WorldWideScience

Sample records for caninas cannis familiaris

  1. Canny Edge Detection using Verilog

    OpenAIRE

    D Narayana Reddy*; , Mohan A R2; , Subhramanya Bhat3

    2014-01-01

    Edge detection is one of the key stages in image processing and objects identification. The Canny Edge Detector is one of the most widely used edge detection algorithm due to its good performance. Edge detection carries preprocessing step for many image processing algorithms such as image enhancement, image segmentation, tracking and image/video coding. Canny’s edge detection algorithm that results in significantly reduced memory requirements decreased latency and increased th...

  2. Design and Simulation of Canny Edge Detection

    OpenAIRE

    D Narayana Reddy*; Vaijanath V.Yerigeri; Harish Sanu

    2014-01-01

    Edge is one of the prominent features in the image processing applications. The edge detection algorithm is carried out by using different methods. Canny edge algorithm is one of the well known edge detection algorithm. In proposed design, the canny edge detection algorithm is designed in verilog and simulated using the MATLAB and Modelsim. The input image is converted to text/pixel values using MATLAB and is stored in a new text file. Verilog with test bench program is used to as...

  3. Enteric Parasitic in canines (Canis familiaris) in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

    OpenAIRE

    Llanos Mariana; Condori Marcelina; Ibáñez Teddy; Loza-Murguia Manuel

    2010-01-01

    A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris), 96 dogs (58 males and 38 females) with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, ...

  4. IRIS Biometric Recognition System Employing Canny Operator

    Directory of Open Access Journals (Sweden)

    Binsu C. Kovoor

    2013-05-01

    Full Text Available Biometrics has become important in security applica tions. In comparison with many other biometric features, iris recognition has very high recognition accuracy because it depends on iris which is located in a place that still stable throughout human life and the probability to find two identical iris's is close to zero. The identifi cation system consists of several stages including segmentation stage which is the most serious and cr itical one. The current segmentation methods still have limitation in localizing the iri s due to circular shape consideration of the pupil. In this research, Daugman method is done to investigate the segmentation techniques. Eyelid detection is another step that has been incl uded in this study as a part of segmentation stage to localize the iris accurately and remove un wanted area that might be included. The obtained iris region is encoded using haar wavelets to construct the iris code, which contains the most discriminating feature in the iris pattern . Hamming distance is used for comparison of iris templates in the recognition stage. The datase t which is used for the study is UBIRIS database. A comparative study of different edge det ector operator is performed. It is observed that canny operator is best suited to extract most of the edges to generate the iris code for comparison. Recognition rate of 89% and rejection r ate of 95% is achieved.

  5. Analisis Kinerja Metode Canny Dalam Mendeteksi Tepi Karies Gigi

    OpenAIRE

    Bangun, Melly Br

    2011-01-01

    One of the main stages in the digital image processing is edge detection process, the existence of this process with the boundary between the background object can be determined properly. Edge detection aims to improve the appearance of lines boundary of an area or object within the image. There are many edge detection methods are currently known, in this study used the edge detection method is the Canny method. This study aims to analyze the performance of the Canny edge detection method ...

  6. Residència canina

    OpenAIRE

    Rafart Roca, Mariola

    2013-01-01

    L’idea principal d’aquest projecte consisteix en la construcció d’una Residència Canina a la localitat de la Torre d’Oristà (Osona), en una zona de proximitat al poble però dins de terreny rústic. La zona estarà composta per cinc grans espais: - Edifici on s’ubicarà: lavabos, oficina, perruqueria canina i magatzem. - Bateria de gosseres. - Sala de maquinària. - Zona de piscina. - Zona d’esbarjo. A més també es modificarà en petita escala l’entorn de la zona, per adapta...

  7. Improvement and implementation for Canny edge detection algorithm

    Science.gov (United States)

    Yang, Tao; Qiu, Yue-hong

    2015-07-01

    Edge detection is necessary for image segmentation and pattern recognition. In this paper, an improved Canny edge detection approach is proposed due to the defect of traditional algorithm. A modified bilateral filter with a compensation function based on pixel intensity similarity judgment was used to smooth image instead of Gaussian filter, which could preserve edge feature and remove noise effectively. In order to solve the problems of sensitivity to the noise in gradient calculating, the algorithm used 4 directions gradient templates. Finally, Otsu algorithm adaptively obtain the dual-threshold. All of the algorithm simulated with OpenCV 2.4.0 library in the environments of vs2010, and through the experimental analysis, the improved algorithm has been proved to detect edge details more effectively and with more adaptability.

  8. Iris Recognition System using canny edge detection for Biometric Identification

    Directory of Open Access Journals (Sweden)

    Bhawna Chouhan

    2011-01-01

    Full Text Available biometric system provides automatic identification of an individual based on a unique feature or characteristic possessed by the individual. Iris recognition is regarded as the most reliable and accurate biometric identification system available. Most commercial iris recognition systems use patented algorithms developed by Daugman, and these algorithms are able to produce perfect recognition rates. Especially it focuses on image segmentation and feature extraction for iris recognition process. The performance of iris recognition system highly depends on edge detection. The Canny Edge Detector is one of the most commonly used image processing tools, detecting edges in a very robust manner. For instance, even an effective feature extraction method would not be able to obtain useful information from an iris image that is not segmented properly. This paper presents a straightforward approach for segmenting the iris patterns. The used method determines an automated global threshold and the pupil center. Experiments are performed using iris images obtained from CASIA database (Institute of Automation, Chinese Academy of Sciences and Matlab application for its easy and efficient tools in image manipulation.

  9. Age McCanni büroo = Offices of Age McCann

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Rotermanni 8 asuva Age McCanni büroo sisekujundusest. Sisekujunduse autorid: sisearhitekt Kerli Valk (Kukuhaus OÜ) ja arhitekt Tomomi Hayashi (HG Arhitektuur OÜ), nende tähtsamate tööde loetelu

  10. Secondary metabolites from Scrophularia canina L.

    Science.gov (United States)

    Venditti, A; Frezza, C; Riccardelli, M; Foddai, S; Nicoletti, M; Serafini, M; Bianco, A

    2016-07-01

    A re-examination of Scrophularia canina L. confirmed the presence of iridoid glucosides considered as chemotaxonomic markers for the Scrophulariaceae family, like aucubin, harpagide and 8-O-acetylharpagide, besides the further presence of 8-epiloganic acid, which is, indeed, considered the biogenetic precursor of iridoids normally found in Scrophulariaceae, and was recognised here for the first time in the studied species. Also verbascoside and (E)-phytol were evidenced for the first time in S. canina. The former compound is an almost ubiquitous glycosidic phenyl-ethanoid, which attains systematic importance when in co-occurrence with iridoids, and its taxonomical implications were discussed. The latter compound, even though it is omnipresent, is interestingly endowed with several biological activities, which may give an additional reason for the traditional uses of this plant. PMID:26675659

  11. A Facial Expression Classification System Integrating Canny, Principal Component Analysis and Artificial Neural Network

    CERN Document Server

    Thai, Le Hoang; Hai, Tran Son

    2011-01-01

    Facial Expression Classification is an interesting research problem in recent years. There are a lot of methods to solve this problem. In this research, we propose a novel approach using Canny, Principal Component Analysis (PCA) and Artificial Neural Network. Firstly, in preprocessing phase, we use Canny for local region detection of facial images. Then each of local region's features will be presented based on Principal Component Analysis (PCA). Finally, using Artificial Neural Network (ANN)applies for Facial Expression Classification. We apply our proposal method (Canny_PCA_ANN) for recognition of six basic facial expressions on JAFFE database consisting 213 images posed by 10 Japanese female models. The experimental result shows the feasibility of our proposal method.

