CASE OF AUTOCHTHONOUS HUMAN VISCERAL LEISHMANIASIS IN THE URBAN CENTER OF RIO DE JANEIRO: CASE REPORT

    OpenAIRE

    Silva, Guilherme Almeida Rosa da; Boechat, Thiago de Oliveira; Ferry, Fernando Raphael de Almeida; Pinto, Jorge Francisco da Cunha; Azevedo, Marcelo Costa Velho Mendes de; Carvalho, Ricardo de Souza; Motta, Rogerio Neves; Veras, Mariana Ferreira

    2014-01-01

    Visceral leishmaniasis is an anthropozoonosis that is caused by protozoa of the genus Leishmania, especially Leishmania (Leishmania) infantum, and is transmitted to humans by the bite of sandflies of the genus Lutzomyia, such as Lutzomyia longipalpis. There are many reservoirs, including Canis familiaris. It is a chronic infectious disease with systemic involvement that is characterized by three phases: the initial period, the state period and the final period. The main symptoms are fever, ma...

  15. A critical reflection on current control of Toxocara canis in household dogs

    NARCIS (Netherlands)

    Nijsse, E.R.|info:eu-repo/dai/nl/314103198

    2016-01-01

    Toxocara canis is a roundworm that is common worldwide and also in Dutch household dogs. Adult stages of T. canis can be present in the small intestines of dogs where they produce large numbers of eggs that are shed in the environment (patent infection). Because very young dogs and humans can

  16. Investigation of tick vectors of Hepatozoon canis in Brazil.

    Science.gov (United States)

    Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena

    2013-12-01

    Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil. Copyright © 2013 Elsevier GmbH. All rights

  17. Tissue distribution and functional analysis of vitellogenin-6 of Toxocara canis.

    Science.gov (United States)

    Zhu, Hong-Hong; Ma, Guang-Xu; Luo, Yong-Fang; Luo, Yong-Li; Yin, Sha-Sha; Xiong, Yi; Zhou, Rong-Qiong

    2017-06-01

    Toxocara canis is an common intestinal nematode of canids and the principal causative agent of human toxocariasis. Vitellogenin (Vg), a source of amino acids and lipids in the eggs, are considered to play an important role in embryo development of a wide range of organisms. In the present study, the transcriptional levels of Tc-vit-6 gene in male and female adult T. canis were determined by quantitative real-time PCR, which indicated high transcription of Tc-vit-6 in the intestine, reproductive tract and body wall of male and female adult T. canis. The fragment of Tc-vit-6 encoding a vWD domain, was cloned and expressed to produce a rabbit anti-TcvWD polyclonal antibody. Tissue distribution of TcVg6 was detected by immunohistochemical assays, which showed predominant distribution of TcVg6 in the tissues of intestine, as well as reproductive tract (including some of the germ cells) and musculature of male and female adult worms. Collectively, these results indicated multiple biological roles of TcVg6 apart from that in the reproduction of T. canis. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Trophic cascades linking wolves (Canis lupus), coyotes (Canis latrans), and small mammals

    Science.gov (United States)

    Miller, B.J.; Harlow, H.J.; Harlow, T.S.; Biggins, D.; Ripple, W.J.

    2012-01-01

    When large carnivores are extirpated from ecosystems that evolved with apex predators, these systems can change at the herbivore and plant trophic levels. Such changes across trophic levels are called cascading effects and they are very important to conservation. Studies on the effects of reintroduced wolves in Yellowstone National Park have examined the interaction pathway of wolves (Canis lupus L., 1758) to ungulates to plants. This study examines the interaction effects of wolves to coyotes to rodents (reversing mesopredator release in the absence of wolves). Coyotes (Canis latrans Say, 1823) generally avoided areas near a wolf den. However, when in the proximity of a den, they used woody habitats (pine or sage) compared with herbaceous habitats (grass or forb or sedge)- when they were away from the wolf den. Our data suggested a significant increase in rodent numbers, particularly voles (genus Microtus Schrank, 1798), during the 3-year study on plots that were within 3 km of the wolf den, but we did not detect a significant change in rodent numbers over time for more distant plots. Predation by coyotes may have depressed numbers of small mammals in areas away from the wolf den. These factors indicate a top-down effect by wolves on coyotes and subsequently on the rodents of the area. Restoration of wolves could be a powerful tool for regulating predation at lower trophic levels.

  19. Novel genotype of Ehrlichia canis detected in samples of human blood bank donors in Costa Rica.

    Science.gov (United States)

    Bouza-Mora, Laura; Dolz, Gaby; Solórzano-Morales, Antony; Romero-Zuñiga, Juan José; Salazar-Sánchez, Lizbeth; Labruna, Marcelo B; Aguiar, Daniel M

    2017-01-01

    This study focuses on the detection and identification of DNA and antibodies to Ehrlichia spp. in samples of blood bank donors in Costa Rica using molecular and serological techniques. Presence of Ehrlichia canis was determined in 10 (3.6%) out of 280 blood samples using polymerase chain reaction (PCR) targeting the ehrlichial dsb conserved gene. Analysis of the ehrlichial trp36 polymorphic gene in these 10 samples revealed substantial polymorphism among the E. canis genotypes, including divergent tandem repeat sequences. Nucleotide sequences of dsb and trp36 amplicons revealed a novel genotype of E. canis in blood bank donors from Costa Rica. Indirect immunofluorescence assay (IFA) detected antibodies in 35 (35%) of 100 serum samples evaluated. Thirty samples showed low endpoint titers (64-256) to E. canis, whereas five sera yielded high endpoint titers (1024-8192); these five samples were also E. canis-PCR positive. These findings represent the first report of the presence of E. canis in humans in Central America. Copyright © 2016 Elsevier GmbH. All rights reserved.

  20. Comparative study of Microsporum canis isolates by DNA fingerprinting.

    Science.gov (United States)

    Shafiee, Shabnam; Khosravi, Ali Reza; Ashrafi Tamai, Iradj

    2014-08-01

    Microsporum canis is a zoophilic fungus and it is an important agent of dermatophytosis. Cats act as important reservoirs. Clinically, it is too difficult to differentiate dermatophytosis caused by various species, also this fungus loses its morphological characteristics easily because of subculture; so using of rapid and accurate laboratory techniques for identifying the dermatophytes is important, therefore, RAPD-PCR was applied for the differentiation of the isolates. In this study, 10 M. canis isolates were detected in cats, dog, human, fox and rabbit at the Mycology Research Center, Faculty of Veterinary Medicine, University of Tehran. For running the RAPD-PCR, PCR set system and three random primers OPU 15, OPU 13 and OPA 04 were used. Then phylogenetic tree and similarity coefficient table were drawn. The results showed that there were some common bands between M. canis isolates. There were some specific bands for each isolates, as well. Our study showed, despite the typical morphology of the whole isolates, they were placed in different branches in molecular typing. © 2014 Blackwell Verlag GmbH.

  1. Acquisition and transmission of Hepatozoon canis (Apicomplexa: Hepatozoidae) by the tick Amblyomma ovale (Acari: Ixodidae).

    Science.gov (United States)

    Rubini, A S; Paduan, K S; Martins, T F; Labruna, M B; O'Dwyer, L H

    2009-10-14

    The present study aimed to evaluate under controlled conditions the acquisition of Hepatozoon canis by Amblyomma ovale after feeding on infected dogs, and the subsequent induction of infection in uninfected dogs that ingested the experimentally infected ticks. Two H. canis naturally infected dogs were infested with A. ovale adult ticks derived from an uninfected laboratory tick colony. After feeding, two A. ovale females presented H. canis oocysts in the hemolymph at the first and fourth days after removal of ticks from dogs. The oocysts had an average size of 244.34 microm x 255.46 microm. Three uninfected dogs were fed with ticks previously fed on the infected dogs. Only one dog became infected 32 days after oral inoculation, presenting circulating gametocytes, parasitemia less than 1%, and positive PCR confirmed to be H. canis by DNA sequencing. The results obtained indicated A. ovale ticks as potential vector of H. canis in rural areas of Brazil.

  2. Cross-infection between cats and cows: Origin and control of Streptococcus canis mastitis in a dairy herd

    OpenAIRE

    Tikofsky, L L; Zadoks, R N

    2005-01-01

    Group G streptococci in animals usually belong to the species Streptococcus canis and are most commonly found in dogs and cats. Occasionally, Strep. canis is detected in milk from dairy cows. An outbreak of Strep. canis mastitis in a dairy herd is described. Based on results from bacterial culture and ribotyping, a cat with chronic sinusitis was the most likely source of the outbreak. Subsequent cow-to-cow transmission of Strep. canis was facilitated by poor udder health management, including...

  3. Spatial distribution of Anaplasma phagocytophilum and Hepatozoon canis in red foxes (Vulpes vulpes) in Hungary.

    Science.gov (United States)

    Tolnai, Z; Sréter-Lancz, Z; Sréter, T

    2015-07-01

    In recent years, Ehrlichia canis and Hepatozoon canis transmitted by Rhipicephalus sanguineus were reported from Hungary. The aim of the present study was to reveal the spatial distribution pattern of pathogens transmitted by R. sanguineus in a sentinel species, red fox (Vulpes vulpes) in Hungary and to analyse the relationship of these patterns with landscape and climate by geographical information systems. Fox carcasses, representing 0.5% of the total fox population were randomly selected out of all the foxes of Hungary. The spleen samples of the animals were tested by real-time PCR for Anaplasma platys, Babesia vogeli, E. canis and H. canis infection. Positive results were confirmed by conventional PCR followed by sequencing. The prevalence of H. canis infection was 22.2% (95% CI=18.4-26.4%), and this parasite was detected in all areas including the mountain regions of Hungary. These findings indicate that other tick species or other transmission routes (oral and transplacental) might be in the background of the countrywide distribution of H. canis. Anaplasma platys was not found; nevertheless, the prevalence of Anaplasma phagocytophilum infection transmitted by Ixodes ricinus was 12.5% (95% CI=9.7-16.1%) in foxes. B. vogeli and E. canis infection was not detected. There was no correlation between environmental parameter values in the home range of foxes and A. phagocytophilum or H. canis infection, which is in line with that observed in the case of tick species infesting foxes in Hungary. The results of this study indicate that R. sanguineus, if present, might be rare in Hungary. Our baseline study can be used for future evaluation of the effect of climate change on the spreading and emergence of R. sanguineus transmitted pathogens in Hungary. Copyright © 2015 Elsevier GmbH. All rights reserved.

  4. Molecular Survey of Hepatozoon canis in Red Foxes (Vulpes vulpes) from Romania.

    Science.gov (United States)

    Imre, Mirela; Dudu, Andreea; Ilie, Marius S; Morariu, Sorin; Imre, Kálmán; Dărăbuş, Gheorghe

    2015-08-01

    Blood samples of 119 red foxes, originating from 44 hunting grounds of 3 western counties (Arad, Hunedoara, and Timiş) of Romania, have been examined for the presence of Hepatozoon canis infection using the conventional polymerase chain reaction (PCR) of the fragment of 18S rRNA gene. Overall, 15 (12.6%) samples were found to be PCR-positive. Of the sampled hunting grounds, 29.5% (13/44) were found positive. Positive samples were recorded in all screened counties with the prevalence of 14.8% (9/61) in Arad, 9.8% (5/51) in Timiş, and 14.3% (1/7) in Hunedoara, respectively. No correlation was found (P > 0.05) between H. canis positivity and gender or territorial distribution of the infection. To confirm PCR results, 9 randomly selected amplicons were sequenced. The obtained sequences were identical to each other, confirmed the results of the conventional PCR, and showed 98-100% homology to other H. canis sequences. The results of the current survey support the role of red foxes as sylvatic reservoirs of H. canis in Romania.

  5. Scanning electron microscopy description of a new species of Demodex canis spp.

    Science.gov (United States)

    Tamura, Y; Kawamura, Y; Inoue, I; Ishino, S

    2001-10-01

    Between 1997 and 1999, the prevalence of Demodex canis mites was determined in 150 dogs. In two dogs, we found two different species of mites; Demodex canis and another, unidentified, Demodex mite. The unidentified Demodex mite species had several different morphological features. First, it had a short opisthosoma and an obtuse end. In addition, the fourth coxisternal plate was rectangular and there was a band-like segmental plate between the fourth coxisternal plate and opisthosoma. Although all of the morphology and the development of male mites could not be investigated in this study, the location of the opisthosoma and the genital pore clearly differed from Demodex canis, suggesting that this unidentified mite is a new species.

  6. Demodicosis caused by Demodex canis and Demodex cornei in dogs

    OpenAIRE

    Sivajothi, S.; Sudhakara Reddy, B.; Rayulu, V. C.

    2013-01-01

    Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears ...

  7. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-03-01

    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  8. First isolation and molecular characterization of Ehrlichia canis in Costa Rica, Central America.

    Science.gov (United States)

    Romero, L E; Meneses, A I; Salazar, L; Jiménez, M; Romero, J J; Aguiar, D M; Labruna, M B; Dolz, G

    2011-08-01

    The present study investigated Ehrlichia species in blood samples from dogs suspected of clinical ehrlichiosis, using molecular and isolation techniques in cell culture. From a total of 310 canine blood samples analyzed by 16S rRNA nested PCR, 148 (47.7%) were positive for Ehrlichia canis. DNA from Ehrlichia chaffeensis or Ehrlichia ewingii was not detected in any sample using species-specific primers in separated reactions. Leukocytes from five PCR-positive dogs were inoculated into DH82 cells; successful isolation of E. canis was obtained in four samples. Partial sequence of the dsb gene of eight canine blood samples (including the five samples for in vitro isolation) was obtained by PCR and their analyses through BLAST showed 100% of identity with the corresponding sequence of E. canis in GenBank. This study represents the first molecular diagnosis, isolation, and molecular characterization of E. canis in dogs from Costa Rica. Copyright © 2010 Elsevier Ltd. All rights reserved.

  9. Hepatozoon canis (James, 1905 in dogs from Uberlândia, Minas Gerais. Reports of two cases.

    Directory of Open Access Journals (Sweden)

    Antonio Vicente Mundim

    1992-12-01

    Full Text Available Hepatozoon canis gametocytes, measuring 9,56 µm x 5,60 µm were identified in circulating leukocytes of two dogs admitted to the Veterinary Hospital of the Universidade Federal de Uberlândia. Morulae of Ehrlichia canis were also found in circulating monocytes. The authors report the first occurrence of H. canis in Uberlândia, Minas Gerais state.

  10. Cross-infection between cats and cows: origin and control of Streptococcus canis mastitis in a dairy herd.

    Science.gov (United States)

    Tikofsky, L L; Zadoks, R N

    2005-08-01

    Group G streptococci in animals usually belong to the species Streptococcus canis and are most commonly found in dogs and cats. Occasionally, Strep. canis is detected in milk from dairy cows. An outbreak of Strep. canis mastitis in a dairy herd is described. Based on results from bacterial culture and ribotyping, a cat with chronic sinusitis was the most likely source of the outbreak. Subsequent cow-to-cow transmission of Strep. canis was facilitated by poor udder health management, including use of a common udder cloth and failure to use postmilking teat disinfection. Infected cows had macroscopically normal udders and milk, but significantly higher somatic cell counts than Strep. canis-negative herd mates. The outbreak was controlled through antibiotic treatment of lactating cows, early dry-off with dry cow therapy, culling of infected animals, and implementation of standard mastitis prevention measures. Cure was significantly more likely in dry-treated cows (87.5%) and cows treated during lactation (67%) than in untreated cows (9%). Whereas mastitis due to group G streptococci or Strep. canis in dairy cows is usually limited to sporadic cases of environmental (canine or feline) origin, this case study shows that crossing of the host species barrier by Strep. canis may result in an outbreak of mastitis if management conditions are conducive to contagious transmission. In such a situation, measures that are successful in control of Strep. agalactiae can also be used to control Strep. canis mastitis.

  11. Recurrent patent infections with Toxocara canis in household dogs older than six months

    NARCIS (Netherlands)

    Nijsse, Rolf; Mughini-Gras, Lapo; Wagenaar, Jaap A.; Ploeger, Harm W.

    2016-01-01

    Background: To reduce environmental contamination with Toxocara canis eggs, the current general advice is to deworm all dogs older than six months on average four times a year. However, only a small proportion of non-juvenile household dogs actually shed T. canis eggs, and some dogs shed eggs

  12. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L S

    1988-12-31

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  13. A case report: a dog with acute onset of Hepatozoon canis infection.

    Science.gov (United States)

    Sakuma, Masato; Nakahara, Yoshitaka; Suzuki, Hiroyuki; Uchimura, Masato; Sekiya, Zin; Setoguchi, Asuka; Endo, Yasuyuki

    2009-06-01

    We present a clinical overview of a dog with acute onset of Hepatozoon canis infection. A stray female beagle dog of unknown age was referred to Kagoshima University showing anemia. Blood tests revealed the presence of anemia, thrombocytopenia, hyperproteinemia, polyclonal gammopathy, hypoalbuminemia, and elevated creatine kinase and alkaline phosphatase activities. In addition, capsule-like organisms were detected in the cytoplasm of approximately 50% of neutrophils in blood smears. H. canis infection was confirmed by polymerase chain reaction and DNA sequencing analyses. Amplified DNA fragments revealed 100% identity to the 18S ribosomal RNA gene of H. canis. The clinical symptoms improved after the administration of antibiotics. Hepatozoonosis in dogs is rare, but veterinarians should be alert to its possible acute onset.

  14. Sarcoptic-mange detector dogs used to identify infected animals during outbreaks in wildlife

    OpenAIRE

    Alasaad, Samer; Permunian, Roberto; Gakuya, Francis; Mutinda, Matthew N.; Soriguer, Ramón C.; Rossi, Luca

    2012-01-01

    Abstract Background One of the main aims of forensic investigation is the detection and location of people and substances of interest, such as missing people and illegal drugs. Dogs (Canis lupus var. familiaris) have had an important role in legal and forensic investigations for decades; nonetheless canines’ keen sense of smell has never been utilized in either the surveillance or control of wildlife diseases. The rapid removal and treatment of infected carcasses and/or sick animals is a key ...

  15. Epidemiological aspects and spatial distribution of human and canine visceral leishmaniasis in an endemic area in northeastern Brazil

    OpenAIRE

    Roseane Campos; Márcio Santos; Gabriel Tunon; Luana Cunha; Lucas Magalhães; Juliana Moraes; Danielle Ramalho; Sanmy Lima; José Antônio Pacheco; Michael Lipscomb; Amélia Ribeiro de Jesus; Roque Pacheco de Almeida

    2017-01-01

    Visceral leishmaniasis (VL) is a systemic disease endemic in tropical countries and transmitted through sand flies. In particular, Canis familiaris (or domesticated dogs) are believed to be a major urban reservoir for the parasite causing the disease Leishmania. The average number of human VL cases was 58 per year in the state of Sergipe. The city of Aracaju, capital of Sergipe in Northeastern Brazil, had 159 cases of VL in humans. Correlatively, the percentage of serologically positive dogs ...

  16. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: leeinho1974@hanmail.ne [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: st7.kim@hotmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: odk6464@nate.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: drpjeon@gmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)

    2010-08-15

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  17. MRI findings of spinal visceral larva migrans of Toxocara canis

    International Nuclear Information System (INIS)

    Lee, In Ho; Kim, Sung Tae; Oh, Dae Kun; Kim, Hyung-Jin; Kim, Keon Ha; Jeon, Pyoung; Byun, Hong Sik

    2010-01-01

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  18. Molecular characterization of Hepatozoon canis in dogs from Colombia.

    Science.gov (United States)

    Vargas-Hernandez, Giovanni; André, Marcos R; Munhoz, Thiago D; Faria, Joice M L; Machado, Rosangela Z; Tinucci-Costa, Mirela

    2012-01-01

    Hepatozoonosis is a tick-borne disease whose transmission to dogs occurs by ingestion of oocysts infected ticks or feeding on preys infested by infected ticks. Until now, there is no previous report of molecular characterization of Hepatozoon sp. in dogs from Colombia. EDTA blood samples were collected from 91 dogs from central-western region of Colombia (Bogotá, Bucaramanga, and Villavicencio cities) and submitted to 18S rRNA Hepatozoon sp. PCR and blood smears confection. Phylogenetic analysis was used to access the identity of Hepatozoon species found in sampled dogs. From 91 sampled dogs, 29 (31.8%) were positive to Hepatozoon sp. (25 dogs were only positive in PCR, 1 was positive only in blood smears, and 3 were positive in both blood smears and PCR). After sequencing, the found Hepatozoon sp. DNA showed 100% of identity with Hepatozoon canis DNA isolates. The phylogenetic tree supported the identity of the found Hepatozoon sp. DNA, showing that the isolates from Colombia were placed in the same clade than other H. canis isolates from Venezuela, Spain, and Taiwan. This is the first molecular detection of H. canis in dogs from Colombia.

  19. Genetic and Antigenic Evidence Supports the Separation of Hepatozoon canis and Hepatozoon americanum at the Species Level

    OpenAIRE

    Baneth, Gad; Barta, John R.; Shkap, Varda; Martin, Donald S.; Macintire, Douglass K.; Vincent-Johnson, Nancy

    2000-01-01

    Recognition of Hepatozoon canis and Hepatozoon americanum as distinct species was supported by the results of Western immunoblotting of canine anti-H. canis and anti-H. americanum sera against H. canis gamonts. Sequence analysis of 368 bases near the 3′ end of the 18S rRNA gene from each species revealed a pairwise difference of 13.59%.

  20. The dog mite, Demodex canis: prevalence, fungal co-infection, reactions to light, and hair follicle apoptosis.

    Science.gov (United States)

    Tsai, Yu-Jen; Chung, Wen-Cheng; Wang, Lian-Chen; Ju, Yu-Ten; Hong, Chin-Lin; Tsai, Yu-Yang; Li, Yi-Hung; Wu, Ying-Ling

    2011-01-01

    Infection rate, reaction to light, and hair follicle apoptosis are examined in the dogmite, Demodex canis Leydig (Prostigmata: Demodicidae), in dogs from the northern area of Taiwan. An analysis of relevant samples revealed 7.2% (73/1013) prevalence of D. canis infection. Infection during the investigation peaked each winter, with an average prevalence of 12.5% (32/255). The infection rates significantly varied in accordance with month, sex, age, and breed (p canis Bodin (Onygenales: Arthrodermataceae) and Trichophyton mentagrophyte Robin (Blanchard) on the D. canis infected dogs revealed prevalence rates of 4.4% (2/45) and 2.2% (1/45), respectively. Observations demonstrated that D. canis slowly moved from a light area to a dark area. Skin samples were examined for cellular apoptosis by activated caspase3 immunohistochemical staining. Cells that surrounded the infected hair follicles were activated caspase3-positive, revealing cell apoptosis in infected follicles via the activation of caspase3.

  1. Urinary creatinine to serum creatinine ratio and renal failure index in dogs infected with Babesia canis.

    Science.gov (United States)

    Zygner, Wojciech; Gójska-Zygner, Olga; Wesołowska, Agnieszka; Wędrychowicz, Halina

    2013-09-01

    Urinary creatinine to serum creatinine (UCr/SCr) ratio and renal failure index (RFI) are useful indices of renal damage. Both UCr/SCr ratio and RFI are used in differentiation between prerenal azotaemia and acute tubular necrosis. In this work the authors calculated the UCr/SCr ratio and RFI in dogs infected with Babesia canis and the values of these indices in azotaemic dogs infected with the parasite. The results of this study showed significantly lower UCr/SCr ratio in dogs infected with B. canis than in healthy dogs. Moreover, in azotaemic dogs infected with B. canis the UCr/SCr ratio was significantly lower and the RFI was significantly higher than in non-azotaemic dogs infected with B. canis. The calculated correlation between RFI and duration of the disease before diagnosis and treatment was high, positive and statistically significant (r = 0.89, p caused by B. canis in Poland acute tubular necrosis may develop.

  2. 76 FR 81665 - Endangered and Threatened Wildlife and Plants; Revising the Listing of the Gray Wolf (Canis lupus...

    Science.gov (United States)

    2011-12-28

    ... Wolf (Canis lupus) in the Western Great Lakes; Final rule #0;#0;Federal Register / Vol. 76, No. 249... (Canis lupus) in the Western Great Lakes AGENCY: Fish and Wildlife Service, Interior. ACTION: Final rule... Minnesota population of gray wolves (Canis lupus) to conform to current statutory and policy requirements...

  3. Molecular Detection and Prevalence of Hepatozoon canis in Dogs from Punjab (Pakistan) and Hematological Profile of Infected Dogs.

    Science.gov (United States)

    Qamar, Muhammad; Malik, Muhammad Irfan; Latif, Muhammad; Ain, Qurat Ul; Aktas, Munir; Shaikh, Rehan Sadiq; Iqbal, Furhan

    2017-03-01

    The intraleukocytic parasite, Hepatozoon canis, causes the sometimes fatal tick borne disease canine hepatozoonosis. In this study, dogs from Islamabad, Lahore, and Multan Districts of the Punjab region of Pakistan were surveyed to investigate the presence and prevalence of H. canis infection and to determine the effects of the parasite on hematological parameters. Blood samples were collected from 151 domestic dogs (149 pet, 2 stray) of both sexes and varying ages. Data on sex, age, tick infestation, and clinical factors (body temperature, mucous membrane status, and presence of hematuria and vomiting) were collected. Using PCR, 18 dogs (11.9%) were found positive for the presence of H. canis DNA. Partial sequences of the 18S rRNA gene shared 99-100% similarity with the corresponding H. canis isolates. This epidemiological survey revealed higher prevalence of H. canis in Islamabad (11/49, 22.4%) compared to Lahore (3/52, 5.8%) and Multan (4/50, 8%) in Pakistan. No investigated epidemiological or clinical factors were found to be associated with the presence of H. canis (p > 0.05) in dogs. H. canis positive dogs exhibited higher minimum inhibitory dilution (p = 0.04), mixed inclusion (p = 0.008) and relative distribution width of red blood cells (p = 0.02), and lower hematocrit (p = 0.03) and mean hemoglobin content (p = 0.03) than did dogs in which H. canis was not detected. We are recommending this PCR-based protocol to the veterinary practitioners for the detection and/or confirmation of H. canis in dogs suspected for hepatozoonosis to improve their health status.

  4. Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Valéria Dutra

    2012-06-01

    Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

  5. Genetic and Antigenic Evidence Supports the Separation of Hepatozoon canis and Hepatozoon americanum at the Species Level

    Science.gov (United States)

    Baneth, Gad; Barta, John R.; Shkap, Varda; Martin, Donald S.; Macintire, Douglass K.; Vincent-Johnson, Nancy

    2000-01-01

    Recognition of Hepatozoon canis and Hepatozoon americanum as distinct species was supported by the results of Western immunoblotting of canine anti-H. canis and anti-H. americanum sera against H. canis gamonts. Sequence analysis of 368 bases near the 3′ end of the 18S rRNA gene from each species revealed a pairwise difference of 13.59%. PMID:10699047

  6. Efficacy of Zingiber officinale ethanol extract on the viability, embryogenesis and infectivity of Toxocara canis eggs.

    Science.gov (United States)

    El-Sayed, Nagwa Mostafa

    2017-12-01

    This study evaluated the effect of Zingiber officinal e ( Z. officinal e) ethanol extract on the viability, embryogenesis and infectivity Toxocara canis ( T. canis ) eggs. It was carried out both in vitro and in vivo. In the in vitro experiment, unembryonated T. canis eggs were incubated with 25, 50 and 100 mg/mL Z. officinal e extract at 25 °C for 6, 12, and 24 h to assess the effect of Z. officinal e on their viability and for two weeks to assess the effect of Z. officinal e on their embryogenesis. In vivo experiment was performed to assess the effect of Z. officinal e on infectivity of T. canis eggs. Treated embryonated eggs by Z. officinale extract at concentrations of 25, 50 and 100 mg/mL for 24 h were inoculated into mice and their livers were examined for the presence of T. canis larvae on the 7th day after infection and for histopathological evaluation at 14th day post-infection. Z. officinal e showed a significant ovicidal activity on T. canis eggs. The best effect was observed with 100 mg/mL concentration after 24 h with an efficacy of 98.2%. However, the treated eggs by 25, 50 mg/mL of Z. officinale extract after 24 h showed ovicidal activity by 59.22 and 82.5% respectively. Moreover, this extract effectively inhibited T. canis eggs embryogenesis by 99.64% and caused their degeneration at the concentration of 100 mg/mL after 2 weeks of treatment. However, the lower concentrations, 25 and 50 mg/mL inhibited embryogenesis by 51.19 and 78.57% respectively. The effect of Z. officinal e on the infectivity T. canis eggs was proven by the reduction of larvae recovery in the livers by 35.9, 62.8 and 89.5% in mice groups inoculated by Z. officinale treated eggs at concentrations of 25, 50 and 100 mg/mL respectively. Histopathologically, the liver tissues of mice infected with Z. officinale treated eggs at the concentration of 100 mg/mL appeared healthy with slight degenerative changes of hepatocytes, opposite to that recorded in the infected mice

  7. Hair Contamination of Sheepdog and Pet Dogs with Toxocara Canis Eggs

    Directory of Open Access Journals (Sweden)

    AR Khezri

    2012-12-01

    Full Text Available Background: We tried to investigate the hair contamination of pet dogs and farm sheepdog with Toxocara eggs in terms of the different sex and age groups in north-west of Iran (Urmia and its sub­urbs.Methods: Hair samples were collected from a total of 138 pet and farm sheepdogs from November 2008 to June 2009 in Urmia City and the suburb (West Azerbaijan-Iran and examined for the pres­ence of T. canis eggs.Results: T. canis eggs found in 60 samples altogether (pet and shepherd dogs showed a contamina­tion rate of 36.2%. The number of observed T. canis eggs in each microscope field was va­ried from 1 to > 400. The age of the dog was found a significant factor to influence the prevalence and intensity of contamination, with 82% of all the eggs recovered from puppies (six months and younger. Additionally, the numbers of eggs in farm sheepdogs were significantly higher than pet dogs (P<0.05.Conclusions: This report shows that direct contact with T. canis infected dogs, particularly puppies from shepherd dogs, may pose a serious hazard to human. Besides, as they may harbor a considera­ble number of eggs on their hair, they can contaminate the soil and the environment.

  8. Didelphis albiventris naturally infected with Hepatozoon canis in southeastern Brazil.

    Science.gov (United States)

    da Silva, Maria Regina Lucas; Fornazari, Felipe; Demoner, Larissa de Castro; Teixeira, Carlos Roberto; Langoni, Helio; O'Dwyer, Lucia Helena

    2017-10-01

    Hepatozoon species are vector-borne pathogens that infect domestic and wild animals. Marsupials of the species Didelphis albiventris are adapted to urban and peri-urban areas and act as reservoir hosts for several parasites. The present study evaluated the occurrence of infection by Hepatozoon species in synantropic D. albiventris from Botucatu, São Paulo, Brazil. Blood samples and ectoparasites from 19 D. albiventris were collected from urban and peri-urban areas. Hepatozoon spp. detection was performed by microscopy and molecular analysis. One opossum was positive for Hepatozoon spp. in microscopy analysis and PCR, while another animal was positive only in PCR. The obtained sequences were 100% identical to Hepatozoon canis. Six species of ticks and two species of fleas were detected on D. albiventris. This is the first report of H. canis in synantropic D. albiventris. In Brazil, H. canis transmission among dog populations is not well established, which highlights the importance of investigating the role that opossums might play in the epidemiology of this protozoan. Copyright © 2017 Elsevier GmbH. All rights reserved.

  9. Molecular detection of Dirofilaria immitis, Hepatozoon canis, Babesia spp., Anaplasma platys and Ehrlichia canis in dogs on Costa Rica.

    Science.gov (United States)

    Wei, Lanjing; Kelly, Patrick; Ackerson, Kate; El-Mahallawy, Heba S; Kaltenboeck, Bernhard; Wang, Chengming

    2014-03-01

    Although vector-borne diseases are important causes of morbidity and mortality in dogs in tropical areas, there is little information on these conditions in Costa Rica. In PCRs of blood from dogs in Costa Rica, we did not detect DNAs of Rickettsia (R.) felis and Coxiella (C.) burnetii but we did find evidence of infection with Dirofilaria (D.) immitis (9/40, 22.5%), Hepatozoon (H.) canis (15/40, 37.5%), Babesia spp. (10/40, 25%; 2 with B. gibsoni and 8 with B. vogeli), Anaplasma (A.) platys (3/40, 7.5%) and Ehrlichia (E.) canis (20/40, 50%). Nine dogs (22.5%) were free of any vector-borne pathogens while 14 (35%) were infected with a single pathogen, 11 (27.5%) with two, 4 (10%) with three, 1 (2.5%) with four, and 1 (2.5%) with five pathogens. Dogs in Costa Rica are commonly infected with vector-borne agents.

  10. The infection of questing Dermacentor reticulatus ticks with Babesia canis and Anaplasma phagocytophilum in the Chernobyl exclusion zone.

    Science.gov (United States)

    Karbowiak, Grzegorz; Vichová, Bronislavá; Slivinska, Kateryna; Werszko, Joanna; Didyk, Julia; Peťko, Branislav; Stanko, Michal; Akimov, Igor

    2014-08-29

    Tick occurrence was studied in the Chernobyl exclusion zone (CEZ) during the August-October 2009-2012. Dermacentor reticulatus ticks were collected using the flagging method and then screened for infection with Anaplasma phagocytophilum and Babesia canis by a PCR method incorporating specific primers and sequence analysis. The prevalence of infection with B. canis canis and A. phagocytophilum was found to be 3.41% and 25.36%, respectively. The results present the first evidence of B. canis canis and A. phagocytophilum in questing D. reticulatus ticks from the Chernobyl exclusion zone. They also reveal the presence of tick-borne disease foci in areas with no human activity, and confirm that they can be maintained in areas after a nuclear disaster with radioactive contamination. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Gastric Necrosis due to Acute Massive Gastric Dilatation

    Directory of Open Access Journals (Sweden)

    Ibrahim Aydin

    2013-01-01

    Full Text Available Gastric necrosis due to acute massive gastric dilatation is relatively rare. Vascular reasons, herniation, volvulus, acute gastric dilatation, anorexia, and bulimia nervosa play a role in the etiology of the disease. Early diagnosis and treatment are highly important as the associated morbidity and mortality rates are high. In this case report, we present a case of gastric necrosis due to acute gastric dilatation accompanied with the relevant literature.

  12. Gastric Necrosis due to Acute Massive Gastric Dilatation.

    Science.gov (United States)

    Aydin, Ibrahim; Pergel, Ahmet; Yucel, Ahmet Fikret; Sahin, Dursun Ali; Ozer, Ender

    2013-01-01

    Gastric necrosis due to acute massive gastric dilatation is relatively rare. Vascular reasons, herniation, volvulus, acute gastric dilatation, anorexia, and bulimia nervosa play a role in the etiology of the disease. Early diagnosis and treatment are highly important as the associated morbidity and mortality rates are high. In this case report, we present a case of gastric necrosis due to acute gastric dilatation accompanied with the relevant literature.

  13. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. Copyright © 2016

  14. Demodex lutrae n. sp. (Acari) in European otter Lutra lutra (Carnivora: Mustelidae) with data from other demodecid mites in carnivores.

    Science.gov (United States)

    Izdebska, Joanna N; Rolbiecki, Leszek

    2014-12-01

    This article describes morphological characteristics and occurrence of Demodex lutrae n. sp., which was found on European otter Lutra lutra (Linnaeus, 1758) in Poland. The new species was found in hairy regions of otter skin, mainly in the head area. With respect to morphological features, D. lutrae is most similar to D. canis (Leydig, 1859) from the domestic dog Canis familiaris Linnaeus, 1758. The new species is a medium-sized demodecid mite (adult stages average 200 μm in length); characteristic features of these mites are hammer-shaped supracoxal spines (setae elc.p) on dorsal side of gnathosoma and palps with 3 conical spines. Demodex lutrae is the first representative of the family Demodecidae described in a host from the subfamily Lutrinae. This paper also contains a checklist of demodecid mites known from carnivores.

  15. Importation of canid rabies in a horse relocated from Zimbabwe to South Africa : research communication

    Directory of Open Access Journals (Sweden)

    C.T. Sabeta

    2005-09-01

    Full Text Available In July 2003 a 2-year-old Thoroughbred colt was imported from Harare, Zimbabwe to the Ashburton Training Centre, Pietermaritzburg, South Africa. Five months after importation, the colt presented with clinical signs suggestive of rabies: it was uncoordinated, showed muscle tremors and was biting at itself. Brain tissue was submitted for analysis and the clinical diagnosis was confirmed by the fluorescent antibody test and reverse-transcription polymerase chain reaction (RT-PCR. Phylogenetic analysis of the nucleotide sequence of the cytoplasmic domain of the glycoprotein and the G-L intergenic region of the rabies virus confirmed it to be an infection with a canid rabies virus, originating from an area in Zimbabwe endemic for the domestic dog (Canis familiaris and side-striped jackal (Canis adustus rabies.

  16. Endocarditis por Brucella canis: primer caso documentado en un paciente adulto en Argentina Brucella canis endocarditis: first documented case in Argentina

    Directory of Open Access Journals (Sweden)

    Valeria Manias

    2013-03-01

    Full Text Available Se describe el primer caso documentado de endocarditis por Brucella canis en Argentina. El paciente fue un varón adulto que consultó por edemas en miembros inferiores, registros febriles aislados de 2 meses de evolución y dolor precordial opresivo que irradiaba a brazo izquierdo. Negaba contacto con animales de cría o consumo de productos sin pasteurización. Estudios cardiológicos constataron endocarditis infecciosa. Se resuelve cirugía de recambio valvular ante fracaso terapéutico empírico con cefalotina, ampicilina y gentamicina. Los hemocultivos fueron positivos (4 de 4 muestras con bacilos gram negativos. Se realizó la identificación con técnica API 20 NE (bioMérieux, el método automatizado Phoenix (BD y las pruebas bioquímicas convencionales, sin concluir género ni especie. Se derivó la cepa al departamento de Bacteriología Especial INEI-ANLIS "Dr. Carlos G. Malbrán" donde se identificó al aislamiento como Brucella canis. Se rotó el esquema terapéutico a doxiciclina, rifampicina y trimetoprima-sulfametoxazol con buena evolución. La importancia del caso radica en la posible falla del tratamiento antimicrobiano empírico administrado para endocarditis, ya que B. canis no responde a los antimicrobianos convencionales para esta patología.We herein present the case of an adult male patient who consulted for lower extremity edema, a 2- month history of fever and oppressive chest pain radiating to the left arm. He referred neither contact with breeding animals nor consumption of unpasteurized dairy products. A diagnosis of endocarditis was confirmed by cardiac studies. Since the empirical treatment with cephalotin, ampicillin and gentamicin failed, the patient underwent aortic valve replacement. A total of four blood cultures were positive with a gram-negative rod. Bacterial identification was performed using the API 20 NE technique (bioMerieux, the Phoenix automated method (BD and conventional biochemical tests which were

  17. Establishment of Demodex canis on canine skin engrafted onto scid-beige mice.

    Science.gov (United States)

    Caswell, J L; Yager, J A; Barta, J R; Parker, W

    1996-12-01

    A small animal model of canine demodicosis is described. Normal canine skin was engrafted onto scid (severe combined immunodeficient)-beige mice, which lack functional B and T lymphocytes and have reduced natural killer cell activity. The xenografts were later infected with Demodex canis collected from a dog with demodicosis. At 30-112 days following infection, mites were seen histologically in the canine hair follicles of the engrafted skin. Demodex canis adults, nymphs, larvae, and eggs were present in samples macerated in sodium hydroxide. Mite infestations could not be demonstrated in the mouse skin, nor were mites passed from the infected graft to uninfected skin grafts on in-contact mice. This model may be utilized to assess the efficacy of miticidal treatments, to evaluate the importance of specific components of the immune response, and to study the biology of D. canis.

  18. High frequency of visceral leishmaniasis in dogs under veterinary clinical care in an intense transmission area in the state of Tocantins, Brazil

    OpenAIRE

    Santos, Helcileia Dias; Galvão, Samara Rocha; Dias, Francisca Elda Ferreira; Ribeiro, Taiã Mairon Peixoto; Negreiros Filho, Osmar; Sousa, Sebastiana Adriana Pereira; Minharro, Silvia

    2017-01-01

    ABSTRACT: A direct search for parasites were used as the diagnostic test to determine the frequency of Leishmania spp. infection in dogs ( Canis lupus familiaris ) under veterinary clinical care in the city of Araguaína, Tocantins, Brazil. For this approach, lymph node cell samples were collected using needle aspiration from 649 dogs of different breeds and ages. Two hundred and sixty four (40.7%) dogs tested positive for amastigote forms of Leishmania spp. Furthermore, 202 (76.5%) dogs tha...

  19. First Case of Natural Infection in Pigs: Review of Trypanosoma cruzi Reservoirs in Mexico

    Directory of Open Access Journals (Sweden)

    Paz María Salazar-Schettino

    1997-07-01

    Full Text Available An epidemiological research project was performed in the State of Morelos including collection of samples for blood smears and culture, serological tests, and xenodiagnoses from a total of 76 domestic and peridomestic mammals. Two strains of Trypanosoma cruzi were isolated by haemocultures; one from a pig (Sus scrofa, the first case of natural infection reported in Mexico, and the other from a dog (Canis familiaris. This study summarizes current information in Mexico concerning confirmed reservoirs of T. cruzi

  20. Dogs catch human yawns

    OpenAIRE

    Joly-Mascheroni, Ramiro M; Senju, Atsushi; Shepherd, Alex J

    2008-01-01

    This study is the first to demonstrate that human yawns are possibly contagious to domestic dogs (Canis familiaris). Twenty-nine dogs observed a human yawning or making control mouth movements. Twenty-one dogs yawned when they observed a human yawning, but control mouth movements did not elicit yawning from any of them. The presence of contagious yawning in dogs suggests that this phenomenon is not specific to primate species and may indicate that dogs possess the capacity for a rudimentary f...

  1. Serological cross-reactivity of Trypanosoma cruzi, Ehrlichia canis, Toxoplasma gondii, Neospora caninum and Babesia canis to Leishmania infantum chagasi tests in dogs

    Directory of Open Access Journals (Sweden)

    Maurício Franco Zanette

    2014-01-01

    Full Text Available Introduction: The aim of this study was to evaluate the serological cross-reactivity between Leishmania sp. and other canine pathogens. Methods: Positive serum samples for Ehrlichia canis, Babesia canis, Toxoplasma gondii, Neospora caninum and Trypanosoma cruzi were tested using three serological methods enzyme linked immunosorbent assay (ELISA, indirect immunofluorescent antibody test (IFAT and Kalazar Detect™, for canine visceral leishmaniasis. Results: Of the 57 dog samples tested, 24 (42.1% tested positive using one of the three serological methods: 10/57 (17.5% for ELISA, 11/57 (19.3% for IFAT and 3/57 (5.3% for Kalazar Detect™. Conclusions: Our results demonstrated that the presence of other infectious agents may lead to cross-reactivity on leishmaniasis serological tests.

  2. Morphometric variations in gametocytes of Hepatozoon canis from naturally infected dogs.

    Science.gov (United States)

    Eljadar, Mohamed S M; Singla, L D; Mustafa, Radya A A; Uppal, S K

    2013-04-01

    This study presents the morphometric characteristic of canine haemoprotozoan, Hepatozoon canis, using software DP2-BSW (OLYMPUS). The gametocytes of H. canis found inside the neutrophils were characteristic in shape and size and varied from 9.50 to 11.80 μm × 5.10-6.00 μm. Parasitaemia ranged from 1.00 to 39.00 %. Few gametocytes without nuclei and of abnormal shapes were also observed. The results were compared with the measurements done by using ocular micrometer.

  3. Serology, molecular detection and risk factors of Ehrlichia canis infection in dogs in Costa Rica.

    Science.gov (United States)

    Barrantes-González, Alexander V; Jiménez-Rocha, Ana E; Romero-Zuñiga, Juan José; Dolz, Gaby

    2016-10-01

    A cross-sectional study combining different serological and molecular techniques for the detection of Ehrlichia species in dogs and their ticks was carried out with data from all regions of Costa Rica. A seroprevalence of 32.1% (131/408), and infection with E. canis of 3.2% (13/407) was found, whereas 6.9% (9/130) of ticks attached to the dogs were PCR positive to E. canis. Higher prevalences were found outside the Greater Metropolitan Area (GMA). Risk factors associated with E. canis seropositivity were age, between 2 and 7 years (RR: 1.6, 95% CI: 1.2-2.2) and 8-15 years (RR: 1.8, 95% CI: 1.2-3.0), number of dogs/total of households [Dogs per Household Ratio (DHR) ≥3.1 (RR: 2.0; 95% CI: 1.4-3.0)], number of dogs infested with at least one tick/total of dogs sampled [Tick Infestation Prevalence (TIP)≥31% (RR: 2.1; 95% CI:1.3-3.3)] and living outside the GMA (RR: 1.7; 95% CI: 1.2-2.4) and being a mixed-breed dog (RR: 1.5; 95% CI: 1.1-2.1). Risk factors for E. canis PCR positive dogs were a depressive attitude (OR: 11.2; 95% CI: 1.1-115.9), fever (OR:4.8; 95% CI:1.2-19.3), DHR≥3.1 (OR: 5.7; 95% CI:1.7-19.2)], number of ticks/total of dogs sampled [Tick Distribution Ratio (TDR) ≥2.1 (OR: 6.5; 95% CI: 1.3-31.8)], and TIP≥40% (OR: 5.7; 95% CI: 1.7-19.2). This paper describes E. canis seroprevalence, PCR prevalence and tick analysis in dogs from Costa Rica, with associated clinical signs and owner perceptions. In summary, most of the E. canis infections in dogs in our country seemed to pass unnoticed by owners. Since most of the seropositive dogs (97.7%, 131/134) were negative for E. canis DNA in their blood, it is important to determine in future studies if these dogs recovered from the E. canis infection without any medication, or are persistently infected, and will develop chronic disease. Copyright © 2016 Elsevier GmbH. All rights reserved.

  4. Questing Dermacentor reticulatus harbouring Babesia canis DNA associated with outbreaks of canine babesiosis in the Swiss Midlands.

    Science.gov (United States)

    Schaarschmidt, Daniel; Gilli, Urs; Gottstein, Bruno; Marreros, Nelson; Kuhnert, Peter; Daeppen, Jérôme A; Rosenberg, Gertrud; Hirt, Didier; Frey, Caroline F

    2013-06-01

    In 2011 and 2012, outbreaks of clinical canine babesiosis were observed in 2 areas of the Swiss Midlands that had no history of this disease so far. In one area, cases of canine babesiosis occurred over 2 consecutive tick seasons. The outbreaks involved 29 dogs, 4 of which died. All dogs were infected with large Babesia sp. as diagnosed in Giemsa-stained blood smears and/or PCR. These were identified as B. canis (formerly known as B. canis canis) by subsequent partial sequencing of the 18S rRNA gene of Babesia sp. Interestingly, the sequence indicated either a genotype with heterogeneity in the ssrRNA gene copies or double infection with different B. canis isolates. None of the dogs had a recent travel history, but one had frequently travelled to Hungary and had suffered twice from clinical babesiosis 18 and 24 months prior to the outbreak in autumn 2011. Retrospective sequencing of a stored blood DNA sample of this dog revealed B. canis, with an identical sequence to the Babesia involved in the outbreaks. For the first time in Switzerland, the partial 18S rRNA gene of B. canis could be amplified from DNA isolated from 19 out of 23 adult Dermacentor reticulatus ticks flagged in the same area. The sequence was identical to that found in the dogs. Furthermore, one affected dog carried a female D. reticulatus tick harbouring B. canis DNA. Our findings illustrate that, under favourable biogeographic and climatic conditions, the life-cycle of B. canis can relatively rapidly establish itself in previously non-endemic areas. Canine babesiosis should therefore always be a differential diagnosis when dogs with typical clinical signs are presented, regardless of known endemic areas. Copyright © 2013 Elsevier GmbH. All rights reserved.

  5. Mastication suppresses initial gastric emptying by modulating gastric activity.

    Science.gov (United States)

    Ohmure, H; Takada, H; Nagayama, K; Sakiyama, T; Tsubouchi, H; Miyawaki, S

    2012-03-01

    Because various mastication-related factors influence gastric activity, the functional relationship between mastication and gastric function has not been fully elucidated. To investigate the influence of mastication on gastric emptying and motility, we conducted a randomized trial to compare the effects of mastication on gastric emptying and gastric myoelectrical activity under conditions that excluded the influences of food comminution, taste, and olfaction. A (13)C-acetate breath test with electrogastrography and electrocardiography was performed in 14 healthy men who ingested a test meal with or without chewing gum. Autonomic nerve activity was evaluated by fluctuation analysis of heart rate. Gastric emptying was significantly delayed in the 'ingestion with mastication' group. Gastric myoelectrical activity was significantly suppressed during mastication and increased gradually in the post-mastication phase. A decrease in the high-frequency power of heart rate variability was observed coincidentally with gastric myoelectrical activity suppression. These findings suggest that initial gastric emptying is suppressed by mastication, and that the suppression is caused by mastication-induced inhibition of gastric activity (UMIN Clinical Trial Registration no. UMIN000005351).

  6. Molecular characterization and functional analysis of serine/threonine protein phosphatase of Toxocara canis.

    Science.gov (United States)

    Ma, Guang Xu; Zhou, Rong Qiong; Hu, Shi Jun; Huang, Han Cheng; Zhu, Tao; Xia, Qing You

    2014-06-01

    Toxocara canis (T. canis) is a widely prevalent zoonotic parasite that infects a wide range of mammalian hosts, including humans. We generated the full-length complementary DNA (cDNA) of the serine/threonine phosphatase gene of T. canis (Tc stp) using 5' rapid amplification of the cDNA ends. The 1192-bp sequence contained a continuous 942-nucleotide open reading frame, encoding a 313-amino-acid polypeptide. The Tc STP polypeptide shares a high level of amino-acid sequence identity with the predicted STPs of Loa loa (89%), Brugia malayi (86%), Oesophagostomum columbianum (76%), and Oesophagostomumdentatum (76%). The Tc STP contains GDXHG, GDXVDRG, GNHE motifs, which are characteristic of members of the phosphoprotein phosphatase family. Our quantitative real-time polymerase chain reaction analysis showed that the Tc STP was expressed in six different tissues in the adult male, with high-level expression in the spermary, vas deferens, and musculature, but was not expressed in the adult female, suggesting that Tc STP might be involved in spermatogenesis and mating behavior. Thus, STP might represent a potential molecular target for controlling T. canis reproduction. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Hepatozoon canis infection in ticks during spring and summer in Italy.

    Science.gov (United States)

    Dantas-Torres, Filipe; Latrofa, Maria Stefania; Weigl, Stefania; Tarallo, Viviana Domenica; Lia, Riccardo Paolo; Otranto, Domenico

    2012-02-01

    Hepatozoon canis is a common protozoan of dogs, being among the most prevalent tick-borne pathogens infecting dogs around the world. It is primarily transmitted by Rhipicephalus sanguineus, the brown dog tick. In this study we tested ticks collected from dogs and from the environment in order to track the origin of an outbreak of H. canis infection detected in October 2009 in a private dog shelter in southern Italy. Ticks from dogs (n = 267) were collected during the spring of 2009, whereas ticks from environment (n = 300) were found on sticky traps placed in the same shelter during the summer of 2009. All ticks were tested by PCR for the detection of a H. canis 18S ribosomal RNA gene fragment. Four (1.5%, one female and three males) ticks collected from dogs were PCR positive. None of the larvae collected from the environment were positive, but a relatively high infection rate (8.0%) was detected in nymphs. These findings point out that dogs became infected during the summer, when ticks were abundant and highly infected by H. canis. Moreover, this study suggests that castor oil sticky traps might be useful to collect engorged immature ticks in highly infested environments (e.g., dog shelters). This might be particularly interesting to evaluate the level of infection by certain pathogens in free-ranging ticks R. sanguineus, as done in the present study.

  8. Evidence of morphine like substance and μ-opioid receptor expression in Toxacara canis (Nematoda: Ascaridae).

    Science.gov (United States)

    Golabi, Mostafa; Naem, Soraya; Imani, Mehdi; Dalirezh, Nowruz

    2016-01-01

    Toxocara canis (Nematoda: Ascaridae) is an intestinal nematode parasite of dogs, which can also cause disease in humans. Transmission to humans usually occurs because of direct contact with T. canis eggs present in soil contaminated with the feces of infected dogs. This nematode has extraordinary abilities to survive for many years in different tissues of vertebrates, and develop to maturity in the intestinal tract of its definitive host. Survival of parasitic nematodes within a host requires immune evasion using complicated pathways. Morphine-like substance, as well as opioids, which are known as down regulating agents, can modulate both innate and acquired immune responses, and let the parasite survives in their hosts. In the present study, we aimed to find evidences of morphine-like substance and µ-opiate receptor expression in T. canis , using high performance liquid chromatography (HPLC) and reverse transcription polymerase chain reaction (RT-PCR). The results indicated that T. canis produced morphine-like substances at the level of 2.31± 0.26 ng g -1 wet weight, and expressed µ-opiate receptor as in expected size of 441 bp. According to our findings, it was concluded that T. canis , benefits using morphine-like substance to modulate host immunity.

  9. Molecular and histopathological detection of Hepatozoon canis in red foxes (Vulpes vulpes) from Portugal.

    Science.gov (United States)

    Cardoso, Luís; Cortes, Helder C E; Eyal, Osnat; Reis, Antónia; Lopes, Ana Patrícia; Vila-Viçosa, Maria João; Rodrigues, Paula A; Baneth, Gad

    2014-03-24

    Hepatozoon canis is a protozoan tick-borne pathogen of dogs and wild canids. Hepatozoon spp. have been reported to infect foxes in different continents and recent studies have mostly used the polymerase chain reaction (PCR) for the detection and characterization of the infecting species. Surveying red foxes (Vulpes vulpes) may contribute to better understanding the epidemiology of canine vector-borne diseases, including hepatozoonosis caused by H. canis in domestic dogs. The present study investigated the prevalence of Hepatozoon spp. by means of histopathology and molecular analysis of different tissues in red foxes from different parts of Portugal. Blood and tissues including bone marrow, heart, hind leg muscle, jejunum, kidney, liver, lung, popliteal or axillary lymph nodes, spleen and/or tongue were collected from 91 red foxes from eight districts in northern, central and southern Portugal. Tissues were formalin-fixed, paraffin-embedded, cut and stained with hematoxylin and eosin. Polymerase chain reaction (PCR) amplified a ~650 bp fragment of the 18S rRNA gene of Hepatozoon spp. and the DNA products were sequenced. Hepatozoon canis was detected in 68 out of 90 foxes (75.6%) from all the sampled areas by PCR and sequencing. Histopathology revealed H. canis meronts similar in shape to those found in dogs in the bone marrow of 11 (23.4%) and in the spleen of two (4.3%) out of 47 foxes (p = 0.007). All the 11 foxes found positive by histopathology were also positive by PCR of bone marrow and/or blood. Positivity by PCR (83.0%) was significantly higher (p Hepatozoon canis was found to be highly prevalent in red fox populations from northern, central and southern Portugal. Detection of the parasite by histopathology was significantly less sensitive than by PCR. Red foxes are a presumptive reservoir of H. canis infection for domestic dogs.

  10. MASTICATORY MUSCLE MYOSITIS IN A GRAY WOLF (CANIS LUPUS).

    Science.gov (United States)

    Kent, Marc; Glass, Eric N; Castro, Fernando A; Miller, Andrew D; de Lahunta, Alexander

    2017-03-01

    A 10-yr-old male, neutered gray wolf ( Canis lupus ) was presented for atrophy of the temporalis and masseter muscles. Clinical signs and magnetic resonance imaging were consistent with a myopathy. Positive serology for antibody titers directed against Type 2M myofibers, and the observation of a mixed mononuclear inflammatory cell infiltrate along with eosinophils and neutrophils within the temporalis muscle, were diagnostic for masticatory muscle myositis. Importantly, protozoal myositis was excluded based on other clinicopathologic data. The case highlights the potential for immune-mediated polymyositis in canids other than the domesticated dog ( Canis lupus familaris). Additionally, awareness of a diet in which raw meat is used should prompt a thorough investigation for an underlying infectious myositis in the gray wolf.

  11. First molecular evidence of Hepatozoon canis infection in red foxes and golden jackals from Hungary.

    Science.gov (United States)

    Farkas, Róbert; Solymosi, Norbert; Takács, Nóra; Hornyák, Ákos; Hornok, Sándor; Nachum-Biala, Yaarit; Baneth, Gad

    2014-07-02

    Recently, Hepatozoon canis infection has been detected among shepherd, hunting and stray dogs in the southern part of Hungary, which is considered to be free of Rhipicephalus sanguineus sensu lato and close to the border with Croatia. The aim of this study was to acquire information on the possibility that red foxes and/or golden jackals could play a role in the appearance and spread of H. canis in Hungary. A conventional PCR was used to amplify a 666 bp long fragment of the Hepatozoon 18S rRNA gene from blood samples collected from 334 foxes shot in 231 locations in 16 counties and 15 golden jackals shot in 9 locations in two southwestern counties close to Croatia. A second PCR assay was performed in some of the samples positive by the first PCR to amplify a larger segment (approximately 1500 bp) of the 18S rRNA gene of Hepatozoon spp. for further phylogenetic analysis. Hepatozoon infection was detected in canids shot in 30 locations and 9 counties. Altogether 26 foxes (8.0%, 95% CI: 5-11%) and 9 jackals (60%, 95% CI: 33-81%) were PCR positive. Hepatozoon canis sequences were obtained from 12 foxes and 7 jackals. DNA sequences from 16 animals were 99-100% similar to H. canis from Croatian foxes or dogs while two of the sequences were 99% similar to an Italian fox. Half (13/26) of the infected red foxes and all golden jackals were shot in the two southwestern counties. This is the first report on molecular evidence of H. canis in red foxes (Vulpes vulpes) and golden jackals (Canis aureus) from Hungary, which is considered free from the tick vector of H. canis, R. sanguineus. Although no R. sanguineus sensu lato had been found on infected or non-infected wild canids, the detection of authochnous canine hepatozoonosis in Hungary might imply that the range of R. sanguineus sensu lato has reached this country.

  12. Anticorpos anti-Brucella canis e anti-Brucella abortus em cães de Araguaína, Tocantins

    Directory of Open Access Journals (Sweden)

    Elaine Maria Seles Dorneles

    2011-04-01

    Full Text Available The aims of the present study were to determine the seroprevalence of infection by Brucella canis and Brucella abortus and to evaluate possible risk factors for infection in dogs from Araguaína, Tocantins, Brazil. Sera from 374 dogs, of the urban zones of the municipality, from both sexes, were submitted to the agar-gel immunodiffusion for Brucella canis-antibodies and to rose Bengal test (AAT and fluorescence polarization assay (FPA for Brucella abortus-antibodies. From the 374 tested dogs, 21 reacted in the AAT, but no one was positive in the FPA. The seroprevalence of B. canis infection found in Araguaína, Tocantins, Brazil, was 44.53% (95% IC; 39.43 to 49.72. No association was found among seropositivity for B. canis and the risk factors studied. Thus, data from the present study showed that there was no infection by B. abortus among dogs in the sample and that infection by B. canis is widespread and at high prevalence in Araguaína, Tocantins, Brazil.

  13. Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Maisa Leite de Queiroz

    2013-02-01

    Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.

  14. Konsentrasi Serum Anjing yang Optimum untuk Menumbuhkan dan Memelihara Babesia canis dalam Biakan

    Directory of Open Access Journals (Sweden)

    Tutuk Astyawati

    2010-12-01

    Full Text Available The use of cultivation system in vitro is very important in the future study of Babesia canis. Theaim of this study was to cultivate B. canis in vitro using RPMI media with different concentration of dogsera. B. canis infected erythrocytes were collected from splenectomized infected dog. Parasites werecultivated with RPMI 1640 medium supplemented with normal dog sera at the concentration of 10%, 20%and 40%, the culture were then incubated in 5% CO2 , 37oC temperature for 17 days and subcultured every48 hours. The Percentage of Parasitized Erythrocytes (PPE in culture with 10% dog serum was significantlylower than those 20%, and 40% The used of 20% and 40 % sera were better than 10%. It is recommendedthat 40 % serum can be used for initiation phase of cultivation, whereas 20% concentration were used formaintenance of the culture.