  12. ANTIMICROBIAL ACTIVITY OF ROSA CANINA FLOWERS AGAINST SELECTED MICROORGANISMS

    Directory of Open Access Journals (Sweden)

    Katarína Rovná

    2015-02-01

    Full Text Available Rosa canina flowers were screened against various plant pathogenic microbial strains to study the antimicrobial properties of the plant. Ethanolic and methanolic extracts of flowers were screened applying agar well diffusion method against two Gram-negative bacteria including Escherichia coli CCM 3988 and Pseudomonas aeruginosa CCM 1960 and three microscopic filamentous fungi strains Aspergillus niger, Fusarium culmorum and Alternaria alternata, respectively. The best antimicrobial effect of ethanolic extract of Rosa canina flowers was found against Pseudomonas aeruginosa and the best antimicrobial effect of methanolic extract of Rosa canina flowers was found against Escherichia coli.

  13. SEGMENTATION OF CT SCAN LUMBAR SPINE IMAGE USING MEDIAN FILTER AND CANNY EDGE DETECTION ALGORITHM

    Directory of Open Access Journals (Sweden)

    E.Punarselvam

    2013-09-01

    Full Text Available The lumbar vertebrae are the largest segments of the movable part of the vertebral column, they are elected L1 to L5, starting at the top. The spinal column, more commonly called the backbone, is made up primarily of vertebrae discs, and the spinal cord. Acting as a communication conduit for the brain, signals are transmitted and received through the spinal cord. It is otherwise known as vertebralcolumn consists of 24 separate bony vertebrae together with 5 fused vertebrae, it is the unique interaction between the solid and fluid components that provides the disc strength and flexibility required to bear loading of the lumbar spine. In this work the Segmentation of Spine Image using Median Filter and Canny Edge Detection Algorithm between lumbar spine CT scan spine disc image. The result shows thatthe canny edge detection algorithm produced better result when compared other edge detection algorithm. Finding the correct boundary in a noisy image of spine disc is still a difficult one. To find outabsolute edges from noisy images, the comparative result can be verified and validated with the standard medical values. The result shows that the canny edge detection algorithm performs well and produced a solution very nearer to the optimal solution. This method is vigorous for all kinds of noisy images.

  14. Gestolen kenmerken: wat zijn soorten in Rosa sect. Caninae?

    NARCIS (Netherlands)

    Haveman, R.

    2016-01-01

    In 2011 verscheen in dit tijdschrift een overzicht van de rozensoorten in ons land. Bakker et al hanteren in dit overzicht een artificieel, typologisch soortconcept om orde te scheppen in de chaos van Rosa sect. Caninae, waarbij de variatie via morfologische kenmerken wordt verdeeld in eenheden, waa

  15. Gestolen kenmerken: wat zijn soorten in Rosa sect. Caninae?

    NARCIS (Netherlands)

    Haveman, R.

    2016-01-01

    In 2011 verscheen in dit tijdschrift een overzicht van de rozensoorten in ons land. Bakker et al.1
    hanteren in dit overzicht een artificieel, typologisch soortconcept om orde te scheppen in de chaos
    van Rosa sect. Caninae, waarbij de variatie via morfologische kenmerken wordt verdeeld in een

  16. Brazilian canine hepatozoonosis Hepatozoonose canina brasileira

    Directory of Open Access Journals (Sweden)

    Lucia Helena O'Dwyer

    2011-09-01

    Full Text Available The genus Hepatozoon includes hundreds of species that infect birds, reptiles, amphibians and mammals, in all continents with tropical and subtropical climates. Two species have been described in domestic dogs: H. canis, reported in Europe, Asia, Africa, South America and the United States; and H. americanum, which so far has only been diagnosed in the United States. In Brazil, the only species found infecting dogs is H. canis. The objective of this review was to detail some aspects of canine hepatozoonosis, caused by H. canis, and the main points of its biology, transmission, pathogenicity, symptoms, epidemiology and diagnostic methods, with emphasis on research developed in Brazil.O gênero Hepatozoon compreende centenas de espécies que infectam aves, répteis, anfíbios e mamíferos, em todos os continentes de clima tropical e subtropical. No cão doméstico duas espécies são descritas, H. canis e H. americanum; a primeira presente na Europa, Ásia, África, América do Sul e nos Estados Unidos da América do Norte (EUA, e a segunda, diagnosticada até o momento somente nos EUA. No Brasil, a espécie que infecta o cão foi caracterizada como H. canis. Esta revisão objetiva detalhar alguns aspectos da hepatozoose canina, causada pelo H. canis e principais pontos de biologia, transmissão, patogenia e sintomas, epidemiologia e métodos de diagnóstico, enfatizando as pesquisas desenvolvidas no Brasil.

  17. Performance evaluation of canny edge detection on a tiled multicore architecture

    Science.gov (United States)

    Brethorst, Andrew Z.; Desai, Nehal; Enright, Douglas P.; Scrofano, Ronald

    2011-01-01

    In the last few years, a variety of multicore architectures have been used to parallelize image processing applications. In this paper, we focus on assessing the parallel speed-ups of different Canny edge detection parallelization strategies on the Tile64, a tiled multicore architecture developed by the Tilera Corporation. Included in these strategies are different ways Canny edge detection can be parallelized, as well as differences in data management. The two parallelization strategies examined were loop-level parallelism and domain decomposition. Loop-level parallelism is achieved through the use of OpenMP,1 and it is capable of parallelization across the range of values over which a loop iterates. Domain decomposition is the process of breaking down an image into subimages, where each subimage is processed independently, in parallel. The results of the two strategies show that for the same number of threads, programmer implemented, domain decomposition exhibits higher speed-ups than the compiler managed, loop-level parallelism implemented with OpenMP.

  18. Rosa canina as an adjunctive treatment of asthma: A hypothesis

    Directory of Open Access Journals (Sweden)

    Samin Hamidi

    2015-01-01

    Full Text Available Asthma is one of the most common chronic disorders and about 7% of the US population suffers from asthma. Initial response to allergy is associated with mediators like histamine, prostaglandin (PG D2 and leukotriene (LT C4. In asthmatic patients, 5-lipo-oxygenase (5-LO pathway produces more LTC4 than the healthy people. Also, pro-inflammatory factors like interleukin (IL-1, IL-6 and Tumor Necrosis Factor (TNF-α play a remarkable role in bronchoconstriction. The common asthma medications are associated with a number of unwanted side effects, especially throughout long term treatment. Herbal medication is an alternative treatment for asthma and the plants are rich sources of antioxidants that intensively reduce the activity of free radicals. Among several herbs, Rosa canina (RC is a potent anti-inflammatory remedy which contains a number of well-known antioxidants including vitamin C, quercetin, hesperidin, rutin and some other therapeutic compounds. The aim of this study was to review the scientific evidences supporting the probable influence of Rosa canina on asthma.Keywords: Asthma; Rosa canina; Anti-inflammatory

  19. The help-seeking behaviour of dogs (Canis familiaris)

    OpenAIRE

    Brodd, Louise

    2014-01-01

    During domestication, the dog( Canis familiaris), have become skilful in understanding human communication and also in communicating with humans. The wolf ( Canis lupus), is not as skilled with this interspecific communication. When dogs are faced with an unsolvable problem, they seek help from human by e.g. gazing at them. This behaviour has been studied and both age and breed group differences have been showed. In this study, we presented dogs with a task that consisted of a solvable and un...

  20. Rose hip (Rosa canina L): A functional food perspective

    OpenAIRE

    Cui Fan; Callen Pacier; Danik M. Martirosyan

    2014-01-01

    Rose hip (Rosa canina L.) is the pseudo-fruit of the rose plant, which is widely known as a valuable source of polyphenols and vitamin C. Both in vivo and in vitro studies have demonstrated that this fruit exhibits anti-inflammatory, antioxidant, and antiobesogenic activities. The health benefits of Rose hip (RH) have been attributed to its wide range of bioactive compounds including the anti-inflammatory galactolipid: (2S)-1,2-di-O-[(9Z,12Z,15Z)-octadeca-9,12,15-trienoyl]-3-O-β-D gala...

  1. Phenolic profile of wild fruits of Rosa canina SL. from Northeast Portugal

    OpenAIRE

    Guimarães, Rafaela; Barros, Lillian; Filipa S. Reis; Dueñas, Montserrat; Carvalho, Ana Maria; Santos-Buelga, Celestino; Queiroz, Maria João R. P.; Ferreira, Isabel C.F.R.