  15. SCM, the M Protein of Streptococcus canis Binds Immunoglobulin G.

    Science.gov (United States)

    Bergmann, Simone; Eichhorn, Inga; Kohler, Thomas P; Hammerschmidt, Sven; Goldmann, Oliver; Rohde, Manfred; Fulde, Marcus

    2017-01-01

    The M protein of Streptococcus canis (SCM) is a virulence factor and serves as a surface-associated receptor with a particular affinity for mini-plasminogen, a cleavage product of the broad-spectrum serine protease plasmin. Here, we report that SCM has an additional high-affinity immunoglobulin G (IgG) binding activity. The ability of a particular S. canis isolate to bind to IgG significantly correlates with a scm -positive phenotype, suggesting a dominant role of SCM as an IgG receptor. Subsequent heterologous expression of SCM in non-IgG binding S. gordonii and Western Blot analysis with purified recombinant SCM proteins confirmed its IgG receptor function. As expected for a zoonotic agent, the SCM-IgG interaction is species-unspecific, with a particular affinity of SCM for IgGs derived from human, cats, dogs, horses, mice, and rabbits, but not from cows and goats. Similar to other streptococcal IgG-binding proteins, the interaction between SCM and IgG occurs via the conserved Fc domain and is, therefore, non-opsonic. Interestingly, the interaction between SCM and IgG-Fc on the bacterial surface specifically prevents opsonization by C1q, which might constitute another anti-phagocytic mechanism of SCM. Extensive binding analyses with a variety of different truncated SCM fragments defined a region of 52 amino acids located in the central part of the mature SCM protein which is important for IgG binding. This binding region is highly conserved among SCM proteins derived from different S. canis isolates but differs significantly from IgG-Fc receptors of S. pyogenes and S. dysgalactiae sub. equisimilis , respectively. In summary, we present an additional role of SCM in the pathogen-host interaction of S. canis . The detailed analysis of the SCM-IgG interaction should contribute to a better understanding of the complex roles of M proteins in streptococcal pathogenesis.

  16. Babesia canis vogeli infection in dogs and ticks in the semiarid region of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Andreina C. Araujo

    2015-05-01

    Full Text Available Abstract:This study aimed to report the prevalence of Babesia canis vogeli in dogs and ticks in the urban and rural areas of Petrolina, Pernambuco. Serum and peripheral blood samples of 404 dogs were tested by indirect immunofluorescence assay (IFA and by blood smears, respectively. The presence of tick infestation was evaluated, and some specimens were submitted to DNA amplification by polymerase chain reaction (PCR. The presence of antibodies anti-B. canis vogeli was determinate in 57.9% (234/404 of dogs. The direct detection of Babesia spp was obtained in 0.5% (2/404 dogs by visualization of intraerythrocytic forms. Infestation by Rhipicephalus sanguineus sensu lato was observed in 54.5% (220/404 of dogs in both urban and rural areas. DNA of Babesia canis vogeli were obtained by PCR in 6% individual (3/50 and 8.7% of pool of ticks (7/80. The risk factors for the presence of anti-B. canis vogeli antibodies, as determined through the application of logistic regression models (P<0.05, were the following: medium breed size variables (P<0.001; contact with areas of forest (P=0.021; and access on the street (P=0.046. This study describes, for the first time, the confirmation of infection of B. canis vogeli in dogs and ticks in the semiarid region of Pernambuco, Brazil.

  17. Prevalence of Toxocara canis infection in dogs in the Warszawa area.

    Science.gov (United States)

    Borecka, A; Gawor, J

    2000-01-01

    The evaluation of Toxocara canis infection in stray dogs from two shelters and private owners dogs in the Warszawa district was the aim of this study. In 1998 five hundred faecal samples were examined. The homeless dogs were found more infected than those kept as pets. T. canis was recorded in 3.4% and 8.8% of stray dogs from the shelters and in 0.4% of animals from flats. The higher prevalence of infection in homeless dogs was due to high density of dogs population, worse environmental condition and irregular anthelmintic treatment in the shelters when compare with housed dogs.

  18. Persistence of specific antibody response in different experimental infections of mice with Toxocara canis larvae Persistência da resposta humoral em camundongos experimentalmente infectados com larvas de Toxocara canis

    Directory of Open Access Journals (Sweden)

    Pedro Paulo Chieffi

    1995-06-01

    Full Text Available Anti-Toxocara antibody production and persistence were studied in experimental infections of BALB/c mice, according to three different schedules: Group I (GI - 25 mice infected with 200 T. canis eggs in a single dose; Group II (GII 25 mice infected with 150 T. canis eggs given in three occasions, 50 in the 1st, 50 in the 5th and 50 in the 8th days; Group III (GIII - 25 mice also infected with 150 T. canis eggs, in three 50 eggs portions given in the 1st, 14th and 28th days. A 15 mice control group (GIV was maintained without infection. In the 30th, 50th, 60th, 75th, 105th and 180th post-infection days three mice of the GI, GII and GIII groups and two mice of the control group had been sacrificed and exsanguinated for sera obtention. In the 360th day the remainder mice of the four groups were, in the same way, killed and processed. The obtained sera were searched for the presence of anti-Toxocara antibodies by an ELISA technique, using T. canis larvae excretion-secretion antigen. In the GI and GII, but not in the GIII, anti-Toxocara antibodies had been found, at least, up to the 180th post-infection day. The GIII only showed anti-Toxocara antibodies, at significant level, in the 30th post-infection day.Estudou-se a cinética de anticorpos anti-Toxocara em camundongos BALB/c infectados experimentalmente segundo três esquemas: Grupo I (GI: 25 camundongos infectados com dose única de 200 ovos embrionados de T. canis; grupo II (GII: 25 camundongos infectados com 150 ovos embrionados de T. canis, divididos em três doses de 50 ovos, administrados no 1º, 5º e 8º dias; Grupo III (GIII: 25 camundongos infectados com 150 ovos embrionados de T. canis, administrados em três doses de 50 ovos no 1º, 14º e 28º dias. Um grupo de 15 camundongos foi mantido nas mesmas condições, porém sem infecção, constituindo o grupo controle (GIV. No 30º, 50º, 60º, 75º, 105º e 180º dias pós-infecção três camundongos dos grupos GI, GII e GIII e dois do

  19. Primers for polymerase chain reaction to detect genomic DNA of Toxocara canis and T. cati.

    Science.gov (United States)

    Wu, Z; Nagano, I; Xu, D; Takahashi, Y

    1997-03-01

    Primers for polymerase chain reaction to amplify genomic DNA of both Toxocara canis and T. cati were constructed by adapting cloning and sequencing random amplified polymorphic DNA. The primers are expected to detect eggs and/or larvae of T. canis and T. cati, both of which are known to cause toxocariasis in humans.

  20. Canis mtDNA HV1 database: a web-based tool for collecting and surveying Canis mtDNA HV1 haplotype in public database.

    Science.gov (United States)

    Thai, Quan Ke; Chung, Dung Anh; Tran, Hoang-Dung

    2017-06-26

    Canine and wolf mitochondrial DNA haplotypes, which can be used for forensic or phylogenetic analyses, have been defined in various schemes depending on the region analyzed. In recent studies, the 582 bp fragment of the HV1 region is most commonly used. 317 different canine HV1 haplotypes have been reported in the rapidly growing public database GenBank. These reported haplotypes contain several inconsistencies in their haplotype information. To overcome this issue, we have developed a Canis mtDNA HV1 database. This database collects data on the HV1 582 bp region in dog mitochondrial DNA from the GenBank to screen and correct the inconsistencies. It also supports users in detection of new novel mutation profiles and assignment of new haplotypes. The Canis mtDNA HV1 database (CHD) contains 5567 nucleotide entries originating from 15 subspecies in the species Canis lupus. Of these entries, 3646 were haplotypes and grouped into 804 distinct sequences. 319 sequences were recognized as previously assigned haplotypes, while the remaining 485 sequences had new mutation profiles and were marked as new haplotype candidates awaiting further analysis for haplotype assignment. Of the 3646 nucleotide entries, only 414 were annotated with correct haplotype information, while 3232 had insufficient or lacked haplotype information and were corrected or modified before storing in the CHD. The CHD can be accessed at http://chd.vnbiology.com . It provides sequences, haplotype information, and a web-based tool for mtDNA HV1 haplotyping. The CHD is updated monthly and supplies all data for download. The Canis mtDNA HV1 database contains information about canine mitochondrial DNA HV1 sequences with reconciled annotation. It serves as a tool for detection of inconsistencies in GenBank and helps identifying new HV1 haplotypes. Thus, it supports the scientific community in naming new HV1 haplotypes and to reconcile existing annotation of HV1 582 bp sequences.

  1. Gastric volvulus with partial and complete gastric necrosis

    Science.gov (United States)

    Shukla, Ram Mohan; Mandal, Kartik Chandra; Maitra, Sujay; Ray, Amit; Sarkar, Ruchirendu; Mukhopadhyay, Biswanath; Bhattacharya, Malay

    2014-01-01

    Here, we report two interesting cases of gastric necrosis in acute gastric volvulus due to eventration of the diaphragm. Both the cases presented with a significant challenge and were managed successfully. The management of the cases is presented and relevant literature is discussed. To the best of our knowledge, this is the first case report of gastric volvulus with gastric necrosis requiring complete and partial gastrectomy in the available English literature. PMID:24604987

  2. Gastric volvulus with partial and complete gastric necrosis

    Directory of Open Access Journals (Sweden)

    Ram Mohan Shukla

    2014-01-01

    Full Text Available Here, we report two interesting cases of gastric necrosis in acute gastric volvulus due to eventration of the diaphragm. Both the cases presented with a significant challenge and were managed successfully. The management of the cases is presented and relevant literature is discussed. To the best of our knowledge, this is the first case report of gastric volvulus with gastric necrosis requiring complete and partial gastrectomy in the available English literature.

  3. First phylogenetic analysis of Ehrlichia canis in dogs and ticks from Mexico. Preliminary study

    Directory of Open Access Journals (Sweden)

    Carolina G. Sosa-Gutiérrez

    2016-09-01

    Full Text Available Objective. Phylogenetic characterization of Ehrlichia canis in dogs naturally infected and ticks, diagnosed by PCR and sequencing of 16SrRNA gene; compare different isolates found in American countries. Materials and methods. Were collected Blood samples from 139 dogs with suggestive clinical manifestations of this disease and they were infested with ticks; part of 16SrRNA gene was sequenced and aligned, with 17 sequences reported in American countries. Two phylogenetic trees were constructed using the Maximum likelihood method, and Maximum parsimony. Results. They were positive to E. canis 25/139 (18.0% dogs and 29/139 (20.9% ticks. The clinical manifestations presented were fever, fatigue, depression and vomiting. Rhipicephalus sanguineus Dermacentor variabilis and Haemaphysalis leporis-palustris ticks were positive for E. canis. Phylogenetic analysis showed that the sequences of dogs and ticks in Mexico form a third group diverging of sequences from South America and USA. Conclusions. This is the first phylogenetic analysis of E. canis in Mexico. There are differences in the sequences of Mexico with those reported in South America and USA. This research lays the foundation for further study of genetic variability.

  4. Tissue expression pattern of ABCG transporter indicates functional roles in reproduction of Toxocara canis.

    Science.gov (United States)

    Luo, Yong-Li; Ma, Guang-Xu; Luo, Yong-Fang; Kuang, Ce-Yan; Jiang, Ai-Yun; Li, Guo-Qing; Zhou, Rong-Qiong

    2018-03-01

    Toxocara canis is a zoonotic parasite with worldwide distribution. ATP-binding cassette (ABC) transporters are integral membrane proteins which involve in a range of biological processes in various organisms. In present study, the full-length coding sequence of abcg-5 gene of T. canis (Tc-abcg-5) was cloned and characterized. A 633 aa polypeptide containing two conserved Walker A and Walker B motifs was predicted from a continuous 1902 nt open reading frame. Quantitative real-time PCR was employed to determine the transcriptional levels of Tc-abcg-5 gene in adult male and female worms, which indicated high mRNA level of Tc-abcg-5 in the reproductive tract of adult female T. canis. Tc-abcg-5 was expressed to produce rabbit polyclonal antiserum against recombinant TcABCG5. Indirect-fluorescence immunohistochemical assays were carried out to detect the tissue distribution of TcABCG5, which showed predominant distribution of TcABCG5 in the uterus (especially in the germ cells) of adult female T. canis. Tissue transcription and expression pattern of Tc-abcg-5 indicated that Tc-abcg-5 might play essential roles in the reproduction of this parasitic nematode.

  5. Seroprevalence of Ehrlichia canis infection in stray dogs from Serbia

    Directory of Open Access Journals (Sweden)

    Nataša Bogićević

    2017-03-01

    Full Text Available Canine Monocytic Ehrlichiosis is a zoonotic bacterial disease with worldwide distribution. With regards to the population of stray dogs, the disease is facilitated due to their lifestyle and the lack of anti-parasitic protection. The aim of this study was to provide serological data on the presence of a specific Ehrlichia canis IgG antibodies in stray dogs, originating from 7 municipalities in Serbia. During the period from April 2013 to June 2014, 217 canine sera were submitted to the laboratory of the Department of Infectious Diseases of Animals and Bees, Faculty of Veterinary Medicine in Belgrade. An immunofluorescent antibody test (IFAT was performed to detect antibodies to Ehrlichia canis (cut off, 1:50. Seropositive dogs were found in 5 out of 7 counties with a seroprevalence varying from 3.57% to 20% and an overall seroprevalence of 11.06% (24/217. There was no statistically significant difference between the prevalence of infection and the host age or gender. Results showed that stray dogs contribute to maintaining and spreading of Ehrlichia canis in Serbia. Due to the close relationship between people and dogs, it is of great importance to constantly monitor and improve prevention of this disease.

  6. ENCUESTA EXPLORATORIA DE INFECCION POR Brucella canis EN PERROS DE

    Directory of Open Access Journals (Sweden)

    Ana Pardo D

    2009-08-01

    Full Text Available Objetivo. Determinar la presencia de anticuerpos a B. canis en perros domésticos y callejeros del municipio de Villavicencio, Colombia. Materiales y métodos. Se utilizó la prueba de aglutinación rápida en placa con antígeno menos mucoide (M- en 201 muestras de suero. En dos animales seropositivos se realizó intento de aislamiento por hemocultivo en medio selectivo para Brucella (oxoid®. En un animal seropositivo, con crecimiento bacteriano con características morfológicas sugestivas a B. canis se realizó histopatología de testículo, bazo e hígado. Resultados. La seropositividad general fue de 1.49% y correspondió a tres caninos machos, dos de los cuales presentaron signos clínicos de epididimitis y orquitis (unilateral. El cultivo y la histopatología no fueron concluyentes para el diagnostico de B. canis. Conclusiones. La seropositividad fue baja y sugiere que la población estudiada no ha estado en contacto con la bacteria. La presencia de reactores puede estar asociado con falsos positivos. El no aislamiento de la bacteria no indica que la enfermedad no exista por lo que se requiere de nuevos estudios.

  7. Do domestic dogs (Canis lupus familiaris) perceive the Delboeuf illusion?

    Science.gov (United States)

    Miletto Petrazzini, Maria Elena; Bisazza, Angelo; Agrillo, Christian

    2017-05-01

    In the last decade, visual illusions have been repeatedly used as a tool to compare visual perception among species. Several studies have investigated whether non-human primates perceive visual illusions in a human-like fashion, but little attention has been paid to other mammals, and sensitivity to visual illusions has been never investigated in the dog. Here, we studied whether domestic dogs perceive the Delboeuf illusion. In human and non-human primates, this illusion creates a misperception of item size as a function of its surrounding context. To examine this effect in dogs, we adapted the spontaneous preference paradigm recently used with chimpanzees. Subjects were presented with two plates containing food. In control trials, two different amounts of food were presented in two identical plates. In this circumstance, dogs were expected to select the larger amount. In test trials, equal food portion sizes were presented in two plates differing in size: if dogs perceived the illusion as primates do, they were expected to select the amount of food presented in the smaller plate. Dogs significantly discriminated the two alternatives in control trials, whereas their performance did not differ from chance in test trials with the illusory pattern. The fact that dogs do not seem to be susceptible to the Delboeuf illusion suggests a potential discontinuity in the perceptual biases affecting size judgments between primates and dogs.

  8. Performance constraints in strength events in dogs (Canis lupus familiaris).

    Science.gov (United States)

    Helton, William S

    2011-01-01

    Ecological performance in animals is considered to be constrained by trade-offs between structural and physiological features. Some of the best anatomical and physiological data in support of this perspective are based on findings from canines, in which researchers have demonstrated skeletal shape trade-offs between running efficiency and strength. There has, however, actually been little examination of the link between these structural differences and relevant performance. In this paper I analyze the performance of six breeds of dogs in standardized weight pulling competitions. More brachycephalic shaped (broad headed) dogs are indeed significantly stronger than more dolichocephalic shaped (narrow headed) dogs even when controlling for body mass. Morphological trade-offs between power and running ability may be an important constraint on the evolution of canines and other terrestrial vertebrates. Copyright © 2010 Elsevier B.V. All rights reserved.

  9. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  10. Word Generalization by a Dog (Canis familiaris): Is Shape Important?

    Science.gov (United States)

    van der Zee, Emile; Zulch, Helen; Mills, Daniel

    2012-01-01

    We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

  11. Toxocara canis, Trichinella spiralis and Taenia solium helminthozoonoses: seroprevalence among selected populations in north India.

    Science.gov (United States)

    Singh, B B; Sharma, R; Gill, J P S

    2015-09-01

    Helminthozoonoses are being considered as a research priority in India and many other tropical and subtropical countries. Taenia solium and Trichinella spiralis are emerging public health and food safety issues in the country and the developing world. The asymptomatic Ta. solium carriers act as important risk for neurocysticercosis, leading to adult onset epilepsy in the country. Human toxocariasis is another common zoonosis which occurs due to larvae of Toxocara canis or T. cati. The current study was planned to obtain baseline seropositivity data for Ta. solium, To. canis and Tr. spiralis antibodies among selected populations in Punjab province of northern India. In the present study, 122 human subjects belonging to selected occupations viz. farmers and veterinary practitioners were screened using the RIDASCREEN(®) Ta. solium IgG, RIDASCREEN(®) Toxocara IgG and RIDASCREEN(®) Trichinella IgG enzyme immunoassays for the qualitative determination of IgG antibodies against Ta. solium, Tr. spiralis and To. canis, respectively in human serum. The seropositivity of To. canis, Tr. spiralis and Ta. solium infections were found to be 22.13, 5.73 and 11.47 %, respectively in human serum samples. The relative risk of being infected for To. canis, Tr. spiralis and Ta. solium infections was found to be 1.91 (95 % CI 0.786-4.669), 2.61 (95 % CI 0.3258-20.94) and 1.596 (95 % CI 0.427-5.3893) times high respectively in farmers when compared to veterinary practitioners. The present study indicates that exposure to To. canis and Ta. solium is not uncommon among farmers and veterinary practitioners in this part of the country. These results provided evidence of Tr. spiralis among selected human populations in the country and demand more research related to trichinellosis in their respective animal and human hosts.

  12. The prevalence and impact of Babesia canis and Theileria sp. in free-ranging grey wolf (Canis lupus) populations in Croatia.

    Science.gov (United States)

    Beck, Ana; Huber, Doroteja; Polkinghorne, Adam; Kurilj, Andrea Gudan; Benko, Valerija; Mrljak, Vladimir; Reljić, Slaven; Kusak, Josip; Reil, Irena; Beck, Relja

    2017-04-04

    Babesia spp. and Theileria spp. are important emerging causes of disease in dogs. Alongside these domesticated hosts, there is increasing recognition that these piroplasms can also be found in a range of wild animals with isolated reports describing the presence of these pathogen in foxes (Vulpes vulpes) and captive grey wolves (Canis lupus). The prevalence and impact of these infections in free-ranging populations of canids are unknown. To gain a better insight into the epidemiology and pathogenesis of piroplasm infections in free-ranging grey wolves, pathological and molecular investigations into captive and free-ranging grey wolves in Croatia were performed. The carcasses of 107 free-ranging wolves and one captive wolf were the subjects of post-mortem investigations and sampling for molecular studies. A blood sample from one live captured wolf for telemetric tracking was also used for molecular analysis. PCR amplification targeting the 18S RNA gene revealed that 21 of 108 free-ranging wolves and one captive animal were positive for Theileria/Babesia DNA. Subsequent sequencing of a fragment of the 18S RNA gene revealed that 7/22 animals were positive for Babesia canis while the other amplified sequence were found to be identical with corresponding 18S rDNA sequences of Theileria capreoli isolated from wild deer (15/22). Haematological and cytological analysis revealed the presence of signet-ring shaped or pear-shaped piroplasms in several animals with the overall parasite burden in all positive animals assessed to be very low. Pathological investigation of the captive animal revealed fatal septicemia as a likely outcome of hemolytic anaemia. There was little or no evidence of hemolytic disease consistent with babesiosis in other animals. Importantly, the presence of B. canis in free-ranging grey wolves has not been described before but has been reported in a single fox and domestic dogs only. That B. canis infections cause disease in dogs but have little impact

  13. Hematological disorders detected in dogs infected by Hepatozoon canis in a municipality in Mato Grosso do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    L.M. Paiz

    Full Text Available ABSTRACT A retrospective review of hematological reports of nine dogs detected with Hepatozoon canis infection by microscopic examination of blood smears in a laboratory in the municipality of Dourados, Mato Grosso do Sul, Brazil was conducted. This study aimed to evaluate the hematological profile of these infected dogs, in addition to the occurrence of coinfections with other agents that infect blood cells, since studies concerning canine hepatozoonosis in Brazil are scarce and there are some divergences regarding H. canis infection that still require a resolution. The nine cases of H. canis infection were identified among all dogs examined at the studied laboratory in 2009 and 2010, with an occurrence of 7/1,192 (0.59%; 95% CI 0.15 - 1.02% positive dogs in the first year and 2/1,313 (0.15%; 95% CI 0.02 - 0.55% cases in 2010. The analysis of the hematological reports showed an occurrence of coinfection between H. canis and other agents in two (2/9; 22.22%; 95% CI 2.81 - 60.00% dogs, one with E. canis and another with Babesia spp. (1/9; 11.11%; 95% CI 0.28 - 48.24%. Only the blood test of one dog had no alterations, based on reference values. Anemia was the most frequent hematological alteration (6/9; 66.67%; 95% CI 29.93 - 92.51%. Although the occurrence of H. canis infection was low, significative hematological alterations were observed in most infected dogs. Coinfection with Babesia spp. and E. canis was detected in two dogs and the hematological alterations cannot be attributed exclusively to H. canis in these animals. Longitudinal studies would be of fundamental importance to determine the causality of these alterations. These results highlight the importance of differential diagnosis in dogs when there is clinical suspicion of infection by hemoparasites, since the hematological changes in dogs infected by H. canis are quite variable.

  14. Abnormal neurobehaviour and impaired memory function as a consequence of Toxocara canis- as well as Toxocara cati-induced neurotoxocarosis.

    Directory of Open Access Journals (Sweden)

    Elisabeth Janecek

    2017-05-01

    Full Text Available Neuroinvasive larvae of the worldwide occurring zoonotic roundworms Toxocara canis and T. cati may induce neurotoxocarosis (NT in humans, provoking a variety of symptoms including cognitive deficits as well as neurological dysfunctions. An association with neuropsychological disorders has been discussed. Similar symptoms have been described in T. canis-infected mice, whereas data on T. cati-induced NT are rare. Therefore, it was aimed to obtain insights into the impact on neurobehaviour as well as progression of neurological symptoms and behavioural alterations during the course of NT directly comparing T. canis- and T. cati-infected mice as models for human NT.C57BL/6 mice were orally infected with 2000 embryonated T. canis or T. cati eggs, respectively, the control group received tap water. Mice were screened weekly for neurobehavioural alterations and memory function starting one day prior infection until 97 days post infection (pi; T. canis-infection and day 118 pi (T. cati-infection, uninfected control. Mostly motoric and neurological parameters were affected in T. canis-infected mice starting day 20 pi with severe progression accompanied by stereotypical circling. In contrast, T. cati-infected mice mostly showed reduced response to sudden sound stimulus (indicator for excitability and flight behaviour starting day 6 pi. Interestingly, enhanced grooming behaviour was observed exclusively in T. cati-infected mice, indicating a possible role of neurotransmitter dysregulation. Reduced exploratory behaviour and memory impairment was observed in both infection groups with delayed onset and less severe progression in T. cati- compared to T. canis-infected mice.Results highlight the need to consider T. cati beside T. canis as causative agent of human NT. Findings provide valuable hints towards differences in key regulatory mechanisms during T. canis- and T. cati-induced NT, contributing to a comprehensive picture and consequently a broader

  15. Detection of Hepatozoon canis in the Brown Dog Tick and Domestic Dogs in Peninsular Malaysia.

    Science.gov (United States)

    Prakash, Batah Kunalan; Low, Van Lun; Tan, Tiong Kai; Vinnie-Siow, Wei Yin; Lim, Yvonne Ai-Lian; Morvarid, Akhavan Rezaei; Azman, Adzzie Shazleen; Yeong, Yze Shiuan; AbuBakar, Sazaly; Sofian-Azirun, Mohd

    2018-05-17

    Hepatozoon canis has been widely reported in dogs. Its prevalence in ticks, however, has not been well-established. Here we determine the occurrence of Hepatozoon DNA in the brown dog tick Rhipicephalus sanguineus (Latreille) (Acari: Ixodidae) sensu lato (s.l.) and domestic dogs from Peninsular Malaysia using a polymerase chain reaction (PCR) assay based on amplification of the 18S ribosomal RNA coding sequence. Our results revealed a relatively low prevalence of H. canis DNA in both R. sanguineus s.l. (0.7%) and dogs (3.33%). This study represents the first report of H. canis DNA in R. sanguineus s.l. in Malaysia, highlighting the risk of this infection in dogs.

  16. Prolapsing Gastric Polyp Causing Intermittent Gastric Outlet Obstruction.

    Science.gov (United States)

    Kosai, Nik Ritza; Gendeh, Hardip Singh; Norfaezan, Abdul Rashid; Razman, Jamin; Sutton, Paul Anthony; Das, Srijit

    2015-06-01

    Gastric polyps are often an incidental finding on upper gastrointestinal endoscopy, with an incidence up to 5%. The majority of gastric polyps are asymptomatic, occurring secondary to inflammation. Prior reviews discussed Helicobacter pylori (H pylori)-associated singular gastric polyposis; however, we present a rare and unusual case of recurrent multiple benign gastric polyposis post H pylori eradication resulting in intermittent gastric outlet obstruction. A 70-year-old independent male, Chinese in ethnicity, with a background of diabetes mellitus, hypertension, and a simple renal cyst presented with a combination of melena, anemia, and intermittent vomiting of partially digested food after meals. Initial gastroscopy was positive for H pylori; thus he was treated with H pylori eradication and proton pump inhibitors. Serial gastroscopy demonstrated multiple sessile gastric antral polyps, the largest measuring 4 cm. Histopathologic examination confirmed a benign hyperplastic lesion. Computed tomography identified a pyloric mass with absent surrounding infiltration or metastasis. A distal gastrectomy was performed, whereby multiple small pyloric polyps were found, the largest prolapsing into the pyloric opening, thus explaining the intermittent nature of gastric outlet obstruction. Such polyps often develop from gastric ulcers and, if left untreated, may undergo neoplasia to form malignant cells. A distal gastrectomy was an effective choice of treatment, taking into account the polyp size, quantity, and potential for malignancy as opposed to an endoscopic approach, which may not guarantee a complete removal of safer margins and depth. Therefore, surgical excision is favorable for multiple large gastric polyps with risk of malignancy.

  17. Clinical Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum infections in dogs.

    Science.gov (United States)

    Dubey, J P; Chapman, Jennifer L; Rosenthal, Benjamin M; Mense, M; Schueler, Ronald L

    2006-04-15

    Sarcocystis neurona, Sarcocystis canis, Toxoplasma gondii, and Neospora caninum are related apicomplexans that can cause systemic illness in many species of animals, including dogs. We investigated one breeder's 25 Basset Hounds for these infections. In addition, tissues from dogs and other non-canine hosts previously reported as S. canis infections were studied retrospectively. Schizonts resembling those of S. neurona, and recognized by polyclonal rabbit anti-S. neurona antibodies, were found in six of eight retrospective cases, as well as in two additional dogs (one Basset Hound, one Springer Spaniel) not previously reported. S. neurona schizonts were found in several tissues including the central nervous system, lungs, and kidneys. Fatal toxoplasmosis was diagnosed in an adult dog, and neosporosis was diagnosed in an adult and a pup related to the one diagnosed with S. neurona. No serological reactivity to S. neurona antibodies occurred when S. canis-like liver schizonts were retrospectively assayed from two dogs, a dolphin, a sea lion, a horse, a chinchilla, a black or either of two polar bears. Sequencing conserved (18S) and variable (ITS-1) portions of nuclear ribosomal DNA isolated from the schizont-laden liver of a polar bear distinguished it from all previously characterized species of Sarcocystis. We take this genetic signature as provisionally representative of S. canis, an assumption that should be tested with future sequencing of similar liver infections in other mammalian hosts. These findings further extend the uncharacteristically broad intermediate host range for S. neurona, which also causes a neurologic disease in cats, mink, raccoons, skunks, Pacific harbor seals, ponies, zebras, lynxes, and sea otters. Further work is necessary to delineate the causative agent(s) of other cases of canine sarcocystosis, and in particular to specify the attributes of S. canis, which corresponds morphologically to infections reported from wide range of terrestrial

  18. Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis

    Directory of Open Access Journals (Sweden)

    Richards Vincent P

    2012-12-01

    Full Text Available Abstract Background Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Results Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection. A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs [plasmid, phage, integrative conjugative element (ICE] and comparison to other species provided convincing evidence for lateral gene transfer (LGT between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae, with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST of a subset of the isolates (n = 45 detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types], suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. Conclusion This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human

  19. Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis.

    Science.gov (United States)

    Richards, Vincent P; Zadoks, Ruth N; Pavinski Bitar, Paulina D; Lefébure, Tristan; Lang, Ping; Werner, Brenda; Tikofsky, Linda; Moroni, Paolo; Stanhope, Michael J

    2012-12-18

    Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection). A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs) [plasmid, phage, integrative conjugative element (ICE)] and comparison to other species provided convincing evidence for lateral gene transfer (LGT) between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae), with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST) of a subset of the isolates (n = 45) detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types]), suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates) occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human bacteria (Streptococcus urinalis) is cause for concern

  20. Genome characterization and population genetic structure of the zoonotic pathogen, Streptococcus canis

    Science.gov (United States)

    2012-01-01

    Background Streptococcus canis is an important opportunistic pathogen of dogs and cats that can also infect a wide range of additional mammals including cows where it can cause mastitis. It is also an emerging human pathogen. Results Here we provide characterization of the first genome sequence for this species, strain FSL S3-227 (milk isolate from a cow with an intra-mammary infection). A diverse array of putative virulence factors was encoded by the S. canis FSL S3-227 genome. Approximately 75% of these gene sequences were homologous to known Streptococcal virulence factors involved in invasion, evasion, and colonization. Present in the genome are multiple potentially mobile genetic elements (MGEs) [plasmid, phage, integrative conjugative element (ICE)] and comparison to other species provided convincing evidence for lateral gene transfer (LGT) between S. canis and two additional bovine mastitis causing pathogens (Streptococcus agalactiae, and Streptococcus dysgalactiae subsp. dysgalactiae), with this transfer possibly contributing to host adaptation. Population structure among isolates obtained from Europe and USA [bovine = 56, canine = 26, and feline = 1] was explored. Ribotyping of all isolates and multi locus sequence typing (MLST) of a subset of the isolates (n = 45) detected significant differentiation between bovine and canine isolates (Fisher exact test: P = 0.0000 [ribotypes], P = 0.0030 [sequence types]), suggesting possible host adaptation of some genotypes. Concurrently, the ancestral clonal complex (54% of isolates) occurred in many tissue types, all hosts, and all geographic locations suggesting the possibility of a wide and diverse niche. Conclusion This study provides evidence highlighting the importance of LGT in the evolution of the bacteria S. canis, specifically, its possible role in host adaptation and acquisition of virulence factors. Furthermore, recent LGT detected between S. canis and human bacteria (Streptococcus

  1. Recurrent patent infections with Toxocara canis in household dogs older than six months : a prospective study

    NARCIS (Netherlands)

    Nijsse, Rolf; Mughini-Gras, Lapo; Wagenaar, Jaap A; Ploeger, Harm W

    2016-01-01

    BACKGROUND: To reduce environmental contamination with Toxocara canis eggs, the current general advice is to deworm all dogs older than six months on average four times a year. However, only a small proportion of non-juvenile household dogs actually shed T. canis eggs, and some dogs shed eggs more

  2. Occurrence of Hepatozoon canis and Cercopithifilaria bainae in an off-host population of Rhipicephalus sanguineus sensu lato ticks.

    Science.gov (United States)

    Ramos, Rafael Antonio Nascimento; Giannelli, Alessio; Carbone, Domenico; Baneth, Gad; Dantas-Torres, Filipe; Otranto, Domenico

    2014-04-01

    Hepatozoon canis (Eucoccidiorida, Hepatozoidae) and the filarioid Cercopithifilaria bainae (Spirurida, Onchocercidae) are tick-transmitted infectious agents of dogs, highly prevalent in the Mediterranean basin in association with Rhipicephalus sanguineus sensu lato. Ticks were collected from the environment every 25±2 days in a confined location in southern Italy where a community of dogs lives, from August 2012 to July 2013. In order to study the occurrence of H. canis and C. bainae, 1091 tick specimens (770 adults; 271 nymphs, and 50 larvae) were dissected, and oocysts of H. canis and larvae of C. bainae were morphologically identified. Out of 1091 dissected ticks, 13.47% (n=147) were positive for H. canis, with the highest prevalence recorded in unfed adults (16.4%; 126/770), followed by nymphs collected as larvae and allowed to moult (14%; 7/50), unfed nymphs dissected immediately after collection (3%; 8/271), and adults collected as nymphs and allowed to moult (2%; 6/271). The highest number of H. canis-positive ticks (35.5%; 43/121; Pcanis and C. bainae infections in the study area seem to be dependent on the seasonality of vector tick populations. Hence, dogs living in these areas are more exposed to both pathogens during the warmer months. These findings provide new insights into the ecology of both H. canis and C. bainae. Copyright © 2014 Elsevier GmbH. All rights reserved.

  3. Detection and molecular identification of Hepatozoon canis and Babesia vogeli from domestic dogs in Palestine.

    Science.gov (United States)

    Azmi, Kifaya; Al-Jawabreh, Amer; Nasereddin, Abedelmajeed; Abdelkader, Ahmad; Zaid, Taher; Ereqat, Suheir; Sawalha, Samer S; Baneth, Gad; Abdeen, Ziad

    2017-04-01

    Dogs serve as hosts for a great number of parasites, which may affect their health and wellbeing. This study aimed to observe tick borne pathogens in dogs from Palestine including Hepatozoon canis and Babesia species. The prevalence of both H. canis and Babesia species infections in apparently healthy dogs, from ten districts of the West Bank was surveyed. DNA was extracted from blood samples obtained from dogs (n = 362) and ticks (n = 213) collected from dogs (n = 77). A primer set that amplifies a partial sequence of the Babesia and Hepatozoon 18S rRNA gene was used for PCR and the DNA sequences of the PCR products of all samples were determined. Twenty-nine (8·0%) of the dogs were found infected including 20 with H. canis (5·5%), seven with Babesia vogeli (1·9%) and two with undefined Babesia spp. (0·6%). Twelve Rhipicephalus sanguineus s.l ticks were pathogen-positive, including ten with H. canis (4·7%), one with B. vogeli (0·5%), and one with Hepatozoon felis (0·5%). The results indicated that a wide range of tick borne pathogens is circulating in the canine population in the surveyed region. This study is the first report on the prevalence of H. canis, B. vogeli and Babesia spp. in dogs in Palestine and its results will assist in the management of diseases associated with these blood parasites.

  4. Gastric Adenocarcinoma Presenting with Gastric Outlet Obstruction in a Child

    Directory of Open Access Journals (Sweden)

    Abdulrahman Al-Hussaini

    2014-01-01

    Full Text Available Gastric carcinoma is extremely rare in children representing only 0.05% of all gastrointestinal malignancies. Here, we report the first pediatric case of gastric cancer presenting with gastric outlet obstruction. Upper endoscopy revealed a markedly thickened antral mucosa occluding the pylorus and a clean base ulcer 1.5 cm × 2 cm at the lesser curvature of the stomach. The narrowed antrum and pylorus underwent balloon dilation, and biopsy from the antrum showed evidence of Helicobacter pylori gastritis. The biopsy taken from the edge of the gastric ulcer demonstrated signet-ring-cell type infiltrate consistent with gastric adenocarcinoma. At laparotomy, there were metastases to the liver, head of pancreas, and mesenteric lymph nodes. Therefore, the gastric carcinoma was deemed unresectable. The patient died few months after initiation of chemotherapy due to advanced malignancy. In conclusion, this case report underscores the possibility of gastric adenocarcinoma occurring in children and presenting with gastric outlet obstruction.

  5. Giardia and Cryptosporidium species and genotypes in coyotes (Canis latrans).

    Science.gov (United States)

    Trout, James M; Santín, Mónica; Fayer, Ronald

    2006-06-01

    Feces and duodenal scrapings were collected from 22 coyotes (Canis latrans) killed in managed hunts in northeastern Pennsylvania. Polymerase chain reaction (PCR) methods were used to detect Giardia and Cryptosporidium spp. PCR-amplified fragments of Giardia and Cryptosporidium spp. SSU-rRNA genes were subjected to DNA sequence analysis for species/genotype determination. Seven coyotes (32%) were positive for G. duodenalis: three assemblage C, three assemblage D, and one assemblage B. Six coyotes (27%) were positive for Cryptosporidium spp. One isolate shared 99.7% homology with C. muris, whereas five others (23%) shared 100% homology with C. canis, coyote genotype. This is the first report on multiple genotypes of Giardia spp. in coyotes and on the prevalence of Cryptosporidium spp. genotypes in coyotes.

  6. Hepatozoon canis and Leishmania spp. coinfection in dogs diagnosed with visceral leishmaniasis.

    Science.gov (United States)

    Morgado, Fernanda Nazaré; Cavalcanti, Amanda Dos Santos; Miranda, Luisa Helena de; O'Dwyer, Lúcia Helena; Silva, Maria Regina Lucas da; Menezes, Rodrigo Caldas; Andrade da Silva, Aurea Virgínia; Boité, Mariana Côrtes; Cupolillo, Elisa; Porrozzi, Renato

    2016-01-01

    This study describes the occurrence of dogs naturally co-infected with Hepatozoon canis and two Leishmania species: L. infantum or L. braziliensis. Four dogs serologically diagnosed with Visceral Leishmaniasis were euthanized. Liver and spleen samples were collected for histopathological analysis and DNA isolation. H. canis meronts were observed in tissues from all four dogs. H. canis infection was confirmed by PCR followed by sequencing of a fragment of 18S rRNA gene. Leishmania detection and typing was confirmed by ITS1' PCR-RFLP and parasite burden was calculated using ssrRNA quantitative qPCR. A DPP - Dual Path platform test was performed. One out (Dog #2) of four animals was asymptomatic. Dogs #1 and #4 were infected by L. infantum and were DPP test positive. Dogs #2 and #3 were infected by L. braziliensis and were DPP test negative. Furthermore, visceral dissemination was observed in Dogs #2 and #3, since L. braziliensis was detected in liver and spleen samples. The visceral dissemination of L. braziliensis associated with systemic signs suggested that this co-infection could influence the parasite burden and disease progression.

  7. NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0952 ref|NP_003851.1| barrier to autointegration factor 1 [Homo sapien...s] ref|NP_892033.1| barrier to autointegration factor 1 [Bos taurus] ref|XP_854776.1| PREDICTED: similar to barrier to autointegratio...n factor 1 [Canis familiaris] ref|XP_001111817.1| PREDICTED: similar to barrier to autointegration...: similar to barrier to autointegration factor 1 isoform 2 [Macaca mulatta] ref|XP_001111884.1| PREDICTED: s...imilar to barrier to autointegration factor 1 isoform 3 [Macaca mulatta] ref|XP_001111924.1| PREDICTED: similar to barrier to autoint

  8. Polar lipid composition of mammalian hair.

    Science.gov (United States)

    Wix, M A; Wertz, P W; Downing, D T

    1987-01-01

    The types and amounts of polar lipids from the hair of monkey (Macacca fascicularis), dog (Canis familiaris), pig (Sus scrofa) and porcupine (Erethizon dorsatum) have been determined by quantitative thin-layer chromatography. The polar lipid content of the hair samples ranged from 0.6 to 1.6 wt%. Lipid compositions included ceramides (57-63% of the polar lipid by weight), glycosphingolipids (7-9%) and cholesteryl sulfate (22-29%). Several minor components (4-7%) remain unidentified. The results suggest that cholesteryl sulfate may be an important determinant of the cohesiveness of hair.

  9. Failure of imidocarb dipropionate and toltrazuril/emodepside plus clindamycin in treating Hepatozoon canis infection.

    Science.gov (United States)

    De Tommasi, Anna Sara; Giannelli, Alessio; de Caprariis, Donato; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Crescenzo, Giuseppe; Dantas-Torres, Filipe; Baneth, Gad; Otranto, Domenico

    2014-03-01

    Hepatozoonosis caused by Hepatozoon canis (Eucoccidiorida, Hepatozoidae) is among the most widespread vector-borne infections of dogs, primarily transmitted by Rhipicephalus sanguineus sensu lato ticks. Based on the absence of a consensus on the treatment regimes for canine hepatozoonosis, the present study aimed to evaluate the efficacy of imidocarb dipropionate (5-6 mg/kg subcutaneously once a week for 6 weeks), and of toltrazuril/emodepside (Procox(®), 15 mg/kg once a day for 6 days) in association with clindamycin (15 mg/kg once a day for 21 days) in treating naturally infected dogs. At the enrollment time (T0), 32 dogs, cytologically or molecularly positive for H. canis, were assigned to test and control groups. Animals were treated according to the specific therapeutic protocol, and the presence of H. canis gamonts was assessed weekly by cytology and PCR throughout six months (T1-T19). In addition, any abnormality in leucocyte morphology was evaluated and recorded. Results indicate that, in spite of a reduction in the percentage of infected dogs, both treatments did not provide parasitological cure. Accordingly, new treatment protocols or active compounds against H. canis should be investigated. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Gastric emptying in patients with gastric ulcer

    Energy Technology Data Exchange (ETDEWEB)

    Harding, L.K.; Anselmi, M.; Donovan, I.A.; Alexander-Williams, J. (Dudley Road Hospital, Birmingham (UK); Birmingham General Hospital (UK))

    1982-06-01

    The estimated volume of meal in the stomach 30 mins after sup(113m)In-DTPA administration was determined in patients with gastric ulcer and normal controls by 1) relating counts in the stomach to those in the whole field of view of the gamma camera and 2) aspirations. In the normal controls there was no significant difference between the two methods but in the gastric ulcer patients, the gamma camera method predicted significantly more meal in the stomach than was recovered by aspiration. It was suggested that the large low lying stomach found in gastric ulcer disease causes extensive overlap of the small bowel and invalidates measurements of gastric emptying made by a gamma camera.

  11. Gastric emptying in patients with gastric ulcer

    International Nuclear Information System (INIS)

    Harding, L.K.; Anselmi, M.; Donovan, I.A.; Alexander-Williams, J.

    1982-01-01

    The estimated volume of meal in the stomach 30 mins after sup(113m)In-DTPA administration was determined in patients with gastric ulcer and normal controls by 1) relating counts in the stomach to those in the whole field of view of the gamma camera and 2) aspirations. In the normal controls there was no significant difference between the two methods but in the gastric ulcer patients, the gamma camera method predicted significantly more meal in the stomach than was recovered by aspiration. It was suggested that the large low lying stomach found in gastric ulcer disease causes extensive overlap of the small bowel and invalidates measurements of gastric emptying made by a gamma camera. (U.K.)

  12. Gastric cancer-derived MSC-secreted PDGF-DD promotes gastric cancer progression.

    Science.gov (United States)

    Huang, Feng; Wang, Mei; Yang, Tingting; Cai, Jie; Zhang, Qiang; Sun, Zixuan; Wu, Xiaodan; Zhang, Xu; Zhu, Wei; Qian, Hui; Xu, Wenrong

    2014-11-01

    This study was designed to investigate the role of PDGF-DD secreted by gastric cancer-derived mesenchymal stem cells (GC-MSCs) in human gastric cancer progression. Gastric cancer cells were indirectly co-cultured with GC-MSCs in a transwell system. The growth and migration of gastric cancer cells were evaluated by cell colony formation assay and transwell migration assay, respectively. The production of PDGF-DD in GC-MSCs was determined by using Luminex and ELISA. Neutralization of PDGFR-β by su16f and siRNA interference of PDGF-DD in GC-MSCs was used to demonstrate the role of PDGF-DD produced by GC-MSCs in gastric cancer progression. GC-MSC conditioned medium promoted gastric cancer cell proliferation and migration in vitro and in vivo. Co-culture with GC-MSCs increased the phosphorylation of PDGFR-β in SGC-7901 cells. Neutralization of PDGFR-β by su16f blocked the promoting role of GC-MSC conditioned medium in gastric cancer cell proliferation and migration. Recombinant PDGF-DD duplicated the effects of GC-MSC conditioned medium on gastric cancer cells. Knockdown of PDGF-DD in GC-MSCs abolished its effects on gastric cancer cells in vitro and in vivo. PDGF-DD secreted by GC-MSCs is capable of promoting gastric cancer cell progression in vitro and in vivo. Targeting the PDGF-DD/PDGFR-β interaction between MSCs and gastric cancer cells may represent a novel strategy for gastric cancer therapy.

  13. Diversity of the Gastric Microbiota in Thoroughbred Racehorses Having Gastric Ulcer.

    Science.gov (United States)

    Dong, Hee-Jin; Ho, Hungwui; Hwang, Hyeshin; Kim, Yongbaek; Han, Janet; Lee, Inhyung; Cho, Seongbeom

    2016-04-28

    Equine gastric ulcer syndrome is one of the most frequently reported diseases in thoroughbred racehorses. Although several risk factors for the development of gastric ulcers have been widely studied, investigation of microbiological factors has been limited. In this study, the presence of Helicobacter spp. and the gastric microbial communities of thoroughbred racehorses having mild to severe gastric ulcers were investigated. Although Helicobacter spp. were not detected using culture and PCR techniques from 52 gastric biopsies and 52 fecal samples, the genomic sequences of H. pylori and H. ganmani were detected using nextgeneration sequencing techniques from 2 out of 10 representative gastric samples. The gastric microbiota of horses was mainly composed of Firmicutes (50.0%), Proteobacteria (18.7%), Bacteroidetes (14.4%), and Actinobacteria (9.7%), but the proportion of each phylum varied among samples. There was no major difference in microbial composition among samples having mild to severe gastric ulcers. Using phylogenetic analysis, three distinct clusters were observed, and one cluster differed from the other two clusters in the frequency of feeding, amount of water consumption, and type of bedding. To the best of our knowledge, this is the first study to investigate the gastric microbiota of thoroughbred racehorses having gastric ulcer and to evaluate the microbial diversity in relation to the severity of gastric ulcer and management factors. This study is important for further exploration of the gastric microbiota in racehorses and is ultimately applicable to improving animal and human health.

  14. The Mitochondrial Genome of Toxocara canis

    OpenAIRE

    Jex, Aaron R.; Waeschenbach, Andrea; Littlewood, D. Timothy J.; Hu, Min; Gasser, Robin B.

    2008-01-01

    Toxocara canis (Ascaridida: Nematoda), which parasitizes (at the adult stage) the small intestine of canids, can be transmitted to a range of other mammals, including humans, and can cause the disease toxocariasis. Despite its significance as a pathogen, the genetics, epidemiology and biology of this parasite remain poorly understood. In addition, the zoonotic potential of related species of Toxocara, such as T. cati and T. malaysiensis, is not well known. Mitochondrial DNA is known to provid...

  15. Serum Zinc, Iron and Copper Concentrations in Dogs Infected with Hepatozoon canis

    Directory of Open Access Journals (Sweden)

    Kamil Seyrek

    2009-01-01

    Full Text Available In Turkey, canine hepatozoonosis is an emerging infection with a large number of cases detected during the past five years. In the present study, serum zinc, copper and iron concentrations of dogs infected with Hepatozoon canis were measured for the first time. Compared to the controls (n = 10, serum zinc and iron concentrations in infected animals (n = 14 decreased significantly (p p p Hepatozoon canis infection may cause alterations in serum zinc iron and copper concentrations. Furthermore, in the treatment of infected animals addition of zinc and iron to the ration of infected animals should be taken into consideration.

  16. Comparative Experimental Infection Study in Dogs with Ehrlichia canis, E. chaffeensis, Anaplasma platys and A. phagocytophilum.

    Science.gov (United States)

    Nair, Arathy D S; Cheng, Chuanmin; Ganta, Chanran K; Sanderson, Michael W; Alleman, Arthur R; Munderloh, Ulrike G; Ganta, Roman R

    2016-01-01

    Dogs acquire infections with the Anaplasmataceae family pathogens, E. canis, E. chaffeensis, E. ewingii, A. platys and A. phagocytophilum mostly during summer months when ticks are actively feeding on animals. These pathogens are also identified as causing diseases in people. Despite the long history of tick-borne diseases in dogs, much remains to be defined pertaining to the clinical and pathological outcomes of infections with these pathogens. In the current study, we performed experimental infections in dogs with E. canis, E. chaffeensis, A. platys and A. phagocytophilum. Animals were monitored for 42 days to evaluate infection-specific clinical, hematological and pathological differences. All four pathogens caused systemic persistent infections detectible throughout the 6 weeks of infection assessment. Fever was frequently detected in animals infected with E. canis, E. chaffeensis, and A. platys, but not in dogs infected with A. phagocytophilum. Hematological differences were evident in all four infected groups, although significant overlap existed between the groups. A marked reduction in packed cell volume that correlated with reduced erythrocytes and hemoglobin was observed only in E. canis infected animals. A decline in platelet numbers was common with E. canis, A. platys and A. phagocytophilum infections. Histopathological lesions in lung, liver and spleen were observed in all four groups of infected dogs; infection with E. canis had the highest pathological scores, followed by E. chaffeensis, then A. platys and A. phagocytophilum. All four pathogens induced IgG responses starting on day 7 post infection, which was predominantly comprised of IgG2 subclass antibodies. This is the first detailed investigation comparing the infection progression and host responses in dogs after inoculation with four pathogens belonging to the Anaplasmataceae family. The study revealed a significant overlap in clinical, hematological and pathological changes resulting from the

  17. Soroprevalência de anticorpos anti-Ehrlichia canis em cães de Cuiabá, Mato Grosso Seroprevalence anti-Ehrlichia canis antibodies in dogs of Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    José Nivaldo da Silva

    2010-06-01

    Full Text Available A erliquiose canina é uma doença transmitida por carrapatos Rhipicephalus sanguineus e ocasionada pela Ehrlichia canis, bactéria intracelular obrigatória. O presente estudo verificou a prevalência de anticorpos anti-E. canis em 254 cães de quatro regiões administrativas de Cuiabá, Estado de Mato Grosso, por imunofluorescência indireta, observando-se uma prevalência de 42,5% (108/254 sem diferença significativa entre as regiões. As variáveis idade, raça, sexo, hábitat, acesso à zona rural e presença de carrapatos foram analisadas. Os títulos de anticorpos variaram entre 1:40 a 1:2.560. Somente 32 (29,63% cães soropositivos estavam infestados por carrapatos, todos R. sanguineus. O resultado encontrado confirma que não há predisposição racial, sexual ou etária, enquanto a menor ocorrência de cães reagentes no intradomicílio provavelmente está relacionada à baixa infestação por carrapato, apesar de não ter sido observada diferença significativa entre os cães com ou sem a infestação com o carrapato vetor.Canine ehrlichiosis is a disease transmitted by ticks Rhipicephalus sanguineus and caused by Ehrlichia canis, obligatory intracellular bacteria. The present study examined the prevalence of anti-E. canis in 254 dogs from four administrative regions of Cuiabá, Mato Grosso, by indirect immunofluorescence assay. There was a prevalence of 42.5% (108/254 without significant difference between the studied regions. The variables age, breed, sex, habitat, access to rural and ticks were analyzed. The antibody titers ranged from 1:40 to 1:2,560. Only 32 (29.63% seropositive dogs were infested with ticks, all R. sanguineus. The results confirm that do not have breed, sex or age predisposition to ehrlichiosis due E. canis, while the lowest occurrence of reactive dogs indoors probably related to low tick infestation, although no significant difference between dogs with or without infestation with the tick vector.

  18. Gastric cancer

    International Nuclear Information System (INIS)

    Douglass, H.O.

    1988-01-01

    This book contains 10 selections. Some of the titles are: Radiation therapy for gastric cancer; Experimental stomach cancer: Drug selection based on in vitro testing; Western surgical adjuvant trials in gastric cancers: Lessons from current trials to be applied in the future; and Chemotherapy of gastric cancer

  19. Haematopathological Changes in Dogs Affected with Ehrlichia Canis in Lesvos

    Directory of Open Access Journals (Sweden)

    Geromichalou A.

    2017-06-01

    Full Text Available Canine Ehrlichiosis is an important immunosuppressive tick borne disease in dogs. The geographical distribution and transmission is mostly related with Rhipicephalus sanguineus which acts as a vector. There is no predilection of age or sex; all breeds may be infected with Canine Monocytic Ehrlichiosis (CME. The primary targets are monocytic cells. Platelet disorders and serum protein alterations are the principal hematological and biochemical consequences of infections. Clinical signs are almost non-specific. A definitive diagnosis requires: visualization of morulae within monocytes on cytology, detection of serum antibodies with E. canis, the IFA test, or the PCR. The objective of this study was to present information about haematological and biochemical tests of E. canis infected dogs in Lesvos island in Greece, which is an endemic area.

  20. Gastroscopic treatment of gastric band penetrating the gastric wall

    DEFF Research Database (Denmark)

    Jess, Per; Fonnest, G

    1999-01-01

    Gastric wall penetration of a gastric band after operation for morbid obesity is a well known late complication. The treatment is usually reoperation. In this case report we show that a band penetrating the gastric wall can be successfully treated by gastroscopic operation. This technique is more...

  1. Gastric diverticulum causing gastric outlet obstruction in the setting of duodenal atresia

    Directory of Open Access Journals (Sweden)

    Devashis Mukherjee

    2018-04-01

    Full Text Available Duodenal obstruction due to duodenal atresia occurs in 1 in 10,000 live births and is the most common type of intestinal obstruction in neonates [1–3]. Gastric outlet obstruction in the newborn period from causes other than hypertrophic pyloric stenosis is very uncommon [3]. Potential etiologies include gastric volvulus, antral web, and duplication cysts. Gastric diverticula in the infant is even more rare, with only a few case reports published, and only one describes a gastric diverticulum in the presence of a duodenal atresia [4–8]. In this report, we describe the first case of a gastric outlet obstruction due to a gastric diverticulum in the presence of duodenal atresia. Keywords: Duodenal atresia, Gastric diverticulum, Gastric outlet obstruction

  2. Seroepidemiology of Toxocara canis infection among primary schoolchildren in the capital area of the Republic of the Marshall Islands.

    Science.gov (United States)

    Fu, Chung-Jung; Chuang, Ting-Wu; Lin, Huei-Shan; Wu, Chih-Hsiung; Liu, Yung-Ching; Langinlur, Mailynn K; Lu, Min-Yun; Hsiao, Wesley Wei-Wen; Fan, Chia-Kwung

    2014-05-15

    Toxocariasis, which is predominantly caused by Toxocara canis (T. canis) infection, is a common zoonotic parasitosis worldwide; however, the status of toxocariasis endemicity in the Republic of the Marshall Islands (RMI) remains unknown. A seroepidemiological investigation was conducted among 166 primary school children (PSC) aged 7-12 years from the capital area of the RMI. Western blots based the excretory-secretory antigens of larval T. canis (TcES) was employed, and children were considered seropositive if their serum reacted with TcES when diluted at a titer of 1:64. Information regarding demographic characteristics of and environmental risk factors affecting these children was collected using a structured questionnaire. A logistic regression model was applied to conduct a multivariate analysis. The overall seropositive rate of T. canis infection was 86.75% (144/166). In the univariate analysis, PSC who exhibited a history of feeding dogs at home (OR = 5.52, 95% CI = 1.15-26.61, p = 0.02) and whose parents were employed as nonskilled workers (OR = 2.86, 95% CI = 1.08-7.60, p = 0.03) demonstrated a statistically elevated risk of contracting T. canis infections. Cleaning dog huts with gloves might prevent infection, but yielded nonsignificant effects. The multivariate analysis indicated that parental occupation was the critical risk factor in this study because its effect remained significant after adjusting for other variables; by contrast, the effect of dog feeding became nonsignificant because of other potential confounding factors. No associations were observed among gender, age, consuming raw meat or vegetables, drinking unboiled water, cleaning dog huts with gloves, or touching soil. This is the first serological investigation of T. canis infection among PSC in the RMI. The high seroprevalence indicates the commonness of T. canis transmission and possible human risk. The fundamental information that the present study provides

  3. Serological survey of Brucella canis in dogs in urban Harare and selected rural communities in Zimbabwe

    Directory of Open Access Journals (Sweden)

    Simbarashe Chinyoka

    2014-04-01

    Full Text Available A cross-sectional study was conducted in order to detect antibodies for Brucella canis (B. canis in dogs from urban Harare and five selected rural communities in Zimbabwe. Sera from randomly selected dogs were tested for antibodies to B. canis using an enzyme-linked immunosorbent assay. Overall, 17.6% of sera samples tested (57/324, 95% CI: 13.5–21.7 were positive for B. canis antibodies. For rural dogs, seroprevalence varied from 11.7% – 37.9%. Rural dogs recorded a higher seroprevalence (20.7%, 95% CI: 15.0–26.4 compared with Harare urban dogs (12.7%, 95% CI: 6.9–18.5 but the difference was not significant (p = 0.07. Female dogs from both sectors had a higher seroprevalence compared with males, but the differences were not significant (p > 0.05. Five and two of the positive rural dogs had titres of 1:800 and 1:1600, respectively, whilst none of the positive urban dogs had a titre above 1:400. This study showed that brucellosis was present and could be considered a risk to dogs from the studied areas. Further studies are recommended in order to give insight into the epidemiology of brucellosis in dogs and its possible zoonotic consequences in Zimbabwe. Screening for other Brucella spp. (Brucella abortus, Brucella melitensis and Brucella suis other than B. canis is also recommended.

  4. Seroprevalence of Toxocara canis infection in tropical Venezuela.

    Science.gov (United States)

    Lynch, N R; Eddy, K; Hodgen, A N; Lopez, R I; Turner, K J

    1988-01-01

    An enzyme-linked immunosorbent assay (ELISA) was used to determine the seroprevalence of Toxocara canis infection in different socio-economic groups of the tropical population of Venezuela. The lack of definitive independent diagnostic criteria for toxocariasis required the establishment of operational upper limits of normality for Toxocara ELISA values, based upon their log-normalized distribution in a presumptive "non-toxocariasis" sub-population. Only 1.8% of urban subjects of medium-high socio-economic level were considered to be clearly positive in Toxocara ELISA, compared to 20.0% of urban slum dwellers, 25.6% rural subsistence farmers and 34.9% Amazon Indians. As the test was performed using excretory-secretory antigen, and under conditions of competitive inhibition by soluble extracts of non-homologous parasites, co-infection by common intestinal helminths, protozoa or other organisms did not give rise to false positive results. However, strong cross-reactivity with Onchocerca volvulus may have influenced the prevalence figure obtained for the Amazon Indians. These results indicate that T. canis is yet another parasite that is widely distributed in economically underprivileged tropical populations.