    2013-01-01

    Plant polyphenols are a wide group of secondary metabolites and are a common component of our diet. Flavonoids represent the most common and widely distributed group of plant phenolics, and can be further broken into classes including flavones, flavonols, flavanones, flavanols, anthocyanins and isoflavonoids. Different classes of bioactive constituents are present in Rosa canina, including phenolic compounds. Rosa canina fruits can be eaten raw as snacks and possess prophylactic a...

  2. Bioactive compounds and antioxidant activity of Rosa canina L. biotypes from spontaneous flora of Transylvania

    OpenAIRE

    Roman, Ioana; Stănilă, Andreea; Sorin STĂNILĂ

    2013-01-01

    Background The theoretical, but especially the practical values of identifying the biochemical compounds from the Rosa canina L. fruits are of present interest, this aspect being illustrated by the numerous researches. It was reported that the Rosa canina L. fruit, with its high ascorbic acid, phenolics and flavonoids contents, have antioxidant, antimutagenic and anticarcinogenic effects. This study was performed on order to evaluate the amount of the main phytochemicals (vitamin C, total pol...

  3. Rose hip (Rosa canina L: A functional food perspective

    Directory of Open Access Journals (Sweden)

    Cui Fan

    2014-12-01

    Full Text Available Rose hip (Rosa canina L. is the pseudo-fruit of the rose plant, which is widely known as a valuable source of polyphenols and vitamin C. Both in vivo and in vitro studies have demonstrated that this fruit exhibits anti-inflammatory, antioxidant, and antiobesogenic activities. The health benefits of Rose hip (RH have been attributed to its wide range of bioactive compounds including the anti-inflammatory galactolipid: (2S-1,2-di-O-[(9Z,12Z,15Z-octadeca-9,12,15-trienoyl]-3-O-β-D galactopyranosyl glycerol (GOPO, vitamin C, phenolics, lycopene, lutein, zeaxanthin, and other carotenoids. As cyclooxygenase inhibitors, RH compounds may reduce the risk of cancer, heart disease, and various inflammatory conditions. The aim of this review is to present an overview of the functional, medical, and physiological properties of RH.

  4. Color canals modification with canny edge detection and morphological reconstruction for cell nucleus segmentation and area measurement in normal Pap smear images

    Science.gov (United States)

    Riana, Dwiza; Dewi, Dyah Ekashanti Octorina; Widyantoro, Dwi H.; Mengko, Tati Latifah R.

    2014-03-01

    This paper presents a cell nucleus segmentation and area measurement of Pap smear images by means of modification of color canals with Canny edge detection and morphological reconstruction methods. Cell nucleus characterization plays an important role for classifying the degree of abnormality in cervical cancer. The aim of this work is to find the matched measurement method with the manual nucleus area measurement. In this work, we utilized pap smear single cell images from Herlev data bank in RGB mode. The cell images were selected from 90 normal class subjects that include: Normal Superficial, Normal Intermediate, and Normal Columnar classes. The nucleus of each cell image was cropped manually to localize from the cytoplasm. The color canals modification was performed on each cropped nucleus image by, first, separating each R, G, B, and grayscale canals, then implementing addition operation based on color canals (R+G+B, R+G, R+B, G+B, and grayscale). The Canny edge detection was applied on those modifications resulting in binary edge images. The nucleus segmentation was implemented on the edge images by performing region filling based on morphological reconstruction. The area property was calculated based on the segmented nucleus area. The nucleus area from the proposed method was verified to the existing manual measurement (ground truth) of the Herlev data bank. Based on thorough observation upon the selected color canals and Canny edge detection. It can be concluded that Canny edge detection with R+G+B canal is the most significant for all Normal classes (r 0,305, p-value 0.05). While for Normal Superficial and Normal Intermediate, Canny edge detection is significant for all RGB modifications with (r 0.414 - 0.817 range, , p-value 0.05), and for Normal Columnar, Canny edge detection is significant for R+B canal (r 0.505, p-value 0.05).

  5. AVALIAÇÃO DE INICIADORES E PROTOCOLO PARA O DIAGNÓSTICO DA PANCITOPENIA TROPICAL CANINA POR PCR

    Directory of Open Access Journals (Sweden)

    Daniel C. L. Linhares

    2006-10-01

    Full Text Available Este trabalho foi desenvolvido com o objetivo de padronizar um protocolo para a reação em cadeia da polimerase (PCR e selecionar oligonucleotídeos iniciadores para a detecção específica de Ehrlichia canis, em uma única etapa de reação. Inicialmente foram obtidas seqüências depositadas no Genbank, referentes ao gene que codifica o 16S rRNA das espécies E. canis (número de acesso = AF162860, E. ewingii (U96436, E. platys (AF1567844, E. chaffeensis, (U86665, E. phagocytophila genogrupo (U02521, E. bovis (AF294789 e E. risticii (M21290, as quais foram submetidas ao alinhamento genético para a construção dos iniciadores. Do alinhamento foi selecionado, a partir de uma região semiconservada, um iniciador específico para E. canis, designado EBR1 (5’-cctctggctataggaaattg- 3’ e, de uma região conservada, um iniciador genérico EBR5 (5’-ggagtgcttaacgcgttag- 3’. Paralelamente foram obtidas amostras de sangue de dez cães que apresentavam infecção aguda por E. canis, confirmado pela presença de mórulas intracitoplasmáticas, características da riquétsia, em células mononucleares sangüíneas. O DNA genômico extraído dessas amostras foi utilizado para a avaliação da reação de PCR, empregando-se um protocolo adaptado de outros autores e o par de oligos EBR1/EBR5, selecionado neste trabalho. A reação de PCR apresentou resultados positivos para os 10 isolados de E. canis, amplificando o fragmento esperado de 765 pares de bases do gene 16S rRNA. Resultados negativos verificados nas reações de PCR para amostras de DNA genômico de Babesia canis, Hepatozoon canis, Haemobartonella sp., Trypanosoma evansi e do hospedeiro (Canis familiaris livre de infecção indicaram a segurança do método quanto à especificidade para a discriminação de E. canis. PALAVRAS-CHAVE: Cães, Ehrlichia canis, erliquiose canina, hemoparasitose, reação em cadeia da polimerase

  6. Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

    Directory of Open Access Journals (Sweden)

    Llanos Mariana

    2010-10-01

    Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.

  7. Genetic analysis of prostatic diseases in canis familiaris

    OpenAIRE

    Magalhães, Joana Fernandes da Silva

    2014-01-01

    Dissertação de Mestrado em Genética Molecular Comparativa e Tecnológica A glândula prostática faz parte do sistema reprodutor masculino e pode ser afectada por várias condições incluindo a hiperplasia prostática benigna (HPB), o cancro da próstata (CaP), a prostatite e quistos. 0 cão (Canis familiaris) é considerado um bom modelo animal para o estudo destas doenças porque, para além das semelhanças morfológicas e funcionais entre as glândulas prostáticas do homem e do cão, estes animais de...

  8. Canine atopic dermatitis / Dermatite atópica canina

    Directory of Open Access Journals (Sweden)

    Thalita da Costa Teles

    2008-08-01

    Full Text Available Canine Atopic Dermatitis is a skin disease of genetic origin. The affected dog becomes sensible to antigens presents in the environment, developing a severe alergic, pruriginous reaction, which intervenes in the quality of life of the patient. Because of the genetic character, that is an illness that in most of the times has no cure, just control. The treatment in general is lifetime. Thus, some used drugs, for example the corticosteroides, might cause collateral effects when used for a long time, and might decrease the lifetime of the animals. By this way, the owner of the dog with atopia, must know about the complications of the disease, and occasional return of the clinical signs during the period of treatment. Therefore, this article has an objective of a review about Canine Atopic Dermatitis that is an increasing problem in the small animal practice.A Dermatite Atópica Canina é uma dermatopatia de origem genética. Os cães acometidos tornam-se sensíveis aos antígenos presentes no meio ambiente, desenvolvendo grave reação alérgica, pruriginosa, que interferem na qualidade de vida do paciente. Devido ao seu caráter genético, esta é uma doença que na maioria das vezes não tem cura, apenas controle. O tratamento em geral é vitalício. Assim sendo, algumas drogas utilizadas, a exemplo dos corticosteróides, podem causar efeitos colaterais que em longo prazo, são capazes de diminuir o período de vida do animal. Desta maneira, o proprietário do cão portador de atopia, precisa ser esclarecido em relação às complicações e provável recidiva dos sinais clínicos, durante o período de tratamento. Portanto, presente artigo tem como objetivo uma revisão sobre Dermatite Atópica Canina, que está se tornando um problema crescente na clínica de pequenos animais.