  5. Gastric pseudolymphoma

    International Nuclear Information System (INIS)

    Blum, U.; Hellerich, U.; Bodendoerfer, G.; Wimmer, B.; Ruf, G.; Freiburg Univ.; Freiburg Univ.

    1989-01-01

    Gastric pseudolymphoma is an uncommon benign lesion which poses a difficult problem in diagnosis and management. Lymphoid hyperplasia of the stomach, however, may occasionally precede true gastric lymphoma. Endoscopic, radiologic and pathological findings are not generally helpful in establishing the diagnosis preoperatively. Benign gastric lymphoid hyperplasia could be mistaken radiologically for ulcerated gastric carcinoma and pathologically for malignant lymphoma. Recognition of this condition is important to prevent unnecessary treatment by surgery or radiotherapy. About 140 case reports have been published to date. This paper describes the cases of two further patients. (orig.) [de

  6. Hematologic changes in dogs naturally infected Leptospira spp., Brucella abortus and Brucella canis

    Directory of Open Access Journals (Sweden)

    Jacqueline Ribeiro de Castro

    2014-01-01

    Full Text Available ABSTRACT. Castro J.R., Silva C.B., Souza M.A., Salaberry S.R.S., Guimarães E.C., Mundim A.V. & Lima-Ribeiro A.M.C. [Hematologic changes in dogs naturally infected Leptospira spp., Brucella abortus and Brucella canis.] Altera- ções hematológicas em cães naturalmente infectados por Leptospira spp., Brucella abortus e Brucella canis. Revista Brasileira de Medicina Veterinária, 36(1:49-54, 2014. Laboratório de Doenças Infectocontagiosas, Faculdade de Medicina Veterinária, Universidade Federal de Uberlândia, Av. Ceará s/n, Bloco 2D, Sala 33, Campus Umuarama, Uberlândia, MG 38400-902, Brasil. E-mail: jack_ufu@yahoo.com.br The investigations of leptospirosis and brucellosis canine act as sanitary control in public health and zoonoses because they were established by close contact between dog and human. The aim was to determine the main hematological reagents in asymptomatic dogs against Leptospira spp. Brucella abortus and Brucella canis naturally infected, living in urban areas in the city of Uberlandia, Minas Gerais. We examined 140 blood samples from clinically healthy dogs, males and females and different ages. Leptospirosis was diagnosed by microscopic agglutination test (MAT, with a collection of twelve serovars, whereas, brucellosis was identified through the tests of Agar Gel Immunodiffusion (AGID for B. canis and buffered acidified antigen (TAA confirmed 2-Mercaptoethanol (2-ME for B. abortus. The results were analyzed using descriptive statistics with the calculation of simple percentages, mean and standard deviation. He applied and short sample t test for two independent samples to assess whether there were significant differences (p<0.05 between hematological parameters obtained. Dogs evaluated, 15% (21/140 and 2.85% (4/140 were reactive to Leptospira spp. and B. abortus, respectively. There was no sample reagent against B. canis. It was concluded that although no specific thrombocytopenia may be a significant finding in dogs

  7. Soroepidemiologia da brucelose canina causada por Brucella canis e Brucella abortus na cidade de Alfenas, MG Seroepidemiology of canine brucellosis caused by Brucella canis and Brucella abortus in Alfenas, MG, Brazil

    Directory of Open Access Journals (Sweden)

    A.C. Almeida

    2004-04-01

    Full Text Available The prevalence of canine brucellosis was evaluated in the city of Alfenas, MG through the technique of agarose gel imunodifusion for Brucella canis and slow serum agglutination test with 2-mercaptoetanol for Brucella abortus. The prevalence was of 14.2% and 2.8%, respectively, for B. canis and B. abortus. The positives, characterized by animals above one year of age (77.8%, and mongrel dogs (56.2%, showed a prevalence of 50 and 48% for males and females, respectively. The canine brucellosis was prevalent in the city principally in dogs of outskirts.

  8. Molecular epidemiology of parasitic protozoa and Ehrlichia canis in wildlife in Madrid (central Spain).

    Science.gov (United States)

    Criado-Fornelio, Angel; Martín-Pérez, T; Verdú-Expósito, C; Reinoso-Ortiz, S A; Pérez-Serrano, J

    2018-07-01

    Wildlife species are involved in the transmission of diverse pathogens. This study aimed to monitor raccoons (Procyon lotor), American minks (Neovison vison), and red foxes (Vulpes vulpes) as potential reservoirs in central Spain. Specifically, 200 spleen and fecal samples (from 194 raccoons, 3 minks, and 3 foxes) were analyzed molecularly by PCR/qPCR and sequencing for the presence of piroplasmids, Hepatozoon spp., Toxoplasma gondii, and Ehrlichia canis infections in the Community of Madrid (Spain). Biological samples were obtained in the years 2014, 2015, and 2016. No pathogen DNA was found in fecal samples. In contrast, analysis of raccoon spleen samples revealed that Toxoplasma was the most prevalent pathogen (prevalence 3.6 ± 2.6%), followed by Hepatozoon canis and E. canis (each with a prevalence of 2.57 ± 2.2%). Hepatozoon canis was also diagnosed in all three of the analyzed foxes. Analysis of yearly prevalence showed that tick-borne pathogens were less frequent in raccoon in 2015, a dry and warm year compared both to 2014 and 2016. These data suggest that fecal PCR assays are unsuitable for detection of DNA of non-erythrocytic pathogens. Furthermore, they demonstrate that the raccoon (an invasive species often living in proximity to domestic areas) and the red fox are putative reservoirs for pathogenic organisms in the Community of Madrid.

  9. Hepatozoon canis and Leishmania spp. coinfection in dogs diagnosed with visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Fernanda Nazaré Morgado

    Full Text Available Abstract This study describes the occurrence of dogs naturally co-infected with Hepatozoon canis and two Leishmania species: L. infantum or L. braziliensis. Four dogs serologically diagnosed with Visceral Leishmaniasis were euthanized. Liver and spleen samples were collected for histopathological analysis and DNA isolation. H. canis meronts were observed in tissues from all four dogs. H. canis infection was confirmed by PCR followed by sequencing of a fragment of 18S rRNA gene. Leishmania detection and typing was confirmed by ITS1' PCR-RFLP and parasite burden was calculated using ssrRNA quantitative qPCR. A DPP - Dual Path platform test was performed. One out (Dog #2 of four animals was asymptomatic. Dogs #1 and #4 were infected by L. infantum and were DPP test positive. Dogs #2 and #3 were infected by L. braziliensis and were DPP test negative. Furthermore, visceral dissemination was observed in Dogs #2 and #3, since L. braziliensis was detected in liver and spleen samples. The visceral dissemination of L. braziliensis associated with systemic signs suggested that this co-infection could influence the parasite burden and disease progression.

  10. Helicobacter pylori infection, glandular atrophy and intestinal metaplasia in superficial gastritis, gastric erosion, erosive gastritis, gastric ulcer and early gastric cancer

    OpenAIRE

    Zhang, Chuan; Yamada, Nobutaka; Wu, Yun-Lin; Wen, Min; Matsuhisa, Takeshi; Matsukura, Norio

    2005-01-01

    AIM: To evaluate the histological features of gastric mucosa, including Helicobacter pylori infection in patients with early gastric cancer and endoscopically found superficial gastritis, gastric erosion, erosive gastritis, gastric ulcer.

  11. ELEVATED TRANS-MAMMARY TRANSMISSION OF Toxocara canis LARVAE IN BALB/c MICE

    Directory of Open Access Journals (Sweden)

    Paula de Lima Telmo

    2015-02-01

    Full Text Available Toxocariasis is a widespread zoonosis and is considered an important worldwide public health problem. The aim of this study was to investigate the frequency of trans-mammary Toxocara canis infection in newborn BALB/c mice nursed by females experimentally infected with 1,200 eggs after delivery. After 50 days of age, the presence of larvae in different organs of the offspring was investigated. Trans-mammary infection was confirmed in 73.9% of the mice that had been nursed by infected females. These data show a high trans-mammary transmission of T. canis and confirm the significance of this transmission route in paratenic hosts.

  12. Gastric cancer

    International Nuclear Information System (INIS)

    Salek, T.

    2007-01-01

    Gastric cancer is still a major health problem and a leading cause of cancer mortality despite a worldwide decline in incidence. Primarily due to early detection of the disease, the results of treatment for gastric cancer have improved in Japan, Korea and several specialized Western centres. Surgery offers excellent long-term survival results for early gastric cancer (EGC). In the Western world, however more than 80 % of patients at diagnosis have an advanced gastric cancer with a poor prognosis. The aim of surgery is the complete removal of the tumour (UICC R0-resection), which is known to be the only proven, effective treatment modality and the most important treatmentrelated prognostic factor. The prognosis after surgical treatment of gastric cancer remains poor. Neoadjuvant chemotherapy is a rising option in locally advanced gastric cancer. Adjuvant chemoradiation has been shown to be beneficial in gastric cancer patients who have undergone suboptimal surgical resection. The benefits of adjuvant chemotherapy alone seem to be very small, Untreated metastatic gastric cancer is associated with a median survival of only 3 - 4 months, but this can be increased to 8 - 10 months, associated with improved quality of life, with combination chemotherapy. Currently, no standard combination chemotherapy regimen exists, although regimens utilizing both cisplatin and 5-fluorouracil, such as epirubicin/cisplatin/fluorouracil (ECF) or docetaxel/cisplatin/fluorouracil (DCF) are amongst the most active. Newer chemotherapeutic agents, including irinotecan, oxaliplatin and taxanes, show promising activity, and are currently being tested with biologics in clinical trials. (author)

  13. Psuedotumoral gastric varices

    International Nuclear Information System (INIS)

    Yoon, Yong Kyu; Kim, Choon Won

    1974-01-01

    The roentgenographic recognition of gastric varices often is difficult, even when there is a history of liver disease or splenomegaly without demonstrable esophageal varices. An apparant polypoid filling defect with exaggerated mucosal folds in proximal portion of the gastric body and funds on upper GI series, accompanied by hematemesis and splenomegly should suggest the presence of pseudotumoral gastric varices. We have an experience a case of polypoid filling defects in gastric fundus of psudotumoral gastric varices of 49 years old Korean woman, which was diagnosed by surgical and histopathological findings

  14. Molecular detection of Theileria annae and Hepatozoon canis in foxes (Vulpes vulpes) in Croatia.

    Science.gov (United States)

    Dezdek, Danko; Vojta, Lea; Curković, Snjezana; Lipej, Zoran; Mihaljević, Zeljko; Cvetnić, Zeljko; Beck, Relja

    2010-09-20

    An epizootiological field study on tick-borne protozoan infections in foxes (Vulpes vulpes) was carried out in different parts of Croatia. Spleen samples of 191 carcasses of red foxes killed in sanitary hunting, were examined for the presence of hematozoa by polymerase chain reaction (PCR) and subsequent sequencing. The investigation revealed four species of hematozoa in 57 foxes (30%), namely Theileria annae, Theileria sp. 3182/05 and Hepatozoon canis. T. annae was found in 10 foxes (5%), Theileria sp. 3182/05 in a single animal (1%), H. canis in 44 (23%) and Hepatozoon sp. was detected in two foxes (1%). T. annae and H. canis were distributed through all the studied regions, while Theileria sp. 3182/05 and Hepatozoon sp. were restricted to the Zagreb and Zagorje, and Istria regions, respectively. Detection of T. annae in all regions of Croatia indicates the presence of the natural cycle of the parasite and raises the possibility of other vectors other than the proposed Ixodes hexagonus.

  15. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India

    Science.gov (United States)

    Chhabra, Sushma; Uppal, Sanjeev Kumar; Singla, Lachhman Das

    2013-01-01

    Objective To evaluate clinical and hematological aspects of dogs naturally infected with Hepatozoon canis (H. canis) presented at the Small Animal Clinics of Guru Angad Dev Veterinary and Animal Sciences University, Ludhiana. Methods Blood films of 34 naturally infected dogs were examined for haematological alterations and parasitaemia. Signalment and clinical signs were recorded from the animals. Clinical histories were filled out during the consultation. Results Of the 34 positive dogs by Giemsa stained peripheral blood films, 88.23% presented parasitaemia by H. canis only, while 11.77% had the combination of H. canis, Babesia sp. and Ehrlichia sp. Young male dogs less than one-year-old, of non-descript breed, were the most commonly affected. And 26.47% were presented with anorexia/inappetence as the only clinical symptom. Other clinical symptoms were mild to moderate fever, pale mucosae and lethargy; a few were also showing the signs of vomiting and diarrhoea. Haematological alterations showed mainly normochromic-normocytic anaemia, leukocytosis and neutrophilia. Conclusions The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration. PMID:23730562

  16. Retrospective study of clinical and hematological aspects associated with dogs naturally infected by Hepatozoon canis in Ludhiana, Punjab, India.

    Science.gov (United States)

    Chhabra, Sushma; Uppal, Sanjeev Kumar; Singla, Lachhman Das

    2013-06-01

    To evaluate clinical and hematological aspects of dogs naturally infected with Hepatozoon canis (H. canis) presented at the Small Animal Clinics of Guru Angad Dev Veterinary and Animal Sciences University, Ludhiana. Blood films of 34 naturally infected dogs were examined for haematological alterations and parasitaemia. Signalment and clinical signs were recorded from the animals. Clinical histories were filled out during the consultation. Of the 34 positive dogs by Giemsa stained peripheral blood films, 88.23% presented parasitaemia by H. canis only, while 11.77% had the combination of H. canis, Babesia sp. and Ehrlichia sp. Young male dogs less than one-year-old, of non-descript breed, were the most commonly affected. And 26.47% were presented with anorexia/inappetence as the only clinical symptom. Other clinical symptoms were mild to moderate fever, pale mucosae and lethargy; a few were also showing the signs of vomiting and diarrhoea. Haematological alterations showed mainly normochromic-normocytic anaemia, leukocytosis and neutrophilia. The findings of this study substantiate that H. canis caused clinical and haematological alterations of the varied intensity in dogs, even with low parasitaemia, should be taken into consideration.

  17. [AFP-producing gastric cancer and hepatoid gastric cancer].

    Science.gov (United States)

    Wang, Y K; Zhang, X T

    2017-11-23

    AFP-producing gastric cancer(AFPGC) and hepatoid adenocarcinoma of the stomach (HAS) are two special subtypes of gastric cancer. There are both correlation and difference between them. AFPGC is usually identified as primary gastric cancer with serum AFP level more than 20 ng/ml or showed AFP positive staining by immunohistochemistry. The diagnosis of HAS is mainly dependent on the pathological character of hepatocellular carcinoma-like differentiation of gastric cancer. The morbidity of AFPGC and HAS are rather low, especially the incidence of HAS is about 1%. The prognoses of these two subtypes are poorer than that of common gastric adenocarcinoma, due to a high incidence rate of liver metastasis and lymph node metastasis. With the development of next-generation sequencing and other genomic technologies, gastric cancers, including these two rare subtypes, are now being investigated in more detail at the molecular level. Treatment remains the biggest challenge, early diagnosis and radical resection can dramatically improve patients'prognosis. Monitoring serum AFP and abdominal imaging examination during follow-up is important for early detection of liver metastasis. In combination with local treatment methods such as transarterial chemoembolization and radiofrequency ablation of liver may further extend patients'survival time. Targeted therapy owes a great potential value in the future.

  18. Increased risk of gastric adenocarcinoma after treatment of primary gastric diffuse large B-cell lymphoma

    International Nuclear Information System (INIS)

    Inaba, Koji; Morota, Madoka; Mayahara, Hiroshi; Ito, Yoshinori; Sumi, Minako; Uno, Takashi; Itami, Jun; Kushima, Ryoji; Murakami, Naoya; Kuroda, Yuuki; Harada, Ken; Kitaguchi, Mayuka; Yoshio, Kotaro; Sekii, Shuhei; Takahashi, Kana

    2013-01-01

    There have been sporadic reports about synchronous as well as metachronous gastric adenocarcinoma and primary gastric lymphoma. Many reports have dealt with metachronous gastric adenocarcinoma in mucosa-associated lymphoid tissue lymphoma of stomach. But to our knowledge, there have been no reports that document the increased incidence of metachronous gastric adenocarcinoma in patients with gastric diffuse large B-cell lymphoma. This retrospective study was conducted to estimate the incidence of metachronous gastric adenocarcinoma after primary gastric lymphoma treatment, especially in diffuse large B-cell lymphoma. The retrospective cohort study of 139 primary gastric lymphoma patients treated with radiotherapy at our hospital. Mean observation period was 61.5 months (range: 3.7-124.6 months). Patients profile, characteristics of primary gastric lymphoma and metachronous gastric adenocarcinoma were retrieved from medical records. The risk of metachronous gastric adenocarcinoma was compared with the risk of gastric adenocarcinoma in Japanese population. There were 10 (7.2%) metachronous gastric adenocarcinoma patients after treatment of primary gastric lymphomas. It was quite high risk compared with the risk of gastric carcinoma in Japanese population of 54.7/100,000. Seven patients of 10 were diffuse large B-cell lymphoma and other 3 patients were mixed type of diffuse large B-cell lymphoma and mucosa associated lymphoid tissue lymphoma. Four patients of 10 metachronous gastric adenocarcinomas were signet-ring cell carcinoma and two patients died of gastric adenocarcinoma. Metachronous gastric adenocarcinoma may have a more malignant potential than sporadic gastric adenocarcinoma. Old age, Helicobacter pylori infection and gastric mucosal change of chronic gastritis and intestinal metaplasia were possible risk factors for metachronous gastric adenocarcinoma. There was an increased risk of gastric adenocarcinoma after treatment of primary gastric lymphoma

  19. Gastric stem cells and gastric cancer stem cells

    OpenAIRE

    Han, Myoung-Eun; Oh, Sae-Ock

    2013-01-01

    The gastric epithelium is continuously regenerated by gastric stem cells, which give rise to various kinds of daughter cells, including parietal cells, chief cells, surface mucous cells, mucous neck cells, and enteroendocrine cells. The self-renewal and differentiation of gastric stem cells need delicate regulation to maintain the normal physiology of the stomach. Recently, it was hypothesized that cancer stem cells drive the cancer growth and metastasis. In contrast to conventional clonal ev...

  20. Gastric inhibitory polypeptide does not inhibit gastric emptying in humans

    DEFF Research Database (Denmark)

    Meier, Juris J; Goetze, Oliver; Anstipp, Jens

    2004-01-01

    ) = 0.15, P = 0.15 for intact GIP; r(2) = 0.21, P = 0.086 for total GIP). We conclude that gastric emptying does not appear to be influenced by GIP. The secretion of GIP after meal ingestion is not suppressed by its exogenous administration. The lack of effect of GIP on gastric emptying underlines......The insulinotropic gut hormone gastric inhibitory polypeptide (GIP) has been demonstrated to inhibit gastric acid secretion and was proposed to possess "enterogastrone" activity. GIP effects on gastric emptying have not yet been studied. Fifteen healthy male volunteers (23.9 +/- 3.3 yr, body mass....... Gastric emptying was calculated from the (13)CO(2) exhalation rates in breath samples collected over 360 min. Venous blood was drawn in 30-min intervals for the determination of glucose, insulin, C-peptide, and GIP (total and intact). Statistical calculations were made by use of repeated-measures ANOVA...

  1. The situation of the wolf (Canis lupus in the area of the Regional Park of the Simbruini Mountains / La situazione del Lupo (Canis lupus nell'area del Parco Naturale Regionale dei Monti Simbruini

    Directory of Open Access Journals (Sweden)

    Paolo Verucci

    1992-07-01

    Full Text Available Abstract This work presents the results of a field research on the species Canis lupus in the Regional Park of the Simbruini Mountains. In relation to Wolf conservation, an investigation on feral and free-roving dogs was carried out. The method of snowtracking was used for Wolves and Feral dogs, the method of sighting was used for free-roving dogs. The research underlines the importance of the Simbruini Mountains for the protection of Wolf in central Apennines and the factors, at present, threatening its survival. Riassunto Nel presente lavoro vengono illustrati i risultati di una ricerca sul campo sulla specie Canis lupus nel Parco Naturale Regionale dei Monti Simbruini. In relazione agli aspetti riguardanti la conservazione del Lupo, è stata compiuta un'indagine sul fenomeno del randagismo canino. Per i lupi e i cani inselvatichiti è stato usato il metodo dello snowtracking, per le altre categorie di Cani è stato utilizzato il metodo dell'avvistamento. La ricerca ha messo in luce l'importanza dell'area dei Simbruini per la salvaguardia del Lupo nell'Appennino centrale e i fattori che, attualmente, ne minacciano la sopravvivenza.

  2. A report of a Hepatozoon canis infection in a dog with transmissible venereal tumour

    Directory of Open Access Journals (Sweden)

    Namakkal Rajamanickam Senthil

    2015-10-01

    Full Text Available In the present study, a case of a Hepatozoan canis infection in a dog with a sexually transmissible venereal tumour is reported. Haematological examination revealed marked decrease in haemoglobin, PCV and RBC counts and the blood smear revealed rouleaux formation of RBC, hypochromasia, leptocytes and neutrophilia. Neutrophils were parasitized with both non-nucleated and stained nucleated forms of H. canis. Serum biochemistry results showed elevated levels of alkaline phosphatise, whereas blood urea nitrogen, creatinine, total protein, albumin and globulin were in the normal range.

  3. Hereditary Diffuse Gastric Cancer

    Science.gov (United States)

    ... Hereditary Diffuse Gastric Cancer Request Permissions Hereditary Diffuse Gastric Cancer Approved by the Cancer.Net Editorial Board , 10/2017 What is hereditary diffuse gastric cancer? Hereditary diffuse gastric cancer (HDGC) is a rare ...

  4. Ehrlichia canis morulae and DNA detection in whole blood and spleen aspiration samples.

    Science.gov (United States)

    Faria, Joice Lara Maia; Dagnone, Ana Sílvia; Munhoz, Thiago Demarchi; João, Carolina Franchi; Pereira, Wanderson Adriano Biscola; Machado, Rosângela Zacarias; Tinucci-Costa, Mirela

    2010-01-01

    The aim of this study was to compare the detection of Ehrlichia canis morulae and DNA by nPCR in whole blood and spleen aspiration. The sample included 40 dogs showing thrombocytopenia associated to clinical signs suggestive of canine ehrlichiosis. Morulae detection showed that in 35 of the dogs studied, 17 had morulae in spleen tissue, and two in buffy coat smears. E. canis DNA was detected in 29/40 blood samples. We verified that morulae detection is more efficient in cytological preparations from spleen aspiration. On the other hand, nPCR on spleen and blood samples were equally efficient for disease diagnosis.

  5. Road Killed Carnivores Illustrate the Status of Zoonotic Helminthes in Caspian Sea Littoral of Iran.

    Science.gov (United States)

    Vafae Eslahi, Aida; Kia, Eshrat Beigom; Mobedi, Iraj; Sharifdini, Meysam; Badri, Milad; Mowlavi, Gholamreza

    2017-01-01

    Carnivore carcasses on the roads can be regarded as study materials in parasitology and eco-epidemiology. Stray carnivores such as dogs and cats are known to harbor so many different pathogens like zoonotic helminthes. The current investigation, apparent the status of the helminthic parasites found in road killed carnivores from different parts of Guilan Province north of Iran. Fifty road killed carnivores including 27 stray dogs ( Canis familiaris ), 11 golden jackals ( Canis aureus ) and 12 stray cats ( Felis catus ) were collected from 21 locations of Guilan Province, during Apr to Nov 2015. Internal organs of the carcasses, including digestive tract, heart, kidneys, lungs, liver, skin, eyes as well as muscles were carefully inspected and sampled for helminthological investigation. About 80% of the 50 carnivores, (stray dogs 77.77%, golden jackals 81.81%, and stray cats 91.66%) were found naturally infected with helminthic parasites. Dipylidum caninum , Toxocara cati , Toxocara canis , Toxascaris leonine , Ancylostoma caninum , Ancylostoma tubaeforme , Dirofilaria immitis , Dioctophyma renale , Dipylidum caninum , Echinococcus granulosus , Mesocestoides spp ., Taenia hydatigena, Taenia hydatigera , Joyuxiella spp. , Spirometra spp. are reported herein. The prevalent occurrence of zoonotic helminthes such as T. canis , T. cati , T. leonina , E. granulosus , D. immitis and D. renale in stray carnivores should be considered as a public health hazard, specifically within a vast tourism area like Guilan Province.

  6. Road Killed Carnivores Illustrate the Status of Zoonotic Helminthes in Caspian Sea Littoral of Iran

    Directory of Open Access Journals (Sweden)

    Aida VAFAE ESLAHI

    2017-06-01

    Full Text Available Background: Carnivore carcasses on the roads can be regarded as study materials in parasitology and eco-epidemiology. Stray carnivores such as dogs and cats are known to harbor so many different pathogens like zoonotic helminthes. The current investigation, apparent the status of the helminthic parasites found in road killed carnivores from different parts of Guilan Province north of Iran.Methods: Fifty road killed carnivores including 27 stray dogs (Canis familiaris, 11 golden jackals (Canis aureus and 12 stray cats (Felis catus were collected from 21 locations of Guilan Province, during Apr to Nov 2015. Internal organs of the carcasses, including digestive tract, heart, kidneys, lungs, liver, skin, eyes as well as muscles were carefully inspected and sampled for helminthological investigation.Results: About 80% of the 50 carnivores, (stray dogs 77.77%, golden jackals 81.81%, and stray cats 91.66% were found naturally infected with helminthic parasites. Dipylidum caninum, Toxocara cati, Toxocara canis, Toxascaris leonine, Ancylostoma caninum, Ancylostoma tubaeforme, Dirofilaria immitis, Dioctophyma renale, Dipylidum caninum, Echinococcus granulosus, Mesocestoides spp., Taenia hydatigena, Taenia hydatigera, Joyuxiella spp., Spirometra spp. are reported herein.Conclusion: The prevalent occurrence of zoonotic helminthes such as T. canis, T. cati, T. leonina, E. granulosus, D. immitis and D. renale in stray carnivores should be considered as a public health hazard, specifically within a vast tourism area like Guilan Province.

  7. Factores asociados a la infección por Ehrlichia canis en perros infestados con garrapatas en la ciudad de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Edward Huerto-Medina

    Full Text Available El objetivo del estudio fue determinar la frecuencia y factores asociados a la infección por Ehrlichia canis en perros. Se recolectaron muestras de sangre de 150 perros infestados con garrapatas en 10 consultorios veterinarios de la ciudad de Huánuco en Perú, los perros fueron seleccionados al azar sin distinción de raza, edad ni sexo. Se detectó anticuerpos contra Ehrlichia canis mediante inmunoensayo cromatográfico. El 51,3% de perros estuvieron infectados por Ehrlichia canis. En el análisis multivariado se encontraron asociados a la presencia Ehrlichia canis, el mal estado de salud del perro (p=0,049, un promedio mayor de infestación por garrapatas (p=0,018, perros de edad adulta (p=0,038. La frecuencia de Ehrlichia canis en perros de esta ciudad es alta. Se recomienda el control de la garrapata marrón del perro (Rhipicephalus sanguineus vector de la Ehrlichia canis

  8. Gastric Sleeve Surgery

    Science.gov (United States)

    ... Videos for Educators Search English Español Gastric Sleeve Surgery KidsHealth / For Teens / Gastric Sleeve Surgery What's in ... or buying healthy food ) Preparing for Gastric Sleeve Surgery Preparing for this major operation takes months of ...

  9. Prevalence and diversity of Hepatozoon canis in naturally infected dogs in Japanese islands and peninsulas.

    Science.gov (United States)

    El-Dakhly, Khaled Mohamed; Goto, Minami; Noishiki, Kaori; El-Nahass, El-Shaymaa; Hirata, Akihiro; Sakai, Hiroki; Takashima, Yasuhiro; El-Morsey, Ahmed; Yanai, Tokuma

    2013-09-01

    Canine hepatozoonosis is a worldwide protozoal disease caused by Hepatozoon canis and Hepatozoon americanum and is transmitted by ixodid ticks, Rhipicephalus and Amblyomma spp., respectively. H. canis infection is widespread in Africa, Europe, South America, and Asia, including Japan. The objective of this study was to study the distribution pattern and diversity of H. canis in naturally infected dogs in nine Japanese islands and peninsulas. Therefore, 196 hunting dogs were randomly sampled during the period from March to September 2011 and the ages and sexes were identified. Direct microscopy using Giemsa-stained blood smears revealed H. canis gametocytes in the peripheral blood of 45 (23.6%) dogs. Polymerase chain reaction (PCR) was performed on EDTA-anticoagulated blood, initially with the common primer set (B18S-F and B18S-R) amplifying the 1,665-bp portion of the 18S rRNA gene, and then with the specific primer set (HepF and HepR) amplifying about 660 bp fragments of the same gene. Based on PCR, 84 (42.9%) dogs were positive using the common primer and 81 (41.3%) were positive using the specific primer. The current investigation indicated that all screened areas, except for Sado Island and Atsumi Peninsula, were infected. Yaku Island had the highest infection rate (84.6% in males and 100.0% in females), while Ishigaki Island showed the lowest infection rates (8.3% in males and 17.7% in females). Both sexes were infected with no significant difference. However, diversity of infection among the surveyed islands and peninsulas was significantly different (P canis has previously been reported in dogs in Japan, the higher infection rate described in the current study and the diversity of infection in a wide range of islands strongly encourage prospective studies dealing with the prevention and treatment of the infection in dogs, as well as control of ticks.

  10. Prevalence and Characteristics of Streptococcus canis Strains Isolated from Dogs and Cats

    Directory of Open Access Journals (Sweden)

    P. Lysková

    2007-01-01

    Full Text Available To determine the prevalence of Streptococcus canis in dogs and cats, a total of 926 swabs were examined bacteriologically in the period from 2003 to 2005. Eighty-six isolates obtained from various anatomical locations were further characterized for their phenotypic properties. The most frequently isolated biotype produced phosphatase, leucine amidopeptidase, arginine dihydrolase, alpha-D- and beta-D-galactosidase and fermented lactose and ribose. Additional identification by species-specific amplification of the 16S-23S rRNA intergenic spacer region was consistent with S. canis. All isolates were susceptible to penicillin G and ampicillin. The least effective antimicrobial agent was found to be tetracycline (only 33.8% of susceptible strains.

  11. Development of a real-time PCR to detect Demodex canis DNA in different tissue samples.

    Science.gov (United States)

    Ravera, Ivan; Altet, Laura; Francino, Olga; Bardagí, Mar; Sánchez, Armand; Ferrer, Lluís

    2011-02-01

    The present study reports the development of a real-time polymerase chain reaction (PCR) to detect Demodex canis DNA on different tissue samples. The technique amplifies a 166 bp of D. canis chitin synthase gene (AB 080667) and it has been successfully tested on hairs extracted with their roots and on formalin-fixed paraffin embedded skin biopsies. The real-time PCR amplified on the hairs of all 14 dogs with a firm diagnosis of demodicosis and consistently failed to amplify on negative controls. Eleven of 12 skin biopsies with a morphologic diagnosis of canine demodicosis were also positive. Sampling hairs on two skin points (lateral face and interdigital skin), D. canis DNA was detected on nine of 51 healthy dogs (17.6%) a much higher percentage than previously reported with microscopic studies. Furthermore, it is foreseen that if the number of samples were increased, the percentage of positive dogs would probably also grow. Moreover, in four of the six dogs with demodicosis, the samples taken from non-lesioned skin were positive. This finding, if confirmed in further studies, suggests that demodicosis is a generalized phenomenon in canine skin, due to proliferation of local mite populations, even though macroscopic lesions only appear in certain areas. The real-time PCR technique to detect D. canis DNA described in this work is a useful tool to advance our understanding of canine demodicosis.

  12. Transmission trials, ITS2-PCR and RAPD-PCR show identity of Toxocara canis isolates from red fox and dog.

    Science.gov (United States)

    Epe, C; Meuwissen, M; Stoye, M; Schnieder, T

    1999-07-01

    Toxocara canis isolates from dog and from red fox were compared in transmission trials and with molecular analysis using RAPD-PCR technique and comparison of the ITS2 sequence. After oral infection of bitches with 20,000 embryonated T. canis eggs of vulpine and canine origin, the vertical transmission to pup's was examined. All animals of both groups developed typical clinical symptoms of toxocarosis. The haematological, serological, parasitological and post mortem results showed no differences between both isolates except for the infectivity of T. canis stages in mice where the fox isolate showed a significant higher infectivity than the dog isolate. The RAPD-PCR showed a similarity coefficient of 0.95, similar to the range of intraspecific variation in Toxocara cati and Toxascaris leonina specimens as outgroups. The ITS2 comparison showed a 100% identity between both isolates with no intraspecific variations. Therefore, the study shows that the fox and the dog isolate of T. canis were identical in infectivity, transmission and molecular structure; a host adaptation could not be found and the fox has to be seen as a reservoir for T. canis infections in dogs. Considering the increasing number of foxes in urban areas the importance of helminth control in dogs is stressed.

  13. Two randomized, controlled studies to assess the efficacy and safety of lotilaner (Credelio™ in preventing Dermacentor reticulatus transmission of Babesia canis to dogs

    Directory of Open Access Journals (Sweden)

    Daniela Cavalleri

    2017-11-01

    Full Text Available Abstract Background Dogs worldwide are at risk of Babesia spp. infections. Preventive efficacy of lotilaner tablets (Credelio™, Elanco against Babesia canis was evaluated in two studies. Methods Sixteen dogs in Study 1 and 12 dogs in Study 2, all seronegative and polymerase chain reaction (PCR negative for B. canis, were randomized to a sham-treated control group or a lotilaner (20–43 mg/kg treatment group, administered on Day 0 (Study 1: n = 8/group; Study 2: n = 6/group. Dogs were each infested with 50 Dermacentor reticulatus, a percentage of which (Study 1: 8.0–30.0%; Study 2: 12.2% were infected with B. canis, in Study 1 on Days 2, 7, 14, 21 and 28, and in Study 2 on Day 28. Ticks were removed and counted on Day 30 in Study 1, and Day 34 in Study 2. Blood was collected for Babesia detection via smear, PCR and immunofluorescence assay (IFA in Study 1 on Day 2, then approximately weekly through Day 56, and in Study 2 at weekly intervals between Days 28 to 49, and on Days 63 and 91. Additional samples were collected from dogs with body temperature > 39.4 °C (measured three times weekly, from Days 7 to 56 in Study 1 and from Days 35 to 56 in Study 2 and positive for B. canis on blood smear. Dogs with confirmed infections were rescue-treated, removed from the study and, in Study 1, replaced. Results Across both studies B. canis infection of ticks ranged between 8.0–30.0%. In Study 1, all control dogs were positive for B. canis on blood smear and PCR on Day 10 and IFA on Day 21; on Day 21 seven of eight replacement control dogs were B. canis-positive; no replacement dogs were B. canis-positive following tick removal on Day 30. In Study 2, all control dogs were B. canis-positive on Day 56. All lotilaner-treated dogs remained B. canis-negative at all assessments in both studies. Conclusion Lotilaner efficacy was 100% in preventing establishment of B. canis infection, despite post-treatment challenge with infected ticks on Days 2, 7

  14. Systems analysis of pathogenicity BvrR/BvrS, VjbR and VirB in Brucella canis and Brucella abortus 2308

    International Nuclear Information System (INIS)

    Soto Eduarte, Maria Fernanda

    2013-01-01

    An association between the expression of the system of two BvrR/BvrS components is established with respect to the expression of proteins VirB and VjbR. The expression patterns are compared between the species B. abortus 2308 and B. canis 206-10. Strains of B. abortus and B. canis were isolated at the Escuela de Medicina Veterinaria of the Universidad Nacional de Costa Rica from an aborted fetus. The expressions of BvrR and BvrS are determined in different points of the growth curve of B. abortus 2308 and B. canis 206-10. The expressions of VjbR and VirB are defined in different points of the growth curve of B. abortus 2308 and B. canis 206-10. The expression patterns of BvrR, BvrS, VjbR and VirB are compared in different points curve of B. abortus 2308 and B. canis 206-10. The experimental analysis has required a series of reagents, equipment and fundamental materials such as: laminar flow chamber, spectrophotometer, agitator with temperature-controlled, ELISA plate reader, stirrer template, culture media, disposable plastic material, chambers for electrophoresis and Western blot, etc. [es

  15. In vitro effect of Chrysosporium indicum and Chrysosporium keratinophylum on Toxocara canis eggs.

    Science.gov (United States)

    Bojanich, María V; Basualdo, Juan A; Giusiano, Gustavo

    2017-12-05

    The degree of antagonism exercised by fungi on geohelminth development varies according to the morphological alterations caused by different fungal species. Saprophytic fungi may exert ovicidal or ovistatic effects. The aim of this study was to apply scanning electron microscopy (SEM) to observe the action of two soil saprophytic species of Chrysosporium (C. indicum and C. keratinophylum) on Toxocara canis eggs. The fungal strains to be tested were incubated for 28 days at 28°C in 2% water agar with a suspension of unembryonated T. canis eggs. A suspension of T. canis eggs in 2% water agar was used as control group. The assay was done in triplicate for each fungus and the control group. SEM observations were performed on the 4th, 7th, 14th, 21st, and 28th day after inoculation. The effect of the fungi on eggs was evaluated in accordance with the alterations observed on the surface and the changes in the normal characteristics of the eggs. Hyphae around the eggs, appresoria penetrating the shell and changes in the typical egg membrane were observed in this assay. Type 3 effect (alterations that occur both in the embryo and the shell, and hyphal penetration of the eggs) was the prevalent effect. SEM allowed us to observe clearly the morphological alterations in T. canis eggs due to the effect of C. indicum and C. keratinophylum. Both saprophytic species of Chrysosporium alter the egg structure and alterations increase as exposure increases. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  16. Restricted evaluation of Trichodectes canis (Phthiraptera: Trichodectidae detection methods in Alaska gray wolves

    Directory of Open Access Journals (Sweden)

    Theresa M. Woldstad

    2014-12-01

    Full Text Available Trichodectes canis (Phthiraptera: Trichodectidae was first documented on Alaska (USA gray wolves (Canis lupus on the Kenai Peninsula in 1981. In subsequent years, numerous wolves exhibited visually apparent, moderate to severe infestations. Currently, the Alaska Department of Fish and Game utilizes visual inspection, histopathology, and potassium hydroxide (KOH hide digestion for T. canis detection. Our objective was to determine optimal sampling locations for T. canis detection. Wolf hides were subjected to lice enumeration using KOH hide digestion. Thirty nine of the 120 wolves examined had lice. Of these 39, total louse burdens ranged from 14 to an extrapolated 80,000. The hides of 12 infested animals were divided into 10 cm by 10 cm subsections and the lice enumerated on a subsection from each of four regions: neck; shoulder; groin; and rump. Combining the data from these 12 wolves, the highest mean proportions of the total louse burdens on individual wolves were found on the rump and differed significantly from the lowest mean proportion on the neck. However, examination of the four subsections failed to detect all infested wolves. Hides from 16 of the 39 infested animals were cut into left and right sides, and each side then cut into four, approximately equal sections: neck and shoulder; chest; abdomen; and rump. Half hides were totally digested from 11 wolves, and whole hides from 5. For these 21 half hides, the highest mean proportions of total louse burdens were found on the rump, and this section had the highest sensitivity for louse detection, regardless of burden. However, removal of this large section from a hide would likely be opposed by hunters and trappers.

  17. Effect of dopamine on bethanechol-stimulated gastric mucosal blood flow and gastric acid secretion in dogs with gastric fistula

    DEFF Research Database (Denmark)

    Hovendal, C P; Bech, K

    1982-01-01

    of gastric mucosal blood flow, whereas stimulation of beta, muscarinic, and 'gastrinergic' receptors mainly occurs indirectly via changes in parietal cell function. The main effect of dopamine seems to be on gastric motility, whereas the effect on gastric acid secretion is of minor importance.......The aim of the present study was to investigate the effect of Dopamine on bethanechol-stimulated gastric acid secretion and mucosal blood flow. dopamine was used alone and in conjunction with selective blockade of the alpha, beta, and dopaminergic receptors. An increasing and dose......-dependent stimulation of gastric acid secretion was found for dopamine at 1, 5, and 10 micrograms/kg/min. A significant inhibition of gastric acid secretion was found with the highest dose of dopamine (40 micrograms/kg/min). the stimulatory effect seems to be mediated by more than one receptor, whereas the inhibition...

  18. Autoimmunity and Gastric Cancer

    Science.gov (United States)

    Bizzaro, Nicola; Antico, Antonio; Villalta, Danilo

    2018-01-01

    Alterations in the immune response of patients with autoimmune diseases may predispose to malignancies, and a link between chronic autoimmune gastritis and gastric cancer has been reported in many studies. Intestinal metaplasia with dysplasia of the gastric corpus-fundus mucosa and hyperplasia of chromaffin cells, which are typical features of late-stage autoimmune gastritis, are considered precursor lesions. Autoimmune gastritis has been associated with the development of two types of gastric neoplasms: intestinal type and type I gastric carcinoid. Here, we review the association of autoimmune gastritis with gastric cancer and other autoimmune features present in gastric neoplasms. PMID:29373557

  19. Denning behaviour of non-gravid wolves, Canis lupus

    Science.gov (United States)

    Mech, L.D.; Phillips, M.K.; Smith, D.W.; Kreeger, T.J.

    1996-01-01

    Wild wolves (Canis lupus) that had produced pups in earlier years but were not currently pregnant, and ovariectomized captive wolves, dug dens during and after the whelping season even though they produced no pups. These observations suggest that den digging is not a function of pregnancy or of ovarian estrogen or progesterone. We hypothesize that increasing prolactin in spring elicits or mediates den-digging behavior.

  20. Ecologia Comportamental dos cães domésticos em áreas rurais e urbanas do município de Viçosa, MG

    OpenAIRE

    Martinez, Edilberto Nobrega

    2012-01-01

    Após a revolução industrial principalmente a partir do século XX, auge do êxodo rural, houve um incremento do processo de urbanização no Brasil. Nos dias atuais o progresso de atividades econômicas tem contribuído para a crescente aquisição de animais de estimação nos lares brasileiros, principalmente cães (Canis lupus familiaris). Para contemplar essa demanda, milhares de novos indivíduos nascem todos os anos sem um controle adequado. Este processo corrobora com o aumento de cães abandonados...

  1. Investigations into the prevention of prenatal and lactogenic Toxocara canis infections in puppies by application of moxidectin to the pregnant dog.

    Science.gov (United States)

    Krämer, F; Hammerstein, R; Stoye, M; Epe, C

    2006-06-01

    Aim of the investigation was to examine whether two administrations of moxidectin to pregnant dogs could prevent pre-natal and lactogenic infections of puppies with reactivated Toxocara canis larvae. Four pregnant beagles, infected experimentally with 20 000 embryonated eggs of T. canis, were treated subcutaneously with 1 mg moxidectin per kg body weight on days 40 and 55 of pregnancy (5-13 days before parturition). One further dam and its puppies served as untreated control. Two applications of moxidectin completely prevented pre-natal and lactogenic infections in the puppies. Neither intestinal stages nor somatic larvae were found in the dams or their corresponding puppies. All puppies and dams of the treatment group remained coproscopically negative until 42 days after parturition. The administration of moxidectin did not show any side effects in the dams. None of the puppies of the treated dams showed any pathological abnormalities. In the untreated dam one adult and 26 somatic larvae of T. canis were detected at necropsy. All puppies of the untreated dam showed a patent T. canis infection from day 28 post-natum (p.n.); 296 pre-adult and adult stages of T. canis were spontaneously eliminated and 51 intestinal stages and five somatic larvae of T. canis were recovered at necropsy. In contrast to the puppies of the treated dams all negative control puppies showed blood eosinophilia after parturition and elevated liver enzyme levels.

  2. Primary Closure versus Gastric Resection for Perforated Gastric

    African Journals Online (AJOL)

    Perforated gastric ulcer is one of the most life‑threatening complications of peptic ulcer disease with high .... tubes were removed and oral nutrition resumed. The .... surgical approach for perforated gastric cancer: One‑stage vs. two‑stage ...

  3. Successful Emergency Endoscopic Treatment of Gastric Outlet Obstruction due to Gastric Bezoar with Gastric Pneumatosis

    Directory of Open Access Journals (Sweden)

    Hirokazu Honda

    2017-11-01

    Full Text Available Gastric bezoars are rare and are usually found incidentally. They can sometimes cause severe complications, including gastric outlet obstruction (GOO or gastric pneumatosis (GP. In cases of bezoars with GP, the optimal treatment strategy has not yet been defined. We report the case of an 89-year-old man with a history of type 2 diabetes mellitus and hypertension who presented to our emergency room with a 2-day history of upper abdominal pain, nausea, and vomiting. Physical examination revealed no rebound tenderness or guarding, and laboratory values revealed no elevation of the serum lactate level. A computed tomography scan of the abdomen showed a dilated stomach with significant fluid collection, GOO, and GP due to a 42 × 40 mm mass composed of fat and air densities. Emergency esophagogastroduodenoscopy revealed two gastric bezoars, one of which was incarcerated in the pyloric region. We used various endoscopic devices to successfully break and remove the bezoars. We used endoscopic forceps and a water jet followed by an endoscopic snare to cut the bezoars into several pieces and remove them with an endoscopic net. Follow-up endoscopy confirmed that the gastric bezoar had been completely removed. As seen in this case, endoscopic treatment may be a safe and viable option for the extraction of gastric bezoars presenting with GOO and GP.

  4. Successful Emergency Endoscopic Treatment of Gastric Outlet Obstruction due to Gastric Bezoar with Gastric Pneumatosis.

    Science.gov (United States)

    Honda, Hirokazu; Ikeya, Takashi; Kashiwagi, Erika; Okada, Shuichi; Fukuda, Katsuyuki

    2017-01-01

    Gastric bezoars are rare and are usually found incidentally. They can sometimes cause severe complications, including gastric outlet obstruction (GOO) or gastric pneumatosis (GP). In cases of bezoars with GP, the optimal treatment strategy has not yet been defined. We report the case of an 89-year-old man with a history of type 2 diabetes mellitus and hypertension who presented to our emergency room with a 2-day history of upper abdominal pain, nausea, and vomiting. Physical examination revealed no rebound tenderness or guarding, and laboratory values revealed no elevation of the serum lactate level. A computed tomography scan of the abdomen showed a dilated stomach with significant fluid collection, GOO, and GP due to a 42 × 40 mm mass composed of fat and air densities. Emergency esophagogastroduodenoscopy revealed two gastric bezoars, one of which was incarcerated in the pyloric region. We used various endoscopic devices to successfully break and remove the bezoars. We used endoscopic forceps and a water jet followed by an endoscopic snare to cut the bezoars into several pieces and remove them with an endoscopic net. Follow-up endoscopy confirmed that the gastric bezoar had been completely removed. As seen in this case, endoscopic treatment may be a safe and viable option for the extraction of gastric bezoars presenting with GOO and GP.

  5. Pesquisa de aglutininas anti Brucella canis em soros humanos na cidade de São Paulo, Brasil Research on agglutinins for Brucella canis in human sera in the city of S. Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Helena Matiko Akao Larsson

    1980-09-01

    Full Text Available De 330 soros humanos examinados pela prova de soroaglutinação lenta em tubos, 4(1,21% apresentaram aglutininas anti Brucella canis em diluição 1:100 (1 reagente com título 100, 2 reagentes com título 200 e 1 reagente com título 400.Of the 330 human sera tested by tube agglutination test, 4 (1.21% were positive for Brucella canis antibodies with tilers 1:100 or higher (1 reagent with titer of 1:100, 2 reagents with titer of 1:200, and 1 reagent with tiler of 1:400.

  6. Production of Toxocara cati TES-120 Recombinant Antigen and Comparison with its T. canis Homolog for Serodiagnosis of Toxocariasis

    Science.gov (United States)

    Zahabiun, Farzaneh; Sadjjadi, Seyed Mahmoud; Yunus, Muhammad Hafiznur; Rahumatullah, Anizah; Moghaddam, Mohammad Hosein Falaki; Saidin, Syazwan; Noordin, Rahmah

    2015-01-01

    Toxocariasis is a cosmopolitan zoonotic disease caused by the infective larvae of Toxocara canis and T. cati. Diagnosis in humans is usually based on clinical symptoms and serology. Immunoglobulin G (IgG)-enzyme-linked immunosorbent assay kits using T. canis excretory–secretory (TES) larval antigens are commonly used for serodiagnosis. Differences in the antigens of the two Toxocara species may influence the diagnostic sensitivity of the test. In this study, T. cati recombinant TES-120 (rTES-120) was cloned, expressed, and compared with its T. canis homolog in an IgG4-western blot. The diagnostic sensitivity and specificity of T. cati rTES-120 were 70% (33/47) and 100% (39/39), respectively. T. canis rTES-120 showed 57.4% sensitivity and 94.4% specificity. When the results of assays using rTES-120 of both species were considered, the diagnostic sensitivity was 76%. This study shows that using antigens from both Toxocara species may improve the serodiagnosis of toxocariasis. PMID:26033026

  7. Radiological findings of gastric adenomyoma in a neonate presenting with gastric outlet obstruction.

    Science.gov (United States)

    Rhim, Jung Hyo; Kim, Woo Sun; Choi, Young Hun; Cheon, Jung-Eun; Park, Sung Hye

    2013-03-01

    Gastric adenomyoma is a rare tumour-like lesion composed of glandular components and smooth muscle bundles. We report a case of gastric adenomyoma in a 1-week-old neonate who presented with gastric outlet obstruction. To the best of our knowledge, this is the youngest child reported with gastric adenomyoma and a unique case demonstrating radiological findings of gastric adenomyoma in a young infant. At US, the lesion was seen as an asymmetrical mass-like wall-thickening of the pylorus. Upper gastrointestinal series showed findings similar to those seen in a case of hypertrophic pyloric stenosis. We suggest that gastric adenomyoma should be included in the causes of gastric outlet obstruction in neonates even though it is rare in young children.

  8. Dogs (Canis familiaris, but not chimpanzees (Pan troglodytes, understand imperative pointing.

    Directory of Open Access Journals (Sweden)

    Katharina C Kirchhofer

    Full Text Available Chimpanzees routinely follow the gaze of humans to outside targets. However, in most studies using object choice they fail to use communicative gestures (e.g. pointing to find hidden food. Chimpanzees' failure to do this may be due to several difficulties with this paradigm. They may, for example, misinterpret the gesture as referring to the opaque cup instead of the hidden food. Or perhaps they do not understand informative communicative intentions. In contrast, dogs seem to be skilful in using human communicative cues in the context of finding food, but as of yet there is not much data showing whether they also use pointing in the context of finding non-food objects. Here we directly compare chimpanzees' (N = 20 and dogs' (N = 32 skills in using a communicative gesture directed at a visible object out of reach of the human but within reach of the subject. Pairs of objects were placed in view of and behind the subjects. The task was to retrieve the object the experimenter wanted. To indicate which one she desired, the experimenter pointed imperatively to it and directly rewarded the subject for handing over the correct one. While dogs performed well on this task, chimpanzees failed to identify the referent. Implications for great apes' and dogs' understanding of human communicative intentions are discussed.

  9. Gastric wall shortening in early gastric cancer: upper gastrointestinal series and pathologic correlation

    International Nuclear Information System (INIS)

    Kim, In Jae; Choi, Chul Soon; Kim, Eun Ah; Kim, Kyu Sun; Yun, Ku Sub; Kim, Ho Chul; Bae, Sang Hun; Kang, Gu; Shin, Hyung Sik

    1995-01-01

    To investigate the causes of gastric wall shortening in early gastric cancer, upper gastrointestinal study was correlated with pathologic findings. We evaluated 41 cases (M:F = 1.7:1, average age = 49) of early gastric cancer, retrospectively. The gastric wall shortening were classified as Grade I; none, Grade II; intermediate, and Grade III; prominent. Pathologic findings such as size of lesions, depth of tumor invasion, degree of the submucosal fibrosis, degree of thickness of the submucosa and muscularis propria, and morphologic patterns of lesions including conversing mucosal folds were correlated with the degree of gastric wall shortening on upper gastrointestinal series. Submucosal fibrosis was present in 4 cases in Grade I (n = 21), 4 cases in Grade II (n = 6) and 8 cases in Grade III (n = 10). Positive conversing mucosal folds were seen in 5 cases in Grade I (n = 17), 0 case in Grade II (n = 2) and 9 cases in Grade III (n = 9). Gastric wall shortening was significantly associated with submucosal fibrosis and conversing mucosal folds of early gastric cancer. (ρ = 0.0001, and ρ = 0.02, respectively) Upper gastrointestinal finding of gastric wall protrusion in patients with early gastric cancer should not misinterprete as advanced gastric cancer since the finding could be a result of submucosal fibrosis

  10. sero-epidemiology of toxocara canis infection in chil- dren attending ...

    African Journals Online (AJOL)

    2015-06-01

    Jun 1, 2015 ... dogs.2. The prevalence of toxocariasis is generally higher in tropical and developing countries than in developed countries and has been associated with .... canis sero-positivity and characteris- tics of children attending four selected hospitals in the. Central Region, Ghana. Variable Group. (Characteristic).

  11. Failure of imidocarb dipropionate to eliminate Hepatozoon canis in naturally infected dogs based on parasitological and molecular evaluation methods.

    Science.gov (United States)

    Sasanelli, Mariateresa; Paradies, Paola; Greco, Beatrice; Eyal, Osnat; Zaza, Valeria; Baneth, Gad

    2010-08-04

    The efficacy of imidocarb dipropionate for the treatment of Hepatozoon canis infection was studied in three naturally infected asymptomatic dogs followed longitudinally over 8 months. Response to treatment was followed by monitoring blood counts, parasitemia levels in blood, parasite in concentrated buffy-coat smears and by PCR. The dogs were initially treated with a low dose of 3 mg/kg imidocarb dipropionate twice a month and when parasitemia persisted after five treatments, with the regular dose of 6 mg/kg. In one dog, H. canis gamonts were no longer detectable by blood and buffy-coat microscopy after 2 months of therapy with 6 mg/kg while in the two other dogs gamonts were intermittently found in blood but persistently detectable in buffy-coat smears during the whole study period. Furthermore, combined therapy with doxycycline monohydrate administered at 10 mg/kg/day PO for 4 weeks also failed to eliminate H. canis. PCR revealed that parasite DNA was present in the blood of all dogs at all sampling dates regardless of treatment refuting the effectiveness of treatment suggested by negative blood microscopy. Detection of H. canis in buffy coat was found to be twice as sensitive than by blood smear and detection by PCR was even more sensitive revealing infection in eight samples (16% of total samples) negative by blood and buffy-coat microscopy. In conclusion, imidocarb dipropionate was not effective in eliminating H. canis from dogs treated repeatedly over 8 months. Microscopical detection is not sufficient for the evaluation of treatment response in H. canis infection and follow up by molecular techniques is recommended. Copyright 2010 Elsevier B.V. All rights reserved.

  12. Seroprevalence of Ehrlichia canis, Ehrlichia chaffeensis and Ehrlichia ewingii in dogs in North America

    Directory of Open Access Journals (Sweden)

    Beall Melissa J

    2012-02-01

    Full Text Available Abstract Background This study evaluated the exposure of dogs to three different Ehrlichia spp. in the south and central regions of the United States where vector-borne disease prevalence has been previously difficult to ascertain, particularly beyond the metropolitan areas. Methods Dog blood samples (n = 8,662 were submitted from 14 veterinary colleges, 6 private veterinary practices and 4 diagnostic laboratories across this region. Samples were tested for E. canis, E. chaffeensis and E. ewingii specific antibodies using peptide microtiter ELISAs. Results Overall, E. canis, E. chaffeensis and E. ewingii seroprevalence was 0.8%, 2.8%, and 5.1%, respectively. The highest E. canis seroprevalence (2.3% was found in a region encompassing Arkansas, Louisiana, Oklahoma, Tennessee and Texas. E. chaffeensis seroreactivity was 6.6% in the central region (Arkansas, Kansas, Missouri, and Oklahoma and 4.6% in the southeast region (Georgia, Maryland, North Carolina, South Carolina, Tennessee and Virginia. Seroreactivity to E. ewingii was also highest in the central region (14.6% followed by the southeast region (5.9%. The geospatial pattern derived from E. chaffeensis and E. ewingii seropositive samples was similar to previous reports based on E. chaffeensis seroreactivity in white-tailed deer and the distribution of human monocytic ehrlichiosis (HME cases reported by the CDC. Conclusions The results of this study provide the first large scale regional documentation of exposure to E. canis, E. chaffeensis and E. ewingii in pet dogs, highlighting regional differences in seroprevalence and providing the basis for heightened awareness of these emerging vector-borne pathogens by veterinarians and public health agencies.

  13. Demodicosis caused by Demodex canis and Demodex cornei in dogs.

    Science.gov (United States)

    Sivajothi, S; Sudhakara Reddy, B; Rayulu, V C

    2015-12-01

    Two mongrel dogs aged between 7 and 9 months in a same house were presented to the clinics with a history of chronic dermatitis associated with pruritus. Clinical examination revealed presence of primary and secondary skin lesions on the face, around the ears, chin, neck, fore limbs and lateral abdomen. Examination of skin scrapings revealed Demodex cornei (majority) and D. canis (minority) in both the dogs. By using hair pluck examination D. canis were detected and by tape impression smears examination large number of adult short-tail Demodex mites were found. D. cornei was identified by based on the morphological characters including short opisthosoma with blind and round terminal end. Mean length of total body, opisthosoma of both types of the mites were differed statistically significant (P  0.05). Dogs were treated with daily oral ivermectin @ 500 μg/kg/day, external application of amitraz along with supportive therapy. After completion of 45 days of therapy dogs were recovered completely without any side effects.

  14. Itopride for gastric volume, gastric emptying and drinking capacity in functional dyspepsia.

    Science.gov (United States)

    Abid, Shahab; Jafri, Wasim; Zaman, Maseeh Uz; Bilal, Rakhshanda; Awan, Safia; Abbas, Aamir

    2017-02-06

    To study the effect of itopride on gastric accommodation, gastric emptying and drinking capacity in functional dyspepsia (FD). Randomized controlled trial was conducted to check the effect of itopride on gastric accommodation, gastric emptying, capacity of tolerating nutrient liquid and symptoms of FD. We recruited a total of 31 patients having FD on the basis of ROME III criteria. After randomization, itopride was received by 15 patients while 16 patients received placebo. Gastric accommodation was determined using Gastric Scintigraphy. 13 C labeled octanoic breadth test was performed to assess gastric emptying. Capacity of tolerating nutrient liquid drink was checked using satiety drinking capacity test. The intervention group comprised of 150 mg itopride. Patients in both arms were followed for 4 wk. Mean age of the recruited participant 33 years (SD = 7.6) and most of the recruited individuals, i.e ., 21 (67.7%) were males. We found that there was no effect of itopride on gastric accommodation as measured at different in volumes in the itopride and control group with the empty stomach ( P = 0.14), at 20 min ( P = 0.38), 30 min ( P = 0.30), 40 min ( P = 0.43), 50 min ( P = 0.50), 60 min ( P = 0.81), 90 min ( P = 0.25) and 120 min ( P = 0.67). Gastric emptying done on a sub sample ( n = 11) showed no significant difference ( P = 0.58) between itopride and placebo group. There was no significant improvement in the capacity to tolerate liquid in the itopride group as compared to placebo ( P = 0.51). Similarly there was no significant improvement of symptoms as assessed through a composite symptom score ( P = 0.74). The change in QT interval in itopride group was not significantly different from placebo (0.10). Our study found no effect of itopride on gastric accommodation, gastric emptying and maximum tolerated volume in patients with FD.

  15. The role of gastric scintigraphy in primary or post surgical disorders of gastric emptying

    International Nuclear Information System (INIS)

    Jian, R.; Lemann, M.; Rain, J.D.