  9. Thuya occidentalis CH12 como tratamento alternativo da papilomatose canina

    Directory of Open Access Journals (Sweden)

    F.F. QUEIROZ

    2015-01-01

    Full Text Available RESUMO A papilomatose é uma doença de natureza crônica e pode causar tumores epiteliais e na mucosa. Não possui predileção por sexo, raça ou idade, mas comumente aparece em animais jovens. As lesões papilares ocorrem principalmente na mucosa bucal, nos lábios, língua e da faringe, além destes, também são encontradas na forma ocular e cutânea. Este estudo teve como objetivo relatar a eficácia da Thuya occidentalis CH12, uma medicação homeopática de uso comum, no tratamento de cães com papilomatose. Os resultados positivos puderam ser vistos, em alguns casos, já na primeira semana do tratamento, em outros, após vinte dias, e o desaparecimento total das lesões, na maioria dos casos, ocorreu com quinze dias. Alicerçada no princípio da similitude, a homeopatia apóia-se na observação experimental de que toda substância capaz de provocar determinados sintomas em uma pessoa sadia, é capaz de curar estes mesmos sintomas em uma pessoa enferma. A Thuya occidentalis provou ser eficiente contra lesões de papilomavírus canina, e apresentou resultados rápidos e com um valor econômico acessível.

  10. Comprehension of human communicative signs in pet dogs (Canis familiaris).

    Science.gov (United States)

    Soproni, K; Miklósi, A; Topál, J; Csányi, V

    2001-06-01

    On the basis of a study by D. J. Povinelli, D. T. Bierschwale, and C. G. Cech (1999), the performance of family dogs (Canis familiaris) was examined in a 2-way food choice task in which 4 types of directional cues were given by the experimenter: pointing and gazing, head-nodding ("at target"), head turning above the correct container ("above target"), and glancing only ("eyes only"). The results showed that the performance of the dogs resembled more closely that of the children in D. J. Povinelli et al.'s study, in contrast to the chimpanzees' performance in the same study. It seems that dogs, like children, interpret the test situation as being a form of communication. The hypothesis is that this similarity is attributable to the social experience and acquired social routines in dogs because they spend more time in close contact with humans than apes do, and as a result dogs are probably more experienced in the recognition of human gestures. PMID:11459158

  11. Mating System of Free-Ranging Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    S. K. Pal

    2011-01-01

    Full Text Available Fourteen females belonging to five groups were selected for the study of mating system in free-ranging domestic dogs (Canis familiaris All the matings occurred between August and December with a peak in late monsoon months (September to November. Both males and females differed in their degree of attractiveness to the opposite sex. The duration of courting association increased with the number of courting males in an association. The females exhibited selectivity by readily permitting some males to mate and avoiding, or even attacking others, if they attempted to mount. Frequency of mounting in courting association increased with the number of males present. There was a positive correlation between the duration of courting association and the frequency of mounting. The young adult males were more likely to copulate successfully than the old adult males. There was a negative correlation between the number of males present in an association and the number of successful copulations. In this study, six types of mating (monogamy, polygyny, promiscuity, polyandry, opportunity and rape were recorded. Mean (±S.E. duration of copulatory ties was 25.65 (±1.43 min. Several natural factors influencing the duration of copulatory ties were identified.

  12. Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.)

    DEFF Research Database (Denmark)

    Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise;

    2011-01-01

    A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis...... and mainly to involve infiltration of the synovial membrane by macrophages. Therefore, the immunomodulatory effect of standardized rose hip powder of Rosa canina L. was investigated and active principles isolated using the Mono Mac 6 cell line as a model for human macrophages. Treatment of Mono Mac 6 cells...... triterpene acids; oleanolic acid, betulinic acid and ursolic acid (IC(50) 21 +/- 6 microm). Further studies revealed that only oleanolic acid and ursolic acid, but not betulinic acid, could inhibit the lipopolysaccharide induced interleukin-6 release from Mono Mac 6 cells when tested separately. Combination...

  13. Rosa canina Extracts Have Antiproliferative and Antioxidant Effects on Caco-2 Human Colon Cancer

    Science.gov (United States)

    Jiménez, Sandra; Gascón, Sonia; Luquin, Asunción; Laguna, Mariano; Ancin-Azpilicueta, Carmen; Rodríguez-Yoldi, María Jesús

    2016-01-01

    The in vitro antiproliferative and antioxidant effects of different fractions of Rosa canina hips on human colon cancer cell lines (Caco-2) was studied. The compounds tested were total extract (fraction 1), vitamin C (fraction 2), neutral polyphenols (fraction 3) and acidic polyphenols (fraction 4). All the extracts showed high cytotoxicity after 72 h, both low and high concentrations. The flow cytometric analysis revealed that all the fractions produce disturbances in the cell cycle resulting in a concomitant cell death by an apoptotic pathway. Changes in the redox status of Caco-2 cells in response to Rosa canina hips were determined. Cells were exposed to hydrogen peroxide in presence of plant fractions and the production of Reactive Oxygen Species (ROS) was significantly decreased. Therefore, our data demonstrate that rosehip extracts are a powerful antioxidant that produces an antiproliferative effect in Caco-2 cells. Therefore, these results predict a promising future for Rosa canina as a therapeutic agent. Thus, this natural plant could be an effective component of functional foods addressed towards colorectal carcinoma. PMID:27467555

  14. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758 SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758 SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758 sometidas a cesárea

    Directory of Open Access Journals (Sweden)

    Diogo José Cardilli

    2009-12-01

    Full Text Available

    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias após. O método de radioimunoensaio foi utilizado para a realização da dosagem do cortisol sérico (nos períodos já descritos. Realizou-se a análise estatística por meio dos testes t e Tukey. O teor de cortisol sérico apresentou diferença (p< 0,05 no dia da cesariana (6,83 µg/dL, porém não diferiu (p> 0,05 nos dias subsequentes (1,82 µg/dL, 24 horas após; 1,38 µg/dL, 48 horas após; 1,48 µg/dL dez dias após. Os valores médios do grupo controle foram 3,43, 2,01, 3,59 e 1,72 µg/dL, após o parto, 24, 48 horas e dez dias após, respectivamente. O estresse devido à distocia elevou a liberação desse hormônio, voltando à normalidade nos dias subsequentes, porém o estresse cirúrgico não promoveu aumento na liberação de cortisol em cadelas submetidas à cesariana. Os animais do grupo controle apresentaram teores séricos de cortisol, nos devidos períodos, compatíveis com os citados pela literatura.

    PALAVRAS-CHAVES: Cadelas, cesariana, cortisol.