    1996-01-01

    Gastric scintigraphy is the gold standard for the measurement of the gastric emptying of a meal because of its reliability and its reproducibility and the respect of physiological conditions. Moreover, this technique allows to measure the emptying of solid and liquid phases simultaneously. Symptoms motivating a gastric scintigraphy, suggest either a gastric stasis (dyspepsia) or a gastric incontinence (dumping syndrome). The two most frequent clinical conditions triggering this test are motility disorders following vagotomy, a delayed emptying of solids is often associated to an accelerated emptying of liquids. Gastric scintigraphy proves quite useful in these conditions, since the diagnosis of such complex abnormalities is uneasy to establish exclusively on a clinical basis. In idiopathic dyspepsia, gastric stasis is proved only in 50 % of the patients. However, a radionuclide study of gastric emptying is seldom ordered because of the common character and good tolerance of these symptoms. In everyday practice, gastric scintigraphy is considered only when gastric or intestinal obstructive lesions have been ruled out. A suggestive clinical picture and/or absence of a deteriorated general condition allow to prescribe a symptomatic treatment. More rarely, equivocal symptoms, degradation of the general condition and unresponsiveness to symptomatic drugs call for gastric scintigraphy. (authors). 241 refs., 2 figs

  16. Gastric-emptying tests

    International Nuclear Information System (INIS)

    Brown, M.L.; Malagelada, J.R.

    1983-01-01

    Mechanisms regulating gastric emptying have been characterized through many decades of experimental work. Both central and peripheral mechanisms are important. Central mechanisms are related to the center of vomiting and are probably influenced by psychologic and emotional factors. Peripheral mechanisms are located at both sides of the pylorus. Gastric mechanisms are stimulatory and are triggered mainly by distention of the stomach, although hormonal mechanisms may also participate (gastrin). However, with complex, nutrient-containing meals, the intragastric volume is not the primary determinant of gastric emptying. Inhibitory mechanisms of the gut are more important. The key factors are the pH, osmolality, and nutrient content of the chyme being emptied into the duodenum. Osmotic and pH-sensitive receptors are thought to reside in the duodenum. On the other hand, receptors triggered by nutrients extend much more distally into the duodenum and are sensitive to nutrient composition and load. Protein, carbohydrates, and lipids all inhibit gastric emptying, although the lipids are probably the most potent inhibitors. If the duodenal load or the characteristics of the emptying material are not adequate, inhibitory mechanisms will reduce gastric emptying at the expense of expanding the intragastric volume. It is therefore not possible to dissociate postprandial gastric emptying from postprandial gastric secretion

  17. Rangelia vitalii and Hepatozoon canis coinfection in pampas fox Lycalopex gymnocercus from Santa Catarina State, Brazil

    Directory of Open Access Journals (Sweden)

    Maria Regina Lucas da Silva

    2018-05-01

    Full Text Available Abstract Rangelia vitalii is a haemoparasite that infects erythrocytes, white blood cells and the cytoplasm of endothelial cells of blood capillaries of canids in South America, and has been detected in both domestic dogs and sylvatic canids. Hepatozoon canis is a parasite that infects neutrophils and monocytes of many mammalian hosts. This study reports the infection of Lycalopex gymnocercus from Santa Catarina, Brazil, with R. vitalii and H. canis. The piroplasm was observed on both blood smears and molecular tests. Many large piroplasms were detected inside the erythrocytes, with round, oval, or teardrop-shaped organism, that occurred singly or in pairs. They had an abundant, pale blue cytoplasm and decentral dark red small nucleus. The animal was also infected with H. canis that was detected only by molecular tests. The majority of haematological and biochemistry parameters were within the reference values for domestic dog and wild canids.

  18. Rangelia vitalii and Hepatozoon canis coinfection in pampas fox Lycalopex gymnocercus from Santa Catarina State, Brazil.

    Science.gov (United States)

    Silva, Maria Regina Lucas da; Mattoso, Cláudio Roberto Scabelo; Costa, Adson; Saito, Mere Erika; Tchaicka, Lygia; O'Dwyer, Lucia Helena

    2018-05-24

    Rangelia vitalii is a haemoparasite that infects erythrocytes, white blood cells and the cytoplasm of endothelial cells of blood capillaries of canids in South America, and has been detected in both domestic dogs and sylvatic canids. Hepatozoon canis is a parasite that infects neutrophils and monocytes of many mammalian hosts. This study reports the infection of Lycalopex gymnocercus from Santa Catarina, Brazil, with R. vitalii and H. canis. The piroplasm was observed on both blood smears and molecular tests. Many large piroplasms were detected inside the erythrocytes, with round, oval, or teardrop-shaped organism, that occurred singly or in pairs. They had an abundant, pale blue cytoplasm and decentral dark red small nucleus. The animal was also infected with H. canis that was detected only by molecular tests. The majority of haematological and biochemistry parameters were within the reference values for domestic dog and wild canids.

  19. Infection of dogs with Babesia canis in Gwagwalada metropolis of ...

    African Journals Online (AJOL)

    Epidemiological investigation was carried out to determine the prevalence of infection with Babesia canis in dogs in Gwagwalada metropolis of the Federal Capital Territory, Abuja Nigeria, from November 2013 to January 2014. Blood samples were collected from 101 dogs and examined for the parasite. Data obtained were ...

  20. A molecular and parasitological survey of Hepatozoon canis in domestic dogs in Turkey.

    Science.gov (United States)

    Aktas, Munir; Özübek, Sezayi; Altay, Kürşat; Balkaya, İbrahim; Utuk, Armagan Erdem; Kırbas, Akın; Şimsek, Sami; Dumanlı, Nazir

    2015-04-30

    In this study, asymptomatic dogs in nine provinces of Turkey were surveyed to investigate the prevalence and intensity of Hepatozoon canis infection. DNA obtained from blood samples collected from 694 domestic dogs (243 stray, 288 shelter, and 163 pets) of both genders and varying ages were evaluated by polymerase chain reaction (PCR). In addition, 285 thin blood smears prepared from these blood samples were also evaluated for microscopic examination. Direct microscopy revealed Hepatozoon gamonts in the peripheral blood of three of 285 (1.0%; 95% confidence interval (CI): 0.21-3.04) tested. Using PCR, 155 of the 694 (22.3%; 95% CI: 19.28-25.61) were found to be positive for the presence of H. canis DNA. The prevalence of infection was higher in adult dogs (26.2%; 95% CI: 22.1-30.7) than young animals (16.4%; 95% CI: 12.2-21.3). Although the prevalence determined by PCR was higher in male dogs (24.5%; 95% CI: 19.6-29.9) than in female dogs (20.8%; 95% CI: 16.9-25.1), gender differences were not significant. Pet dogs had a lower prevalence of infection (10.4%; 95% CI: 6.2-16.2) compared to stray (26.3%; 95% CI: 20.9-32.3) and shelter dogs (25.7%; 95% CI: 20.7-31.1), but no significant association between stray and shelter dogs was found for the presence of the parasite. Partial sequences of the 18S ribosomal RNA (rRNA) gene shared 99-100% similarity with the corresponding H. canis isolates. This epidemiological survey revealed a high prevalence of H. canis in dogs from several provinces in Turkey, and it suggests that the age and origin are associated with the parasite. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Lactobacillus rhamnosus reduces parasite load on Toxocara canis experimental infection in mice, but has no effect on the parasite in vitro.

    Science.gov (United States)

    Walcher, Débora Liliane; Cruz, Luis Augusto Xavier; de Lima Telmo, Paula; Martins, Lourdes Helena Rodrigues; da Costa de Avila, Luciana Farias; Berne, Maria Elisabeth Aires; Scaini, Carlos James

    2018-02-01

    Human toxocariasis is a neglected global parasitic zoonosis. The efficacy of drug treatment for this disease has been hindered by the biological complexity of the main etiological agent, the nematode Toxocara canis. Experimental studies have shown the potential of probiotics to promote a reduction in the parasite load of T. canis larvae. This study aimed to evaluate the effect of probiotic Lactobacillus rhamnosus ATCC 7469 on the parasite load of BALB/c mice with acute toxocariasis and evaluate the direct effect of this probiotic on T. canis larvae in vitro. In vivo administration of probiotics reduced the parasite load of T. canis larvae by 53.3% (p = 0.0018) during the early stage of infection in mice. However, when analyzed in vitro, it was observed that the probiotic did not present a deleterious effect on the larvae, as approximately 90% of these remained viable. These results demonstrate the potential of the probiotic L. rhamnosus in the reduction of T. canis larvae in BALB/c mice and suggest it could be used as an alternative means for the controlling of visceral toxocariasis. However, further studies are required to elucidate the mechanisms of action promoted by this probiotic.

  2. Identification of toxocara canis antigens by Western blot in experimentally infected rabbits

    Directory of Open Access Journals (Sweden)

    MORALES Olga Lucía

    2002-01-01

    Full Text Available Toxocariasis is a frequent helminthiasis that can cause visceral and ocular damage in humans specially in children. The identification of specific antigens of Toxocara canis is important in order to develop better diagnostic techniques. Ten rabbits were infected orally with a dose of 5000 Toxocara canis embryonated eggs. Rabbits were bled periodically and an ELISA assay was performed to determine levels of specific Toxocara IgG antibodies. ELISA detected antibodies at day 15 after infection. Western blot (WB assay was performed using excretory/secretory antigens (E/S of T. canis second stage larvae. Different antigen concentrations were evaluated: 150, 200, 250 and 300 µg/mL. The concentration of 250 µg/mL was retained for analysis. Rabbit sera were diluted 1:100. Secondary antibody was used at a dilution of 1:1000. Results of WB indicated that in the first month after infection specific antibodies against the 200 KDa, 116 KDa, 92 KDa and 35 KDa antigens were detected; antibodies against the 92 KDa, 80 KDa, 66 KDa, 45 KDa, 31 KDa and 28 KDa antigens appeared later. All positive sera in the ELISA test were also positive in WB. Two antigen bands, 92 KDa and 35 KDa, were identified since the beginning and throughout the course of infection. These antigens merit further evaluation as candidates for use in diagnosis.

  3. Gastric emptying in morbid obesity

    International Nuclear Information System (INIS)

    Venzina, W.; Chamberlain, M.; Carruthers, S.G.; Grace, D.M.; King, M.; Mowbray, R.D.; Bondy, D.C.

    1984-01-01

    Weight loss following gastroplasty had no correlation with gastric emptying rate. Patients who showed transient prolongation of gastric emptying returned to normal one year later and showed no significant difference in weight loss from those who did not have temporary delayed gastric emptying. Perhaps gatroplasty (at least temporarily) reduces the gastric volume producing early satiation without affecting the gastric emptying rate as tested by a small volume radiolabelled test meal. Longer follow-up is indicated to see if delayed weight gain occurs because of gastric pouch stretching and if this has any correlation with gastric emptying rate. (Author)

  4. Mesentero-axial gastric volvulus after removal of laparoscopic adjustable gastric band.

    Science.gov (United States)

    Pirmadjid, N; Pournaras, D J; Huan, S; Sujendran, V

    2017-02-01

    Despite the decreasing popularity of gastric banding, a large number of patients still have a band in situ. Although immediate postoperative complications are relatively rare, long-term complications of gastric banding are more common but are not reported to occur after band removal. We report a case of gastric volvulus and subsequent ischaemic perforation in a patient shortly after band removal, resulting in emergency laparotomy and total gastrectomy. Severe continuing pain persisting after band deflation and even gastric band removal should be treated as an emergency and urgent investigation should not be delayed.

  5. Differential serodiagnostics of Toxocara canis and Toxocara cati - is it possible?

    DEFF Research Database (Denmark)

    Poulsen, C. S.; Skov, Søren; Yoshida, A.

    2015-01-01

    and uncertainties regarding the validity of existing serological assays. In this study, we used sera from a pig model experimentally infected with T. canis and T. cati to evaluate whether a Western blot could discriminate between the two species. No proteins were observed that could be used as a diagnostic tool......One of the most common zoonotic helminth infections is caused by species in the genus Toxocara, particularly Toxocara canis and T. cati (Syn. T. mystax). However, their relative contribution to toxocarosis in humans remains largely unknown because causative larvae are seldom recovered...

  6. Itopride for gastric volume, gastric emptying and drinking capacity in functional dyspepsia

    OpenAIRE

    Abid, Shahab; Jafri, Wasim; Zaman, Maseeh Uz; Bilal, Rakhshanda; Awan, Safia; Abbas, Aamir

    2017-01-01

    AIM To study the effect of itopride on gastric accommodation, gastric emptying and drinking capacity in functional dyspepsia (FD). METHODS Randomized controlled trial was conducted to check the effect of itopride on gastric accommodation, gastric emptying, capacity of tolerating nutrient liquid and symptoms of FD. We recruited a total of 31 patients having FD on the basis of ROME III criteria. After randomization, itopride was received by 15 patients while 16 patients received placebo. Gastri...

  7. History of Helicobacter pylori, duodenal ulcer, gastric ulcer and gastric cancer.

    Science.gov (United States)

    Graham, David Y

    2014-05-14

    Helicobacter pylori (H. pylori) infection underlies gastric ulcer disease, gastric cancer and duodenal ulcer disease. The disease expression reflects the pattern and extent of gastritis/gastric atrophy (i.e., duodenal ulcer with non-atrophic and gastric ulcer and gastric cancer with atrophic gastritis). Gastric and duodenal ulcers and gastric cancer have been known for thousands of years. Ulcers are generally non-fatal and until the 20th century were difficult to diagnose. However, the presence and pattern of gastritis in past civilizations can be deduced based on the diseases present. It has been suggested that gastric ulcer and duodenal ulcer both arose or became more frequent in Europe in the 19th century. Here, we show that gastric cancer and gastric ulcer were present throughout the 17th to 19th centuries consistent with atrophic gastritis being the predominant pattern, as it proved to be when it could be examined directly in the late 19th century. The environment before the 20th century favored acquisition of H. pylori infection and atrophic gastritis (e.g., poor sanitation and standards of living, seasonal diets poor in fresh fruits and vegetables, especially in winter, vitamin deficiencies, and frequent febrile infections in childhood). The latter part of the 19th century saw improvements in standards of living, sanitation, and diets with a corresponding decrease in rate of development of atrophic gastritis allowing duodenal ulcers to become more prominent. In the early 20th century physician's believed they could diagnose ulcers clinically and that the diagnosis required hospitalization for "surgical disease" or for "Sippy" diets. We show that while H. pylori remained common and virulent in Europe and the United States, environmental changes resulted in changes of the pattern of gastritis producing a change in the manifestations of H. pylori infections and subsequently to a rapid decline in transmission and a rapid decline in all H. pylori-related diseases.

  8. AVALIAÇÃO DE INICIADORES E PROTOCOLO PARA O DIAGNÓSTICO DA PANCITOPENIA TROPICAL CANINA POR PCR

    Directory of Open Access Journals (Sweden)

    Daniel C. L. Linhares

    2006-10-01

    Full Text Available Este trabalho foi desenvolvido com o objetivo de padronizar um protocolo para a reação em cadeia da polimerase (PCR e selecionar oligonucleotídeos iniciadores para a detecção específica de Ehrlichia canis, em uma única etapa de reação. Inicialmente foram obtidas seqüências depositadas no Genbank, referentes ao gene que codifica o 16S rRNA das espécies E. canis (número de acesso = AF162860, E. ewingii (U96436, E. platys (AF1567844, E. chaffeensis, (U86665, E. phagocytophila genogrupo (U02521, E. bovis (AF294789 e E. risticii (M21290, as quais foram submetidas ao alinhamento genético para a construção dos iniciadores. Do alinhamento foi selecionado, a partir de uma região semiconservada, um iniciador específico para E. canis, designado EBR1 (5’-cctctggctataggaaattg- 3’ e, de uma região conservada, um iniciador genérico EBR5 (5’-ggagtgcttaacgcgttag- 3’. Paralelamente foram obtidas amostras de sangue de dez cães que apresentavam infecção aguda por E. canis, confirmado pela presença de mórulas intracitoplasmáticas, características da riquétsia, em células mononucleares sangüíneas. O DNA genômico extraído dessas amostras foi utilizado para a avaliação da reação de PCR, empregando-se um protocolo adaptado de outros autores e o par de oligos EBR1/EBR5, selecionado neste trabalho. A reação de PCR apresentou resultados positivos para os 10 isolados de E. canis, amplificando o fragmento esperado de 765 pares de bases do gene 16S rRNA. Resultados negativos verificados nas reações de PCR para amostras de DNA genômico de Babesia canis, Hepatozoon canis, Haemobartonella sp., Trypanosoma evansi e do hospedeiro (Canis familiaris livre de infecção indicaram a segurança do método quanto à especificidade para a discriminação de E. canis. PALAVRAS-CHAVE: Cães, Ehrlichia canis, erliquiose canina, hemoparasitose, reação em cadeia da polimerase

  9. A method for establishing human primary gastric epithelial cell culture from fresh surgical gastric tissues.

    Science.gov (United States)

    Aziz, Faisal; Yang, Xuesong; Wen, Qingping; Yan, Qiu

    2015-08-01

    At present, biopsy specimens, cancer cell lines and tissues obtained by gastric surgery are used in the study and analysis of gastric cancer, including the molecular mechanisms and proteomics. However, fibroblasts and other tissue components may interfere with these techniques. Therefore, the present study aimed to develop a procedure for the isolation of viable human gastric epithelial cells from gastric surgical tissues. A method was developed to culture human gastric epithelial cells using fresh, surgically excised tissues and was evaluated using immunocytochemistry, periodic acid-Schiff (PAS) staining and cell viability assays. Low cell growth was observed surrounding the gastric tissue on the seventh day of tissue explant culture. Cell growth subsequently increased, and at 12 days post-explant a high number of pure epithelial cells were detected. The gastric cancer cells exhibited rapid growth with a doubling time of 13-52 h, as compared to normal cells, which had a doubling time of 20-53 h. Immunocytochemical analyses of primary gastric cells revealed positive staining for cytokeratin 18 and 19, which indicated that the culture was comprised of pure epithelial cells and contained no fibroblasts. Furthermore, PAS staining demonstrated that the cultured gastric cells produced neutral mucin. Granulin and carbohydrate antigen 724 staining confirmed the purity of gastric cancer and normal cells in culture. This method of cell culture indicated that the gastric cells in primary culture consisted of mucin-secreting gastric epithelial cells, which may be useful for the study of gastric infection with Helicobacter pylori and gastric cancer.

  10. Infection of dogs with Babesia canis in Gwagwalada metropolis of ...

    African Journals Online (AJOL)

    ADEYEYE

    2014-10-30

    Oct 30, 2014 ... determine the prevalence of Babesia canis and the correlation of infection with age, sex, breed, types of management and presence .... Table 3: Breed distribution of Babesia infection in dogs in Gwagwalada Area Council, FCT. Breed ... the management style of the dogs and infection with. Babesia. Table 5 ...

  11. Familial Gastric Cancers.

    Science.gov (United States)

    Setia, Namrata; Clark, Jeffrey W; Duda, Dan G; Hong, Theodore S; Kwak, Eunice L; Mullen, John T; Lauwers, Gregory Y

    2015-12-01

    Although the majority of gastric carcinomas are sporadic, approximately 10% show familial aggregation, and a hereditary cause is determined in 1%-3% cases. Of these, hereditary diffuse gastric cancer is the most recognized predisposition syndrome. Although rare, the less commonly known syndromes also confer a markedly increased risk for development of gastric cancer. Identification and characterization of these syndromes require a multidisciplinary effort involving oncologists, surgeons, genetic counselors, biologists, and pathologists. This article reviews the molecular genetics, clinical and pathologic features, surveillance guidelines, and preventive measures of common and less common hereditary gastric cancer predisposition syndromes. ©AlphaMed Press.

  12. Assessment of two methods of gastric decompression for the initial management of gastric dilatation-volvulus.

    Science.gov (United States)

    Goodrich, Z J; Powell, L L; Hulting, K J

    2013-02-01

    To assess gastric trocarization and orogastric tubing as a means of gastric decompression for the initial management of gastric dilatation-volvulus. Retrospective review of 116 gastric dilatation-volvulus cases from June 2001 to October 2009. Decompression was performed via orogastric tubing in 31 dogs, gastric trocarization in 39 dogs and a combination of both in 46 dogs. Tubing was successful in 59 (75·5%) dogs and unsuccessful in 18 (23·4%) dogs. Trocarization was successful in 73 (86%) dogs and unsuccessful in 12 (14%) dogs. No evidence of gastric perforation was noted at surgery in dogs undergoing either technique. One dog that underwent trocarization had a splenic laceration identified at surgery that did not require treatment. Oesophageal rupture or aspiration pneumonia was not identified in any dog during hospitalization. No statistical difference was found between the method of gastric decompression and gastric compromise requiring surgical intervention or survival to discharge. Orogastric tubing and gastric trocarization are associated with low complication and high success rates. Either technique is an acceptable method for gastric decompression in dogs with gastric dilatation-volvulus. © 2013 British Small Animal Veterinary Association.

  13. Seroprevalence and risk factors associated with Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and D. immitis in hunting dogs from southern Italy.

    Science.gov (United States)

    Piantedosi, Diego; Neola, Benedetto; D'Alessio, Nicola; Di Prisco, Francesca; Santoro, Mario; Pacifico, Laura; Sgroi, Giovanni; Auletta, Luigi; Buch, Jesse; Chandrashekar, Ramaswamy; Breitschwerdt, Edward B; Veneziano, Vincenzo

    2017-10-01

    Canine vector-borne diseases (CVBDs) are caused by a range of pathogens transmitted to dogs by arthropods. The present study investigates Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and Dirofilaria immitis seroprevalences in hunting dogs from southern Italy. Dogs (no. 1335) were tested using a commercial in-clinic enzyme-linked immunosorbent assay kit. Odds ratios (ORs) were calculated by logistic regression analysis to identify risk factors. Overall, 138/1335 dogs (10.3%) were seroreactive to at least one CVBD pathogen. E. canis, Anaplasma spp., B. burgdorferi s.l., and D. immitis seroprevalences were 7.6, 4.4, 0.3, and 0.2%, respectively. E. canis and Anaplasma spp. co-exposures were found in 30 dogs (2.2%), compared with Anaplasma spp. and B. burgdorferi s.l. co-exposures in 2 dogs (0.1%). Adult age was a risk factor for E. canis (OR 2.35) seroreactivity whereas hunting fur-bearing animals for E. canis (OR 4.75) and Anaplasma spp. (OR 1.87), respectively. The historical presence of tick infestation was identified as a risk factor for positivity to E. canis (OR 2.08) and Anaplasma spp. (OR 2.15). Finally, larger dog pack size was significantly associated with E. canis (OR 1.85) and Anaplasma spp. (OR 2.42) exposures. The results of the present survey indicated that hunting dog populations are at relative risk of CVBDs in southern Italy. Further studies are needed to evaluate the role of hunting dogs in the epidemiology of vector-borne organisms due to sharing common environments with wild, sympatric animal populations.

  14. Cardiac markers: profile in rats experimentally infected with Toxocara canis Marcadores cardíacos: perfil em ratos infectados experimentalmente com Toxocara canis

    Directory of Open Access Journals (Sweden)

    Cecília Braga Laposy

    2012-09-01

    Full Text Available The aim of this study was to evaluate the profile of the enzymes creatine kinase (CK, creatine kinase MB (CK-MB and lactate dehydrogenase (LDH in Wistar rats infected with 250 (GI, n = 24 or 1000 (GII, n = 24 Toxocara canis eggs. Animals were evaluated on days 7, 15, 30, 60, 120 and 180 post-infection (DPI. Only the GI rats showed an increase in CK and CK-MB, at 15 and 30 DPI, respectively. Anti-Toxocara spp. antibodies were detected by ELISA in infected animals. Despite of the presence of eosinophilic infiltrate in the heart of three infected animals, none larva was recovered from the organ neither by acid digestion nor by Baermann procedure. Eosinophilia was observed in both groups but there was no significant difference in the eosinophil counts between GI and GII (p = 0.2239. It is possible to consider that cardiac lesion is an eventual finding in murine model for toxocariasis.O objetivo do presente estudo foi avaliar o perfil das enzimas creatinoquinase (CK, creatinoquinase-MB (CK-MB e lactato desidrogenase (LDH em ratos Wistar infectados com 250 (GI, n = 24 ou 1000 (GII, n = 24 ovos de Toxocara canis. Os animais foram avaliados nos dias 7, 15, 30, 60, 120 e 180 pós-infecção (DPI. Observou-se que apenas os animais do GI apresentaram aumento da atividade de CK e CK-MB aos 15 e 30 DPI, respectivamente. Anticorpos anti-T. canis foram detectados por ELISA nos animais infectados. Apesar da presença de infiltrado eosinofílico em três animais infectados, nenhuma larva foi recuperada do coração pela digestão ácida ou pela técnica de Baermann. Eosinofilia foi observada em todos os momentos em GI e GII, sem diferença significativa entre os grupos (p = 0,2239. Pode-se considerar que as lesões cardíacas foram um achado eventual no modelo murino para toxocaríase.

  15. Association between canine leishmaniosis and Ehrlichia canis co-infection: a prospective case-control study.

    Science.gov (United States)

    Attipa, Charalampos; Solano-Gallego, Laia; Papasouliotis, Kostas; Soutter, Francesca; Morris, David; Helps, Chris; Carver, Scott; Tasker, Séverine

    2018-03-20

    In the Mediterranean basin, Leishmania infantum is a major cause of disease in dogs, which are frequently co-infected with other vector-borne pathogens (VBP). However, the associations between dogs with clinical leishmaniosis (ClinL) and VBP co-infections have not been studied. We assessed the risk of VBP infections in dogs with ClinL and healthy controls. We conducted a prospective case-control study of dogs with ClinL (positive qPCR and ELISA antibody for L. infantum on peripheral blood) and clinically healthy, ideally breed-, sex- and age-matched, control dogs (negative qPCR and ELISA antibody for L. infantum on peripheral blood) from Paphos, Cyprus. We obtained demographic data and all dogs underwent PCR on EDTA-blood extracted DNA for haemoplasma species, Ehrlichia/Anaplasma spp., Babesia spp., and Hepatozoon spp., with DNA sequencing to identify infecting species. We used logistic regression analysis and structural equation modelling (SEM) to evaluate the risk of VBP infections between ClinL cases and controls. From the 50 enrolled dogs with ClinL, DNA was detected in 24 (48%) for Hepatozoon spp., 14 (28%) for Mycoplasma haemocanis, 6 (12%) for Ehrlichia canis and 2 (4%) for Anaplasma platys. In the 92 enrolled control dogs, DNA was detected in 41 (45%) for Hepatozoon spp., 18 (20%) for M. haemocanis, 1 (1%) for E. canis and 3 (3%) for A. platys. No Babesia spp. or "Candidatus Mycoplasma haematoparvum" DNA was detected in any dog. No statistical differences were found between the ClinL and controls regarding age, sex, breed, lifestyle and use of ectoparasitic prevention. A significant association between ClinL and E. canis infection (OR = 12.4, 95% CI: 1.5-106.0, P = 0.022) was found compared to controls by multivariate logistic regression. This association was confirmed using SEM, which further identified that younger dogs were more likely to be infected with each of Hepatozoon spp. and M. haemocanis, and dogs with Hepatozoon spp. were more likely to

  16. Benign gastric filling defect

    Energy Technology Data Exchange (ETDEWEB)

    Oh, K K; Lee, Y H; Cho, O K; Park, C Y [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1979-06-15

    The gastric lesion is a common source of complaints to Orientals, however, evaluation of gastric symptoms and laboratory examination offer little specific aid in the diagnosis of gastric diseases. Thus roentgenography of gastrointestinal tract is one of the most reliable method for detail diagnosis. On double contract study of stomach, gastric filling defect is mostly caused by malignant gastric cancer, however, other benign lesions can cause similar pictures which can be successfully treated by surgery. 66 cases of benign causes of gastric filling defect were analyzed at this point of view, which was verified pathologically by endoscope or surgery during recent 7 years in Yensei University College of Medicine, Severance Hospital. The characteristic radiological picture of each disease was discussed for precise radiologic diagnosis. 1. Of total 66 cases, there were 52 cases of benign gastric tumor 10 cases of gastric varices, 5 cases of gastric bezoar, 5 cases of corrosive gastritis, 3 cases of granulomatous disease and one case of gastric hematoma. 2. The most frequent causes of benign tumors were adenomatous polyp (35/42) and the next was leiomyoma (4/42). Others were one of case of carcinoid, neurofibroma and cyst. 3. Characteristic of benign adenomatous polyp were relatively small in size, smooth surface and were observed that large size, benign polyp was frequently type IV lesion with a stalk. 4. Submucosal tumors such as leiomyoma needed differential diagnosis with polypoid malignant cancer. However, the characteristic points of differentiation was well circumscribed smooth margined filling defect without definite mucosal destruction on surface. 5. Gastric varices showed multiple lobulated filling defected especially on gastric fundus that changed its size and shape by respiration and posture of patients. Same varices lesions on esophagus and history of liver disease were helpful for easier diagnosis. 6. Gastric bezoar showed well defined movable mass

  17. Benign gastric filling defect

    International Nuclear Information System (INIS)

    Oh, K. K.; Lee, Y. H.; Cho, O. K.; Park, C. Y.