    Bitches submitted to caesarian section, for being in a physiological different situation, can present alterations to adapt to this new stress condition. Into possible alterations are cortisol levels during per partum period. So, the objectives of this study was to quantify seric cortisol of bitches submitted to caesarian section in partum and postpartum period (in the day of the partum or surgery , 24, 48 hours and 10 days later. The reserved serum was used to realization of cortisol measure by radioimmunoassay (on already described periods. The statistics analyzes were made by t test and Tukey. The cortisol levels presented difference (p< 0.05 in the dog of caesarian section (6.83 µg/dL but this didn’t differ (p> 0.05 on subsequent days (1.82 µg/dL, 24 hours later; 1.38 µg/dL, 48 hour later; 1.48 µg/dL, 10 days later. The middle values of control group were 3.43, 2.01, 3.59 e 1.72 µg/dL, in partum day, 24 hours later, 48 hours later and 10 days later. The stress because partum dystocic induced to liberation of cortisol, normalizing in subsequent days, but don’t have variation after cesarian (surgical stress don’t induced bigger liberation of cortisol or partum natural, composed compatible with the one found in the literature.
    KEY WORDS: Bitches, caesarian section, cortisol.
    Perras sometidas a cesárea por estar en situación distinta de la fisiológica, pueden presentar alteraciones séricas para se adaptaren a esa nueva condición de estrés. Una de las posibles alteraciones, es la concentración de cortisol durante el período peri-parto. Siendo así, el objetivo de ese estudio fue cuantificar los niveles séricos del cortisol en perras sometidas a cesárea en la fase de parto y posparto en la fase de parto y posparto (en el día del acto quirúrgico o parto, 24h, 48h y 10 días después. El método de radioinmunoensayo fue utilizado para la realización del dosaje de cortisol sérico (en los períodos ya descritos. La evaluación estadística fue realizada por medio de los testes t y Tukey. El nivel de cortisol sérico presentó diferencia (p< 0,05 en el día de la cesárea (6,83 µg/dL, pero no hubo diferencia estadística (p> 0,05 en los días consecutivos (1,82 µg/dL, 24 horas después; 1,38 µg/dL, 48 horas después; 1,48 µg/dL 10 días después. Los niveles medios del grupo control fueron 3,43, 2,01, 3,59 y 1,72 µg/dL, después del parto, 24, 48 horas y 10 días después, respectivamente. El estrés debido a la distocia elevó la liberación de esa hormona, que volvió a la normalidad en los días siguientes, pero el estrés quirúrgico no promovió aumento en la liberación de cortisol en perras sometidas a cesárea, y los animales del grupo control presentaron niveles séricos de cortisol, en los debidos períodos, de acuerdo con los descritos por la literatura.

  15. TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758) SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758) SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758) sometidas a cesárea

    OpenAIRE

    Diogo José Cardilli; Patrícia Rotta Lopes; Gilson Hélio Toniollo; Valeska Rodrigues; João Ademir de Oliveira

    2009-01-01

    Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias ap...

  16. Hepatite infecciosa canina: 62 casos Infectious canine hepatitis: 62 cases

    Directory of Open Access Journals (Sweden)

    Maria A. Inkelmann

    2007-08-01

    Full Text Available Os protocolos de necropsias realizadas em 5.361 cães durante um período de 43 anos (1964-2006 foram revisados em busca de casos de hepatite infecciosa canina (HIC e sessenta e dois (1,2% casos foram encontrados. A maioria dos 62 cães afetados tinha dois anos de idade ou menos (91,9%. Os sinais clínicos foram anotados nos protocolos de necropsia de 45 cães afetados por HIC e incluíam anorexia (55,6%, apatia (35,6%, diarréia (35,6%, freqüentemente com sangue (43,8% dos casos de diarréia, distúrbios neurológicos (33,3%, vômito (26,7%, petéquias e equimoses nas membranas mucosas e/ou pele (24,4%, hipotermia (20,0%, dor abdominal (15,6%, icterícia (13,3%, aumento de volume e congestão das tonsilas (11,1%, febre (11,1% e ascite (6,7%. A duração do curso clínico variou de poucas horas a 15 dias. Os principais achados de necropsia incluíram alterações hepáticas (87,1%, linfonodos edematosos, congestos e hemorrágicos (51,6%, líquido sanguinolento, líquido claro ou sangue na cavidade abdominal (35,5%, víbices, sufusões e petéquias sobre a pleura visceral (27,4% e superfície serosa das vísceras gastrintestinais (24,2%. Em 12,9% dos casos a serosa do intestino tinha aspecto granular. Hemorragias cerebrais nas leptomeninges e na substância do encéfalo foram observadas em 9,7% dos casos. As alterações hepáticas macroscópicas incluíam fígados moderadamente aumentados de volume, mais friáveis, com acentuação do padrão lobular, congestos e com múltiplos focos de necrose pálidos ou hemorrágicos. Películas e filamentos de fibrina cobriam a superfície hepática em 20,4% dos casos e em 27,8% dos casos a parede da vesícula biliar estava espessada por edema. Necrose hepática zonal ou aleatória (93,5% dos casos associada a corpúsculos de inclusão intranucleares foi a lesão histológica mais regularmente encontrada. Os corpúsculos de inclusão intranucleares ocorreram no fígado em todos os casos e esse foi o crit

  17. Neuropatologia da cinomose canina: 70 casos (2005-2008

    Directory of Open Access Journals (Sweden)

    Marcia C. Silva

    2009-08-01

    Full Text Available Este estudo teve como objetivo realizar uma investigação anátomo-patológica detalhada das lesões e sua distribuição no sistema nervoso central (SNC de cães com cinomose. Foram avaliadas secções padronizadas do encéfalo e da medula espinhal de 70 cães. Os casos foram agrupados de acordo com a idade dos cães e classificados conforme a evolução das lesões. Os resultados permitem concluir que: (1 encefalomielite induzida pelo vírus da cinomose canina é mais prevalente em filhotes e adultos; (2 lesões macroscópicas no SNC ocorrem com baixa freqüência; (3 o encéfalo é mais acometido do que a medula espinhal; (4 as cinco regiões anatômicas mais afetadas do encéfalo são, em ordem decrescente de freqüência, o cerebelo, o diencéfalo, o lobo frontal, a ponte e o mesencéfalo; (5 a região anatômica mais afetada da medula espinhal é o segmento cervical cranial (C1-C5; (6 lesões subagudas e crônicas são mais comuns do que lesões agudas; (7 desmielinização é a lesão mais prevalente e ocorre principalmente no cerebelo, na ponte e no diencéfalo, quase sempre acompanhada de astrogliose e inflamação não-supurativa; (8 na maior parte dos casos em que há astrogliose, observam-se astrócitos gemistocíticos, freqüentemente com formação de sincícios; (9 leptomeningite não-supurativa, malacia e necrose cortical laminar são lesões relativamente freqüentes no encéfalo, mas não na medula espinhal; (10 corpúsculos de inclusão no encéfalo são muito comuns, ocorrem principalmente em astrócitos e com freqüência menor em neurônios; no entanto, independentemente da célula afetada, são vistos predominantemente no núcleo; (11 uma classificação da encefalite na cinomose com base em síndromes clínicas relacionadas com a idade do cão é imprecisa.The current study was performed to determine the pathology and distribution of lesions in the central nervous system (CNS of 70 dogs naturally affected by canine

  18. Breed Differences in Domestic Dogs' (Canis familiaris) Comprehension of Human Communicative Signals

    OpenAIRE

    Wobber, Victoria Elizabeth; Wrangham, Richard W.; Hare, Brian; Koler-Matznick, Janice; Tomasello, Michael

    2009-01-01

    Recent research suggests that some human-like social skills evolved in dogs (Canis familiaris) during domestication as an incidental by-product of selection for “tame” forms of behavior. It is still possible, however, that the social skills of certain dog breeds came under direct selection that led to further increases in social problem solving ability. To test this hypothesis, different breeds of domestic dogs were compared for their ability to use various human communicative behaviors to fi...

  19. Insight into the Genetic Basis of Craniofacial Morphological Variation in the Domestic Dog, Canis familiaris

    OpenAIRE

    Rizk, Oliver Torres

    2012-01-01

    The domestic dog, Canis familiaris, presents a unique opportunity to identify and study the relationship between genotype and phenotype. Over the approximately 15,000 years since its domestication from the gray wolf, Canis lupus, the dog has undergone intense artificial selection for a variety of functional and aesthetic forms, resulting in hundreds of modern breeds that exhibit a wide range of behavior and morphology. Restrictive breeding histories have rendered each breed as a distinct ge...

  20. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    OpenAIRE

    Courtney Hofman; Torben Rick

    2014-01-01

    Domesticated dogs (Canis familiaris) are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial charact...

  1. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    OpenAIRE

    Manuel Graziani

    2014-01-01

    Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazi...

  2. Interactions between jaw-muscle recruitment and jaw-joint forces in Canis familiaris.

    OpenAIRE

    Dessem, D

    1989-01-01

    Electromyographic activity from the jaw-adductor muscles was recorded during mastication and bone crushing in domestic dogs (Canis familiaris). During mastication, balancing-side temporalis electromyographic activity was much less than that of the working side while masseter muscle electromyographic activities were of similar amplitude. Despite the large bite forces that were produced during bone crushing, balancing-side masseter and temporalis electromyographic activities were always smaller...

  3. Forest fragmentation is associated with primary brood sex ratio in the treecreeper (Certhia familiaris).

    OpenAIRE

    Suorsa, Petri; Helle, Heikki; Huhta, Esa; Jäntti, Ari; Nikula, Ari; Hakkarainen, Harri

    2003-01-01

    We studied the primary brood sex ratio of an old-growth forest passerine, the Eurasian treecreeper (Certhia familiaris), along a gradient of forest fragmentation. We found evidence that male nestlings were more costly to produce, since they suffered twofold higher nestling mortality and were larger in body size than females. Furthermore, the proportion of males in the brood was positively associated with the provisioning rate and the amount of food delivered to the nestlings. During the first...

  4. Estudio de biomarcadores de daño cardiopulmonar en la dirofilariosis canina por Dirofilaria immitis

    OpenAIRE

    Carretón, Elena

    2013-01-01

    Programa de doctorado: Clínica e investigación terapéutica. [ES] El objetivo de esta tesis fue evaluar serológicamente e inmunohistoquímicamente los biomarcadores de daño cardiopulmonar troponina T cardíaca, troponina I cardíaca, mioglobina y dímero-D en el diagnóstico, evaluación y pronóstico de la dirofilariosis cardiopulmonar canina, así como valorar su utilidad en la monitorización del paciente durante el tratamiento adulticida empleando el protocolo recomendado por la American Heartwo...

  5. Volatile Oil Constituents of Rosa canina L.: Quality As Affected by the Distillation Method

    Directory of Open Access Journals (Sweden)

    Karim Hosni

    2010-01-01

    Full Text Available The volatile oils of R. canina flowers were isolated by hydrodistillation (HD and traditional dry distillation (DD and analyzed by HRGC-FID and GC-MS. Compared to HD, DD at 50°C leads to the isolation of high quality oil which contains the highest content of oxygenated compounds (83%. The main components are the 2-phenethyl alcohol and eugenol. The percentage of the 2-phenethyl alcohol, a highly desirable component in rose oil, was significantly higher (58.4% in DD extract when compared to that of HD one (13.6%. As temperature increased (100°C during DD, the oil quality decreased. The most significant changes were observed in 2-phenethyl alcohol percentage (4.5%. Moreover, an increase of alkanes/alkenes and the production of furan derivatives were observed. So, DD at moderate temperature (50°C seemed more suitable to improve the volatile oil quality and hence, to make more value of R. canina.

  6. The Effects of a Standardized Herbal Remedy Made from a Subtype of Rosa canina in Patients with Osteoarthritis: A Double-Blind, Randomized, Placebo-Controlled Clinical Trial

    OpenAIRE

    Warholm, Odd; Skaar, Sigrun; Hedman, Ewa; Mølmen, Hanna Maria; Eik, Liv

    2003-01-01

    Background: A standardized rose-hip powder produced from the seeds and husks of fruit from a subtype of Rosa canina has been reported to inhibit leukocyte functions that cause cell injury in osteoarthritis.

  7. Aspectos imunoistoquímicos da hepatite infecciosa canina Immunohistochemical aspects of canine infectious hepatitis

    OpenAIRE

    Maria Andréia Inkelmann; Bruno Leite dos Anjos; Glaucia Denise Kommers; Rafael Almeida Fighera; Claudio Severo Lombardo de Barros

    2008-01-01

    Tecidos de 27 cães que morreram de hepatite infecciosa canina (HIC) foram avaliados por imunoistoquímica (IHQ) para detecção de antígeno de adenovírus canino tipo 1 (CAV-1), por meio de um anticorpo monoclonal. Os tecidos examinados incluíram fígado, rim, baço, linfonodos, tonsilas, pulmão, intestino delgado, encéfalo e medula óssea. Para cada órgão foram atribuídos graus crescentes (de leve a acentuada) de intensidade de imunomarcação. O antígeno de CAV-1 estava presente na maioria dos órgão...

  8. Estudio de micoplasmas y bacterias aerobias en la vagina craneal de hembras caninas clínicamente sanas

    OpenAIRE

    Stornelli, María Alejandra; Cerdá, Raúl Oscar; Gobello, Cristina; Arauz, María Sandra; Stanchi, Néstor Oscar

    2000-01-01

    La flora bacteriana presente en la vagina de hembras caninas posee un discutido rol en las enfermedades reproductivas de esta especie, por lo tanto y para contribuir al esclarecimiento de este aspecto, se realizó un estudio de los microorganismos vaginales en 33 perras sanas. Las muestras fueron tomadas mediante hisopo cubierto y procesadas siguiendo las marchas bacteriológicas indicadas para bacterias aerobias y Micoplasmas. Se aislaron microorganismos a partir de 30 muestras, siendo 3 negat...

  9. El Pennhip modificado y la sinfisiodesis juvenil pubiana como prevención de displasia de cadera canina en las Fuerzas Armadas

    Directory of Open Access Journals (Sweden)

    C. Sánchez Alonso

    2015-09-01

    Full Text Available Introducción: La displasia de cadera canina es la principal causa física de exclusión de los perros de los programas de adiestramiento en las Fuerzas Armadas y los Cuerpos y Fuerzas de Seguridad del Estado, es por ello importante realizar una criba temprana de esta patología. Objetivo: Determinar la eficacia del procedimiento del Penn-Hip modificado y la sinfisiodesis juvenil pubiana como método para prevenir el desarrollo de la displasia de cadera canina. Material y método: Estudio descriptivo y ambispectivo que compara el porcentaje de displasia de cadera canina en una cohorte prospectiva, tras la realización de un programa de screening y cirugía profiláctica, con los resultados de una cohorte histórica. Resultados: El porcentaje de displasia de cadera canina fue el doble en la cohorte histórica comparándola con la cohorte prospectiva tras la implantación del programa, siendo las diferencias estadísticamente significativas (OR: 2,20; IC 95%: 1,03-4,67. Conclusiones: Es necesaria la instauración de programas de screening y profilaxis de displasia de cadera canina, en el ámbito militar al mejorar la producción de perros aptos para el trabajo en las Fuerzas Armadas y en los Cuerpos y Fuerzas de Seguridad del Estado.

  10. The breakfast effect: dogs (Canis familiaris) search more accurately when they are less hungry.

    Science.gov (United States)

    Miller, Holly C; Bender, Charlotte

    2012-11-01

    We investigated whether the consumption of a morning meal (breakfast) by dogs (Canis familiaris) would affect search accuracy on a working memory task following the exertion of self-control. Dogs were tested either 30 or 90 min after consuming half of their daily resting energy requirements (RER). During testing dogs were initially required to sit still for 10 min before searching for hidden food in a visible displacement task. We found that 30 min following the consumption of breakfast, and 10 min after the behavioral inhibition task, dogs searched more accurately than they did in a fasted state. Similar differences were not observed when dogs were tested 90 min after meal consumption. This pattern of behavior suggests that breakfast enhanced search accuracy following a behavioral inhibition task by providing energy for cognitive processes, and that search accuracy decreased as a function of energy depletion. PMID:23032958

  11. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    Directory of Open Access Journals (Sweden)

    Courtney Hofman

    2014-05-01

    Full Text Available Domesticated dogs (Canis familiaris are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial characteristics. No cutmarks were found on the bones, but one of the mandibles was burned. The CA-SRI-2 dogs appear to have eaten high trophic marine foods similar to what humans consumed, documenting the close bond between dogs and humans on the Channel Islands and broader North American Pacific Coast.