    1979-01-01

    The gastric lesion is a common source of complaints to Orientals, however, evaluation of gastric symptoms and laboratory examination offer little specific aid in the diagnosis of gastric diseases. Thus roentgenography of gastrointestinal tract is one of the most reliable method for detail diagnosis. On double contract study of stomach, gastric filling defect is mostly caused by malignant gastric cancer, however, other benign lesions can cause similar pictures which can be successfully treated by surgery. 66 cases of benign causes of gastric filling defect were analyzed at this point of view, which was verified pathologically by endoscope or surgery during recent 7 years in Yensei University College of Medicine, Severance Hospital. The characteristic radiological picture of each disease was discussed for precise radiologic diagnosis. 1. Of total 66 cases, there were 52 cases of benign gastric tumor 10 cases of gastric varices, 5 cases of gastric bezoar, 5 cases of corrosive gastritis, 3 cases of granulomatous disease and one case of gastric hematoma. 2. The most frequent causes of benign tumors were adenomatous polyp (35/42) and the next was leiomyoma (4/42). Others were one of case of carcinoid, neurofibroma and cyst. 3. Characteristic of benign adenomatous polyp were relatively small in size, smooth surface and were observed that large size, benign polyp was frequently type IV lesion with a stalk. 4. Submucosal tumors such as leiomyoma needed differential diagnosis with polypoid malignant cancer. However, the characteristic points of differentiation was well circumscribed smooth margined filling defect without definite mucosal destruction on surface. 5. Gastric varices showed multiple lobulated filling defected especially on gastric fundus that changed its size and shape by respiration and posture of patients. Same varices lesions on esophagus and history of liver disease were helpful for easier diagnosis. 6. Gastric bezoar showed well defined movable mass

  18. Benign gastric filling defect

    Energy Technology Data Exchange (ETDEWEB)

    Oh, K. K.; Lee, Y. H.; Cho, O. K.; Park, C. Y. [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1979-06-15

    The gastric lesion is a common source of complaints to Orientals, however, evaluation of gastric symptoms and laboratory examination offer little specific aid in the diagnosis of gastric diseases. Thus roentgenography of gastrointestinal tract is one of the most reliable method for detail diagnosis. On double contract study of stomach, gastric filling defect is mostly caused by malignant gastric cancer, however, other benign lesions can cause similar pictures which can be successfully treated by surgery. 66 cases of benign causes of gastric filling defect were analyzed at this point of view, which was verified pathologically by endoscope or surgery during recent 7 years in Yensei University College of Medicine, Severance Hospital. The characteristic radiological picture of each disease was discussed for precise radiologic diagnosis. 1. Of total 66 cases, there were 52 cases of benign gastric tumor 10 cases of gastric varices, 5 cases of gastric bezoar, 5 cases of corrosive gastritis, 3 cases of granulomatous disease and one case of gastric hematoma. 2. The most frequent causes of benign tumors were adenomatous polyp (35/42) and the next was leiomyoma (4/42). Others were one of case of carcinoid, neurofibroma and cyst. 3. Characteristic of benign adenomatous polyp were relatively small in size, smooth surface and were observed that large size, benign polyp was frequently type IV lesion with a stalk. 4. Submucosal tumors such as leiomyoma needed differential diagnosis with polypoid malignant cancer. However, the characteristic points of differentiation was well circumscribed smooth margined filling defect without definite mucosal destruction on surface. 5. Gastric varices showed multiple lobulated filling defected especially on gastric fundus that changed its size and shape by respiration and posture of patients. Same varices lesions on esophagus and history of liver disease were helpful for easier diagnosis. 6. Gastric bezoar showed well defined movable mass

  19. Epidemiological Survey of Brucella canis Infection in Different Breeds of Dogs in Fars Province, Iran

    Directory of Open Access Journals (Sweden)

    Mohammad Amin Behzadi and Asghar Mogheiseh1*

    2012-05-01

    Full Text Available This study was conducted to determine the prevalence of Brucella canis antibodies in different breeds, sex and ages of dogs in southern of Iran. A total of 113 whole blood samples were taken from different breeds based on exotic or native sources. The samples were examined with immunochromatography assay for detection of B. canis antibodies. Twelve dogs were serologically positive (10.62%. There was significant differences in ratio of infected dogs between breeds (exotic or native, ages (less, equal or more than 2 years old and the history of vaccination (against rabies, leptospirosis, parvovirus, adenovirus type 2, canine distemper, parainfluenza (P<0.001. However, the results were not significant statistically, among both sex (P=0.058 and the history of clinical signs (P=0.456 in seropositive dogs. Based on this study and the other investigation in companion dogs from southwest of Iran, it seems that the mixed and spray (native breeds are not infected with B. canis, yet. Conversely, the exotic breeds would be the source of bacterium in Iran. Therefore, preventive and control measures are strongly recommended.

  20. Molecular detection of Anaplasma bovis, Ehrlichia canis and Hepatozoon felis in cats from Luanda, Angola.

    Science.gov (United States)

    Oliveira, Ana Cristina; Luz, Maria Francisca; Granada, Sara; Vilhena, Hugo; Nachum-Biala, Yaarit; Lopes, Ana Patrícia; Cardoso, Luís; Baneth, Gad

    2018-03-20

    Molecular identification of tick-borne pathogen infection in cats from Africa is scarce. The presence of bacterial (Anaplasma and Ehrlichia) and protozoal (Babesia and Hepatozoon) agents was investigated in blood samples from 102 domestic cats from Luanda, Angola, by polymerase chain reaction and DNA sequencing. Three cats (2.9%) were found infected with Ehrlichia canis, three (2.9%) with Hepatozoon felis and one (1.0%) with Anaplasma bovis. The prevalence of infections with one single agent was 4.9%, and that of infection with two agents (i.e. E. canis and H. felis) was 1.0%. In total, six cats (5.9%) were found infected with at least one of the detected tick-borne agents. This is the first report of A. bovis, E. canis and H. felis in cats from Angola. To the best of our knowledge, A. bovis is also being reported for the first time in domestic cats outside of Japan. Cats are at a low to moderate risk of being infected with tick-borne agents in Luanda.

  1. Effect of ionizing radiation on gastric secretion and gastric motility in monkeys

    Energy Technology Data Exchange (ETDEWEB)

    Danquechin Dorval, E.; Mueller, G.P.; Eng, R.R.; Durakovic, A.; Conklin, J.J.; Dubois, A.

    1985-08-01

    The prodromal syndrome of radiation sickness is characterized by nausea and vomiting but the pathophysiology and the treatment of this entity is largely unknown. The authors investigated this problem by determining the effects of ionizing radiation on gastric function with and without administration of the dopamine antagonist domperidone. They measured gastric electrical control activity (waves per minute), fractional emptying rate (percent per minute), acid output (microequivalents per minute), and plasma levels of immunoreactive beta-endorphin. Twelve conscious, chair-adapted rhesus monkeys were studied twice before, once immediately after, and once 2 days after a single 800-cGy (800 rads) /sup 60/Co total body irradiation. In addition to causing vomiting, total body irradiation transiently suppressed gastric electrical control activity, gastric emptying and gastric secretion, while increasing plasma levels of immunoreactive beta-endorphin. Domperidone had no effect on vomiting or gastric function either before or after irradiation, but it significantly increased plasma immunoreactive beta-endorphin.

  2. Effect of ionizing radiation on gastric secretion and gastric motility in monkeys

    Energy Technology Data Exchange (ETDEWEB)

    Dorval, E.D.; Mueller, G.P.; Eng, R.R.; Durakovic, A.; Conklin, J.J.

    1985-08-01

    The prodromal syndrome of radiation sickness is characterized by nausea and vomiting but the pathophysiology and the treatment of this entity is largely unknown. The authors investigated this problem by determining the effects of ionizing radiation on gastric function with and without administration of the dopamine antagonist domperidone. They measured gastric electrical control activity (waves per minute), fractional emptying rate (percent per minute), acid output (microequivalents per minute), and plasma levels of immunoreactive Beta-endorphin. Twelve conscious, chair-adapted rhesus monkeys were studied twice before, once immediately after, and once 2 days after a single 800-cGy (800 rads) /sup 60/Co total-body irradiation. In addition to causing vomiting, total-body irradiation transiently suppressed gastric electrical control activity, gastric emptying and gastric secretion, while increasing plasma levels of immunoreactive Beta-endorphin. Domperidone had no effect on vomiting or gastric function either before or after irradiation, but it significantly increased plasma immunoreactive Beta endorphin.

  3. Does remnant gastric cancer really differ from primary gastric cancer? A systematic review of the literature by the Task Force of Japanese Gastric Cancer Association.

    Science.gov (United States)

    Shimada, Hideaki; Fukagawa, Takeo; Haga, Yoshio; Oba, Koji

    2016-04-01

    Remnant gastric cancer, most frequently defined as cancer detected in the remnant stomach after distal gastrectomy for benign disease and those cases after surgery of gastric cancer at least 5 years after the primary surgery, is often reported as a tumor with poor prognosis. The Task Force of Japanese Gastric Cancer Association for Research Promotion evaluated the clinical impact of remnant gastric cancer by systematically reviewing publications focusing on molecular carcinogenesis, lymph node status, patient survival, and surgical complications. A systematic literature search was performed using PubMed/MEDLINE with the keywords "remnant," "stomach," and "cancer," revealing 1154 relevant reports published up to the end of December 2014. The mean interval between the initial surgery and the diagnosis of remnant gastric cancer ranged from 10 to 30 years. The incidence of lymph node metastases at the splenic hilum for remnant gastric cancer is not significantly higher than that for primary proximal gastric cancer. Lymph node involvement in the jejunal mesentery is a phenomenon peculiar to remnant gastric cancer after Billroth II reconstruction. Prognosis and postoperative morbidity and mortality rates seem to be comparable to those for primary proximal gastric cancer. The crude 5-year mortality for remnant gastric cancer was 1.08 times higher than that for primary proximal gastric cancer, but this difference was not statistically significant. In conclusion, although no prospective cohort study has yet evaluated the clinical significance of remnant gastric cancer, our literature review suggests that remnant gastric cancer does not adversely affect patient prognosis and postoperative course.

  4. Loop-mediated isothermal amplification as a reliable assay for Toxocara canis infection in pet dogs.

    Science.gov (United States)

    Khoshakhlagh, Paria; Spotin, Adel; Mahami-Oskouei, Mahmoud; Shahbazi, Abbas; Ozlati, Maryam

    2017-09-01

    Keeping of infected dogs as pet results in the potential transmission risk factors for shedding helminthic infections such as toxocariasis. Lack of accurate identification of Toxocara canis eggs in non-dewormed infected pet dogs remains a diagnostic concern among researchers. In this study, dog owners were asked to fill up a questionnaire regarding their pets and their attitude towards the deworming regimen. One hundred faecal samples were collected from pet dogs (Northwest Iran) and were subsequently identified by the ZnSo4 flotation technique, PCR and loop-mediated isothermal amplification (LAMP) assays. The DNA of the recovered T. canis eggs was then extracted and amplified by LAMP and PCR. Furthermore, ITS2 amplicons were sequenced for appraisal of the phylogenetic analysis. Nine, 5 and 11% of T. canis infections were identified by microscopy, PCR and LAMP, respectively. It was detected that LAMP was 10 times (10 -10 to 10 -13  g/μl) more sensitive than PCR (10 -10 to 10 -12  g/μl). The kappa value between LAMP and PCR indicated a faint concurrence (0.463). The kappa coefficient between LAMP and flotation technique indicated a strong agreement (0.667). The highest infection rate (n = 11) was detected in non-dewormed pet dogs, particularly those less than 3 months old (P canis eggs in infected pet dogs. It was proposed that the dog holder's awareness is insufficient to implement regular deworming schedules. Additionally, regional policymakers should broadly revise anthelmintic treatment guidelines.

  5. Molecular confirmation of Hepatozoon canis in Mauritius.

    Science.gov (United States)

    Daskalaki, Aikaterini Alexandra; Ionică, Angela Monica; Jeetah, Keshav; Gherman, Călin Mircea; Mihalca, Andrei Daniel

    2018-01-01

    In this study, Hepatozoon species was molecularly identified and characterized for the first time on the Indian Ocean island of Mauritius. Partial sequences of the 18S rRNA gene of the Hepatozoon isolates were analysed from three naturally infected dogs. The sequences of H. canis were similar to the 18S rRNA partial sequences (JX112783, AB365071 99%) from dog blood samples from West Indies and Nigeria. Our sequences were deposited in the GenBank database. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Distance to VY Canis Majoris with VERA

    OpenAIRE

    Choi, Yoon Kyung; Hirota, Tomoya; Honma, Mareki; Kobayashi, Hideyuki; Bushimata, Takeshi; Imai, Hiroshi; Iwadate, Kenzaburo; Jike, Takaaki; Kameno, Seiji; Kameya, Osamu; Kamohara, Ryuichi; Kan-ya, Yukitoshi; Kawaguchi, Noriyuki; Kijima, Masachika; Kim, Mi Kyoung

    2008-01-01

    We report astrometric observations of H2O masers around the red supergiant VY Canis Majoris (VY CMa) carried out with VLBI Exploration of Radio Astrometry (VERA). Based on astrometric monitoring for 13 months, we successfully measured a trigonometric parallax of 0.88 +/- 0.08 mas, corresponding to a distance of 1.14 +0.11/-0.09 kpc. This is the most accurate distance to VY CMa and the first one based on an annual parallax measurement. The luminosity of VY CMa has been overestimated due to a p...

  7. Influence of land use and meteorological factors on the spatial distribution of Toxocara canis and Toxocara cati eggs in soil in urban areas.

    Science.gov (United States)

    Gao, Xiang; Wang, Hongbin; Li, Jianxin; Qin, Hongyu; Xiao, Jianhua

    2017-01-15

    Soil which has been contaminated by Toxocara spp. eggs is considered as one of the main infection sources of Toxocariasis in animals and humans. The present study conducted a detailed investigation into the spatial patterns of Toxocara canis (T. canis) and Toxocara cati (T. cati) eggs in soil in urban area of northeastern Mainland China, and assessed the inter-relationships between meteorological factors, land use and the distribution of the Toxocara spp. eggs. Polymerase chain reaction (PCR) was used for the determination of T. canis and T. cati eggs contamination in soil samples. Between April 2014 and May 2015, 9420 soil samples were subjected to PCR examination and 7027 sheep (74.6%) were determined to be positive for T. canis and T. cati eggs. Subsequently, we evaluated the effect of land use, and meteorological factors on the spatial distribution of T. canis and T. cati eggs based on a maximum entropy model. Jackknife analysis revealed that the area of residential land, wood and grass land and precipitation may influence the occurrence of T. canis and T. cati eggs in soil. Our findings indicate that land use and meteorological factors may be important variables affecting transmission of Toxocariasis and should be taken into account in the development of future surveillance programmes for Toxocariasis. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Prevalence and molecular characterization of Hepatozoon canis in dogs from urban and rural areas in Southeast Brazil.

    Science.gov (United States)

    de Miranda, R L; O'Dwyer, L H; de Castro, J R; Metzger, B; Rubini, A S; Mundim, A V; Eyal, O; Talmi-Frank, D; Cury, M C; Baneth, G

    2014-10-01

    The objective of this survey was to investigate the prevalence of Hepatozoon infection in dogs in the rural and urban areas of Uberlândia, Brazil by PCR and molecular characterization. DNA was obtained from blood samples collected from 346 local dogs from both genders and various ages. Seventeen PCR products from positive blood samples of urban dogs and 13 from the rural dogs were sequenced. Partial sequences of the 18S rRNA gene indicated that all 30 dogs were infected with Hepatozoon canis similar in sequence to H. canis from southern Europe. Four local dog sequences were submitted to GenBank (accessions JN835188; KF692038; KF692039; KF692040). This study indicates that H. canis is the cause of canine hepatozoonosis in Uberlândia and that infection is similarly widespread in rural and urban dogs. Copyright © 2014. Published by Elsevier Ltd.

  9. A PARASITOLOGIC AND MOLECULAR SURVEY OF HEPATOZOON CANIS INFECTION IN STRAY DOGS IN NORTHEAST OF IRAN.

    Science.gov (United States)

    Barati, Ali; Razmi, Gholamreza

    2018-05-15

    Canine hepatozoonosis, caused by H. canis, is a tick-borne disease in domestic and wild dogs that is transmitted by ingestion of Rhipicephalus sanguineus ticks. The aim of the study was to detect H. canis in stray dogs in Iran using blood smear examination and molecular techniques. From October 2014 to September 2015, 150 EDTA blood samples were collected from stray dogs in the northeast region of Iran. Blood smears were microscopically examined for the presence of Hepatozoon gamonts; whole blood was evaluated by PCR, with subsequent sequencing and phylogenetic analysis. Hepatozoon spp. Gamonts were observed in the neutrophils of 5/150 (3.3%) blood smears, whereas Hepatozoon spp. 18S rDNA was detected in 12/150 (8.0%) blood samples from stray dogs. There was a good agreement between microscopy and PCR methods. (Kappa= 0.756). The highest rate of infection was seasonally detected in the summer (pHepatozoon spp infection was not significant by gender and age factors (p>0.05). The alignment analysis of the sequenced samples showed ≥99% similarity with other nucleotide sequences of Hepatozoon spp. in GenBank. The phylogenetic tree also revealed that the nucleotide sequences in this study were clustered in the H. canis clade and different from the H. felis and H. americanum clades. According to the results, it is concluded that H. canis infection is present among dogs in northeastern region of Iran.

  10. Ultrasonographic gastric antral area and gastric contents volume in children.

    Science.gov (United States)

    Schmitz, Achim; Thomas, Schraner; Melanie, Fruehauf; Rabia, Liamlahi; Klaghofer, Richard; Weiss, Markus; Kellenberger, Christian

    2012-02-01

    Cross-sectional gastric antral area (GAA) measurements by ultrasonography (US) have been proposed for preoperative assessment of gastric volume in adults but not been validated in children. This study investigates whether in children gastric volumes can be predicted by US performed in different patient positions. Gastric fluid and air volumes were examined by magnetic resonance imaging before or up to 120 min after ingestion of 7 ml·kg(-1) diluted raspberry syrup in healthy volunteers who had fasted overnight. GAA was measured with US three times each in supine (SUP), elevated 45° degree supine (E45) and right decubital (RDC) position using imaging planes defined by vascular landmarks. Correlation coefficients (Pearson) between GAA and gastric volumes were calculated and Bland-Altman analysis performed. Sixteen children aged from 6.4 to 12.8 (9.2) years were included in 23 examinations: 6 after overnight fasting, 3 directly after, and 14 with a delay of 74 ± 35 min after fluid intake. GAA was 221 ± 116, 218 ± 112, and 347 ± 188 mm(2) for SUP, E45, and RDC position, respectively. The best correlation between body weight corrected total gastric/gastric fluid volume (TGV(w)/GFV(w)) with GAA was found for RDC position (R = 0.79; P < 0.01/R = 0.78; P < 0.01). Bias and precision of calculated and measured GFV(w) was 0 ± 2.8 ml·kg(-1). Correlations between GAA and TGV(w) or GFV(w) in children are best in the RDC position, but not sufficient to predict GFV(w) with a given GAA. Interpretation of isolated GAA values may be misleading. © 2011 Blackwell Publishing Ltd.

  11. Gastric and intestinal surgery.

    Science.gov (United States)

    Fossum, Theresa W; Hedlund, Cheryl S

    2003-09-01

    Gastric surgery is commonly performed to remove foreign bodies and correct gastric dilatation-volvulus and is less commonly performed to treat gastric ulceration or erosion, neoplasia, and benign gastric outflow obstruction. Intestinal surgery, although commonly performed by veterinarians, should never be considered routine. The most common procedures of the small intestinal tract performed in dogs and cats include enterotomy and resection/anastomosis. Surgery of the large intestine is indicated for lesions causing obstruction, perforations, colonic inertia, or chronic inflammation.

  12. Mouse Models of Gastric Cancer

    Science.gov (United States)

    Hayakawa, Yoku; Fox, James G.; Gonda, Tamas; Worthley, Daniel L.; Muthupalani, Sureshkumar; Wang, Timothy C.

    2013-01-01

    Animal models have greatly enriched our understanding of the molecular mechanisms of numerous types of cancers. Gastric cancer is one of the most common cancers worldwide, with a poor prognosis and high incidence of drug-resistance. However, most inbred strains of mice have proven resistant to gastric carcinogenesis. To establish useful models which mimic human gastric cancer phenotypes, investigators have utilized animals infected with Helicobacter species and treated with carcinogens. In addition, by exploiting genetic engineering, a variety of transgenic and knockout mouse models of gastric cancer have emerged, such as INS-GAS mice and TFF1 knockout mice. Investigators have used the combination of carcinogens and gene alteration to accelerate gastric cancer development, but rarely do mouse models show an aggressive and metastatic gastric cancer phenotype that could be relevant to preclinical studies, which may require more specific targeting of gastric progenitor cells. Here, we review current gastric carcinogenesis mouse models and provide our future perspectives on this field. PMID:24216700

  13. Characterization of fasted human gastric fluid for relevant rheological parameters and gastric lipase activities

    DEFF Research Database (Denmark)

    Pedersen, Pernille Barbre; Vilmann, Peter; Bar-Shalom, Daniel

    2013-01-01

    be considered important during development of gastric simulated media. Further, the activity of the HGL is active even under fasted gastric conditions and might contribute to the digestion and emulsification of lipid-based drug delivery systems in the entire gastrointestinal tract. HGL should therefore......PURPOSE: To characterize human gastric fluid with regard to rheological properties and gastric lipase activity. In addition, traditional physicochemical properties were determined. METHODS: Fasted HGA were collected from 19 healthy volunteers during a gastroscopic examination. Rheological...... be considered in gastric evaluation of lipid-based drug delivery systems....

  14. Comparative Foraging Efficiency of Two Sympatric Jackals, Silver-Backed Jackals (Canis mesomelas and Golden Jackals (Canis aureus, in the Ngorongoro Crater, Tanzania

    Directory of Open Access Journals (Sweden)

    S. E. Temu

    2016-01-01

    Full Text Available The foraging efficiency of two sympatric species of jackals, silver-backed jackals (Canis mesomelas and golden jackals (Canis aureus, was studied in the Ngorongoro crater from July 2014 through May 2015. The focal animal observation method was used and individuals of both species were followed as they foraged from morning to evening. Observations of individuals of both jackal species were made from a vehicle using binoculars and a spotting scope. Three major parameters were used for determination of foraging efficiency: distance travelled while foraging, time spent foraging, and amount of food secured in foraging period. The Mann–Whitney U test showed no significant difference (P>0.05 in distance travelled per unit time of foraging between the two species in the dry and wet seasons, respectively. Golden jackals secured a significantly higher amount of food than the silver-backed jackals in the wet season (Mann–Whitney U test, P<0.05, U=1035.4. Hunting of prey larger than Thomson’s gazelle (Eudorcas thomsonii fawns was not common. Both species mainly fed on smaller prey such as invertebrates and rodents and scavenged opportunistically. Efficient foraging is crucial for both jackal species especially during their breeding season when they are provisioning dependent pups.

  15. A parasitological, molecular and serological survey of Hepatozoon canis infection in dogs around the Aegean coast of Turkey.

    Science.gov (United States)

    Karagenc, Tulin Ilhan; Pasa, Serdar; Kirli, Gulcan; Hosgor, Murat; Bilgic, Huseyin Bilgin; Ozon, Yavuz Hakan; Atasoy, Abidin; Eren, Hasan

    2006-01-30

    Canine hepatozoonosis is caused by the tick-borne protozoon Hepatozoon spp. The prevalence of the infection in the Aegean coast of Turkey was investigated by examination of blood smear parasitology and polymerase chain reaction (PCR) using blood samples from 349 dogs collected from Central Aydin, Kusadasi, Selcuk, Central Manisa, Bodrum and Marmaris within the Aegean coast of Turkey. The indirect fluorescent antibody test (IFAT) for the detection of Hepatozoon canis antibodies was also used to detect the exposure rate to H. canis. PCR amplifying a 666bp fragment of 18S rRNA gene of Hepatozoon spp. was used in the epidemiological survey. The prevalence of Hepatozoon spp. infection was 10.6% by blood smear parasitology and 25.8% by PCR. IFAT revealed that 36.8% of serum samples were positive for antibodies reactive with Hepatozoon spp. The PCR products of 18S rRNA gene of Hepatozoon spp. isolated from six infected dogs, one isolate originating from each of the six different locations, were sequenced. The results of sequence analysis indicate that they are closely related to Indian and Japanese isolates of H. canis. This is the first epidemiological study on the prevalence of H. canis infection in the dog, in Turkey.

  16. PARASITISMO POR ANCILOSTOMATÍDEOS EM CÃES (Canis familiaris DOMICILIADOS EM CAMPOS DOS GOYTACAZES, RJ. PARASITISM BY ANCYLOSTOMIDES IN DOGS (Canis familiaris DOMICILIATED IN CAMPOS DOS GOYTACAZES, RJ.

    Directory of Open Access Journals (Sweden)

    Francimar Fernandes Gomes

    2008-12-01

    Full Text Available Os ancilostomatídeos são nematóides hematófagos parasitas do intestino delgado, podendo causar retardo no crescimento, inapetência, anorexia, apatia, anemia e até a morte. No homem, algumas espécies como Ancylostoma caninum, A. braziliense e A. tubaeforme podem causar larva migrans cutânea, quando as larvas infectantes de terceiro estágio penetram ativamente a pele íntegra. O objetivo deste trabalho foi detectar o parasitismo por ancilostomatídeos em fezes de cães domiciliados e assintomáticos na cidade de Campos dos Goytacazes, RJ, tendo em vista a proximidade do convívio destes animais com homem. Com esse propósito, amostras fecais de 68 cães foram coletadas, sendo trinta (44,12% considerados parasitados através de exame coproparasitológico utilizando-se o método de Willis-Molley.

    PALAVRAS-CHAVES: Ancylostoma sp., fezes, método Willis-Mollay. The ancylostomides are hematophagous nematodes parasites of the small intestine, being able to cause retardation in the growth, anorexy, apathy, anemia and death. In the man, some species as Ancylostoma caninum, A. braziliense and A. tubaeforme can cause cutaneous larva migrans, when the larvae infects of third period of stage penetrate actively the skin. The objective of this work was to detect the parasitism for ancylostomides in excrements of domiciliated and asymptomatic dogs in Campos dos Goytacazes, RJ, in view of the proximity of the conviviality of these animals with the man. With this intention, faecal samples of 68 dogs had been collected, being 30 (44.12% considered parasitized through stool parasitology using the method of Willis-Molley.

    KEY WORDS: Ancylostoma sp. feces, Willis-Mollay Method.

  17. The distinctive gastric fluid proteome in gastric cancer reveals a multi-biomarker diagnostic profile

    Directory of Open Access Journals (Sweden)

    Eng Alvin KH

    2008-10-01

    Full Text Available Abstract Background Overall gastric cancer survival remains poor mainly because there are no reliable methods for identifying highly curable early stage disease. Multi-protein profiling of gastric fluids, obtained from the anatomic site of pathology, could reveal diagnostic proteomic fingerprints. Methods Protein profiles were generated from gastric fluid samples of 19 gastric cancer and 36 benign gastritides patients undergoing elective, clinically-indicated gastroscopy using surface-enhanced laser desorption/ionization time-of-flight mass spectrometry on multiple ProteinChip arrays. Proteomic features were compared by significance analysis of microarray algorithm and two-way hierarchical clustering. A second blinded sample set (24 gastric cancers and 29 clinically benign gastritides was used for validation. Results By significance analysyis of microarray, 60 proteomic features were up-regulated and 46 were down-regulated in gastric cancer samples (p Conclusion This simple and reproducible multimarker proteomic assay could supplement clinical gastroscopic evaluation of symptomatic patients to enhance diagnostic accuracy for gastric cancer and pre-malignant lesions.

  18. Differential diagnosis of gastric adenoma and type IIa early gastric cancer

    International Nuclear Information System (INIS)

    Tsuchigame, T.; Ogata, Y.; Sumi, M.; Fukui, K.; Saito, R.; Nakashima, K.; Urata, J.; Arakawa, A.; Saito, Y.; Takahashi, M.

    1991-01-01

    The endoscopic and radiographic findings of 45 gastric adenomas in 39 patients were followed for 6 months to 13 years and compared with type IIa early gastric cancer observed in 9 patients. Difficulties in the diffential diagnosis of these disorders were evaluated. The following features were suggestive of gastric adenomas: clustered lesions; protuberance with gentle slope; smooth surface; and relatively young patients. Discrimination of adenoma from type IIa early gastric cancer is often difficult by visual observation alone; biopsy was essential in most patients. A group III adenoma verified on biopsy should be followed closely because the lesion may harbor a cancer (so-called carcinoma-in-adenoma) or a cancer may later develop. (orig.)

  19. Gastric intestinal metaplasia: an intermediate precancerous lesion in the cascade of gastric carcinogenesis

    International Nuclear Information System (INIS)

    Malik, T.H.; Hong, X.; Sayahan, M.Y.A.

    2017-01-01

    Gastric intestinal metaplasia, an intermediate lesion in the development of intestinal-type gastric cancer, is observed in the milieu of long standing non-atrophic gastritis and atrophic gastritis. Most patients with intestinal metaplasia remain asymptomatic unless cobalamin deficiency occurs secondary to loss of glands (that produce intrinsic factor and acid). Genetic events that predispose to development of gastric intestinal metaplasia remains an enigma. Mechanisms leading to the progression of atrophy to metaplasia still needs to be comprehensively explored. Many studies in the literature describe a positive effect of typing intestinal metaplasia and concluded that intestinal metaplasia type III carries the highest risk for developing gastric cancer while others refute it. It is well established that Helicobacter pylori infection is the most important factor for the development of chronic gastritis, gastric intestinal metaplasia as well as gastric cancer. Countries with a higher prevalence of Helicobacter pylori infection and gastric cancer also have a high tendency of being prevalent for intestinal metaplasia. However, it remains elusive whether eradication of Helicobacter pylori infection tends to regress gastric intestinal metaplasia or reduce the subsequent risk of cancer development. Putting together, more prospective cohort studies should be designed to identify factors (antioxidants; anti-inflammatory drugs; food therapy) that may contribute in the regression of intestinal metaplasia, when used simultaneously with eradication therapy. Furthermore, molecular markers for evaluation of intestinal metaplasia, and the potential point-of-no-return should be further investigated. Consensus is also required to advocate a timeframe for surveillance of patients with gastric intestinal metaplasia. (author)

  20. Characterization of rabies virus from a human case in Nepal.

    Science.gov (United States)

    Pant, G R; Horton, D L; Dahal, M; Rai, J N; Ide, S; Leech, S; Marston, D A; McElhinney, L M; Fooks, A R

    2011-04-01

    Rabies is endemic throughout most of Asia, with the majority of human cases transmitted by domestic dogs (Canis familiaris). Here, we report a case of rabies in a 12-year-old girl in the Lalitpur district of Nepal that might have been prevented by better public awareness and timely post-exposure prophylaxis. Molecular characterization of the virus showed 100% identity over a partial nucleoprotein gene sequence to previous isolates from Nepal belonging to the 'arctic-like' lineage of rabies virus. Sequence analysis of both partial nucleoprotein and glycoprotein genes showed differences in consensus sequence after passage in vitro but not after passage in vivo.