  12. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-03-01

    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  13. Juvenile cellulitis in a puppy – case reportsCelulite juvenil canina – relato de casos

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Fonseca-Alves

    2012-08-01

    Full Text Available Juvenile cellulitis or juvenile sterile granulomatous lymphadenitis is a rare disorder that affects puppies between three weeks to six months years old. Clinical signs include alopecia, edema, papules, pustules and crusts especially on eyelids. Definitive diagnosis requires cytological and histological evaluation and early and aggressive therapy is recommended, once scars after recovery can be severe .The choice treatment is the high dose of corticosteroids use such as prednisone. Three animals of canine species were attended at the Veterinary Hospital Clinical Small Animal Service presenting different clinical signs. Hemogram, skin lesions and submandibular lymph nodes cytological examination was collected and analyzed. The treatment was instituted, using cephalexin (22mg/kg, twice daily up to control of secondary bacterial infection, and prednisone (2mg/kg, once a day until clinical resolution. Complete cure was obtained at the end of treatment. The aim of this work is to report three clinical cases of juvenile cellulitis in dogs. A celulite juvenil ou linfadenite granulomatosa estéril juvenil, é um distúrbio raro que acomete filhotes com idade entre três semanas a seis meses. Os sinais clínicos incluem alopecia, edema, pápulas, pústulas e crostas especialmente em pálpebras. O diagnóstico definitivo requer exames citológico e histopatológico e a terapia precoce e agressiva é preconizada, pois as cicatrizes após recuperação podem ser graves. O tratamento de escolha consiste no uso de altas doses dos glicocorticoides, como prednisona. Foram atendidos no Hospital Veterinário, três animais da espécie canina, apresentando sinais clínicos variados. Foram realizados hemograma, exame citológico das lesões de pele e dos linfonodos submandibulares. O tratamento foi instituído, utilizando-se cefalexina na dose de 22 mg/kg, duas vezes ao dia, até controle de infecção bacteriana secundária e prednisona na dose de 2mg/kg, uma vez

  14. El Pennhip modificado y la sinfisiodesis juvenil pubiana como prevención de displasia de cadera canina en las Fuerzas Armadas

    OpenAIRE

    C. Sánchez Alonso; A. García Luque; M.J. Chamorro Sancho; P. Arias Sanz; P. De Vega Terán; F. Crespo Castejón

    2015-01-01

    Introducción: La displasia de cadera canina es la principal causa física de exclusión de los perros de los programas de adiestramiento en las Fuerzas Armadas y los Cuerpos y Fuerzas de Seguridad del Estado, es por ello importante realizar una criba temprana de esta patología. Objetivo: Determinar la eficacia del procedimiento del Penn-Hip modificado y la sinfisiodesis juvenil pubiana como método para prevenir el desarrollo de la displasia de cadera canina. Material y método: Estudio descripti...

  15. Proyecciones de rabia canina en Argentina, Bolivia y Paraguay, usando series de tiempo

    Directory of Open Access Journals (Sweden)

    M. SCORTTI

    1997-01-01

    Full Text Available Se estudió el número de casos mensuales de rabia canina en Argentina (1971-1993, Bolivia (1987-1993 y Paraguay (1976-1993, a fin de identificar fluctuaciones regulares y predecir el comportamiento futuro de la rabia en dichos países. Los métodos empleados consistieron en análisis de series de tiempo, incluyendo el análisis armónico de Fourier y los modelos multiplicativos ARIMA-SARIMA de Box-Jenkins. Se evidenciaron ciclos en Argentina y Paraguay. La estacionalidad ocurrió a fines de invierno y primavera. Las recurrencias mostraron un período de aproximadamente cuatro años, pronosticándose la próxima alza para 1997Monthly prevalence of canine rabies in Argentina (1971-1993, Bolivia (1987-1993 and Paraguay (1976-1993 were analyzed to identify seasonal cycles of the disease. Moreover, data to forecast the evolution of rabies were studied. The time series analysis was employed. This included the Fourier Harmonie Analysis and Box-Jenkins ARIMA-SARIMA multiplicative models. Cycles were detected in Argentina and Paraguay. The seasonal cycles occurred at the end of winter and spring. Seasonal cycles were about every four years, and the next peak was estimated for 1997

  16. Evolution of sociality, diet, and craniodental anatomy in the subfamly caninae

    International Nuclear Information System (INIS)

    Social carnivores affect population parameters, ecology, behavior and speciation and extinction rates of their prey and other sympatric carnivores. Therefore, social carnivores may have influenced the evolution of the structure and organization of ancestral and modern mammal communities. Thus, it is important to identify what extinct carnivore species may have been social and to determine when, where and under which environmental contexts they evolved. The first step is to establish if there is an association between morphological traits, susceptible of being preserved in the fossil record, and differences in the degree of sociality of present day carnivores. The aim of this research was to establish if there is an association between variation in shape and variables related to mechanical properties of the skulls, and differences in sociality level, diet and sex in modern canids. The sample included 972 specimens of 33 canid species. We analyzed the shape of the lateral side of the cranium, zygomatic arch, dentary bone and mandibular corpus, as well as 20 variables related to mechanical properties of the skull. Results suggest that hypercarnivorous social canids have shapes and mechanical properties that are different from other modern canids. We found that morphological variation is not affected by sex. Results may be used to identify extinct caninae species that were social and hypercarnivorous. Results also suggest that the evolution of sociality is dependent on phylogenetic relationships and ecological context, particularly the abundance of large prey and the presence of sympatric carnivores.

  17. Aspectos moleculares del virus de la parvovirosis canina y sus implicaciones en la enfermedad

    Directory of Open Access Journals (Sweden)

    César A. Díaz R.

    2008-06-01

    Full Text Available El parvovirus canino tipo 2 (CPV-2 es el agente causal de una enfermedad infecto-contagiosa que produce una gastroenteritis aguda hemorrágica que afecta a caninos jóvenes. El CPV-2 se adaptó a la especie canina por mutación del virus de la Panleucopenia felina (FPV luego de su paso por animales silvestres como el hurón y los zorros. La alta variabilidad de la proteína viral 2 (VP2 es la causa principal del amplio rango de hospedadores y de las reacciones cruzadas entre las variantes. En la actualidad, la secuenciación de esta proteína ha permitido identificar tres variantes del virus conocidas como 2a, 2b y 2c que conviven en el mundo con diferencias en tropismo celular, infecciocidad y patogenicidad. El virus ssADN ha presentado una gran variación génica en cortos períodos de tiempo lo que indica un alto grado de selección por evolución sólo comparable con virus RN, esta alta variabilidad no se ha aclarado totalmente. El empleo de las técnicas moleculares permitirá diferenciar entre cepas vacunales y de campo, tanto como contar con técnicas diagnósticas confiables y específicas.

  18. Fluctuating feather asymmetry in relation to corticosterone levels is sex-dependent in Eurasian treecreeper (Certhia familiaris) nestlings

    OpenAIRE

    Helle, Samuli; Suorsa, Petri; Huhta, Esa; Hakkarainen, Harri

    2010-01-01

    Fluctuating asymmetry (FA) has been widely used as a stress-related phenotypic marker of developmental instability. However, previous studies relating FA to various stressful conditions have produced inconsistent results and we still lack quantitative individual-level evidence that high FA is related to stress in wild vertebrate species. We studied how baseline plasma levels of corticosterone predicted FA of wing and tail feathers in free-living Eurasian treecreeper (Certhia familiaris) nestl...

  19. Cooperation, leadership and numerical assessment of opponents in conflicts between groups of feral dogs (Canis lupus familiaris)

    OpenAIRE

    Bonanni, Roberto

    2009-01-01

    This thesis attempted to assess the adaptive value of the behaviour of feral dogs (Canis lupus familiaris) by using such species as a model for testing predictions based on evolutionary theories. In particular, the following topics concerning dogs’ behaviour were examined: intergroup agonistic behaviour in relation to numerical assessment of opponents, cooperative behaviour during intergroup conflicts and decision making processes during collective activity changes. The research focuse...

  20. Diagnóstico de la ehrlichiosis monocítica canina: una revisión actualizada

    OpenAIRE

    Roger Iván Rodríguez-Vivas; Manuel Emilio Bolio-González; Melina Maribel Ojeda-Chi

    2015-01-01

    La ehrlichiosis monocítica canina (EMC) es causada por la infección de una rickettsia denominada Ehrlichia canis; este microorganismo se reproduce solamente en el citoplasma de los monocitos sanguíneos y macrófagos tisulares. La EMC ha sido reportada en todo el mundo, pero las frecuencias más altas se reportan en las regiones tropicales y subtropicales. La EMC no siempre es reconocida clínicamente, pues es difícil de diagnosticar debido a que los signos clínicos son variables, a que se presen...

  1. Aplicaciones clínicas de los agonistas dopaminérgicos en reproducción canina

    OpenAIRE

    Gobello, Cristina

    2000-01-01

    Este artículo de actualización describe las principales indicaciones de los agonistas dopaminérgicos (AD) en reproducción canina y explica brevemente sus mecanismos de acción. Los AD son alcaloides de la ergotamina, derivados de síntesis de la ergolina que inhiben la secreción de prolactina regulando la acción dopaminérgica o la serotoninérgica. Los AD con los que se cuenta con mayor experiencia en medicina veterinaria de pequeños animales son la bromocriptina, la cabergolina y la metergolina...

  2. Diagnóstico por imagen de la articulación de la rodilla en la especie canina

    OpenAIRE

    Soler Laguía, Marta

    2003-01-01

    En la especie canina, la rodilla es la articulación que más frecuentemente presenta alteraciones, siendo las patologías de los ligamentos y meniscos las más comunes, asociadas a cambios degenerativos articulares secundarios. Para evaluar las estructuras que componen la rodilla y poder diagnosticar dichas alteraciones podemos emplear numerosas técnicas de diagnóstico por imagen como la artrografia, ecografía así como estudios de imagen por resonancia magnética (IRM). La artrografia de la rodil...

  3. Investigation of The Physiological Changes In (Rosa Canina L.) Plant Members Comprising and Not Creating The Gall

    OpenAIRE

    Özpınar, Hülya; Yalçın, İbrahim

    2013-01-01

    Chlorophyl a, Chlorophyl b, Carotenoid, total chloropyhl concentrations, Kl-a/Kl-b ratio, Total Chlorophyl/Carotenoid ratio, sugar and starch and total carbohydrate amounts, dry biomass changes and proline and sugar amounts interaction at fruit galls of Diplolepis mayri Schld. On Rosa canina L. were studied. We found that Kl-a, Kl-b, carotenoid concentrations increased but Kla/Kl-b ratio decreased and total chlorophyl/carotenoid ratio did not change with gall occurunce in leaves of galled pla...

  4. Comparative study of biological activities and phytochemical composition of two rose hips and their preserves: Rosa canina L. and Rosa arvensis Huds.

    Science.gov (United States)

    Nađpal, Jelena D; Lesjak, Marija M; Šibul, Filip S; Anačkov, Goran T; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N

    2016-02-01

    The aim of this study was to compare phenolic profile, vitamin C content, antioxidant, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of two Rosa species: renowned Rosa canina L. and unexplored Rosa arvensis Huds. The liquid chromatography-tandem mass spectrometry analysis of 45 phenolics resulted in quantification of 14 compounds, with quercitrin, gallic and protocatechuic acids as the most dominant. High antioxidant potential of R. canina and a moderate activity of R. arvensis extracts were determined through several assays. Purée of both species and methanol extract of air-dried R. canina hips showed some anti-inflammatory (cyclooxygenase-1 and 12-lipooxygense inhibition potency) activity. Purée of R. canina exerted cytotoxic activity only against the HeLa cell line among several others (HeLa, MCF7, HT-29 and MRC-5). The presented results support traditional use of rose hips and their fruit preserves as food with health and nutritional benefits. PMID:26304428

  5. Mielopatía Degenerativa canina: signos clínicos, diagnóstico y terapéutica (Canine degenerative myelopathy: clinical signs, diagnosis and therapy

    Directory of Open Access Journals (Sweden)

    Suraniti, A.P

    2011-08-01

    Full Text Available ResumenLa mielopatía degenerativa canina es una enfermedad neurológica progresiva autoinmune que afecta principalmente a caninos adultos de talla grande sin predilección de sexo.SummaryCanine degenerative myelopathy is a progressive neurological autoimmune disease that primarily affects large size adult dogs and no sex predilection.

  6. All types naive and canny

    OpenAIRE

    HEIFETZ , Aviad; Kets, Willemien

    2012-01-01

    This paper constructs a type space that contains all types with a finite depth of reasoning, as well as all types with an infinite depth of reasoning - in particular those types for whom finite-depth types are conceivable, or think that infnite-depth types are conceivable in the mind of other players, etcetera. We prove that this type space is uni- versal with respect to the class of type spaces that include types with a finite or infinite depth of reasoning. In particular, we show that it co...

  7. Criptococose canina: relato de caso Canine ocular cryptococcosis: a case report

    Directory of Open Access Journals (Sweden)

    C.E. Larsson

    2003-10-01

    Full Text Available Descreve-se, pela primeira vez no Brasil, um caso de criptococose canina com acometimento oftalmo e dermatopático, com diagnóstico intra-vitam, em animal da raça Pastor Alemão, fêmea, com 24 meses de vida, criado em São Paulo, em contacto com outros cinco cães assintomáticos, que havia se infectado pelo contato com dejetos de pombos (Columba livia. Evoluia há 90 dias, com quadro tegumentar e ósseo, sintomas e lesões características, sendo, ainda, detectada forma assintomática de coriorretinite, de início unilateral. O diagnóstico foi estabelecido pelos dados da anamnese, dos exames físico, dermatológico e complementares (radiográfico, cultivo micológico, histopatologia de pele tendo-se evidenciado e isolado cepa de Criptococcus neoformans var. neoformans. Após nove meses de terapia com itraconazol (9mg/kg/SID/VO houve involução total do quadro, sem qualquer efeito adverso à droga.A case of cryptococcosis with ocular and cutaneous involvement is reported by the first time in Brazil in a dog. A two-year-old female German Shepherd living in a hold house with other five healthy dogs was infected through the contact with pigeon (Columba livia feces. The illness started 90 days previously with cutaneous and bone involvement resulting in characteristic clinical signs and lesions, in addition to a initially unilateral asymptomatic chorioretinitis. The diagnosis was established based on anamnesis, physical and dermatologic examinations and complementary exams (radiographs, skin biopsy and histopathology and the isolation of a Cryptococcus neoformans var. neoformans strain was accomplished. There was a complete resolution of the disease after nine months of therapy using itraconazole (9mg/kg, q24h, PO and no side effect was observed.

  8. Patologias genitais associadas à leishmaniose visceral canina Genital pathologies associated with canine visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Vinícius Vasconcelos Gomes de Oliveira

    2012-09-01

    Full Text Available A leishmaniose visceral canina (LVC é uma doença parasitária crônica causada por protozoários pertencentes ao gênero Leishmania. No Brasil, a transmissão se dá, principalmente, pela ação hematófaga de insetos vetores pertencentes à subfamília Phlebotominae, particularmente, a espécie Lutzomyia longipalpis. Todavia, a trasmissão vertical e venérea da LVC está presente. Os principais sinais clínicos observados nos animais acometidos pela LVC são linfoadenomegalia, dermatopatias, hepatoesplenomegalia, onicogrifose e oftalmopatias, contudo quadros atípicos podem ser observados, inclusive com o envolvimento do sistema genital. Dessa forma, o objetivo deste artigo é realizar revisão sobre as principais patologias genitais em cães machos e fêmeas com leishmaniose visceral (LV.The canine visceral leishmaniasis (CanL is a chronic parasitic disease caused by protozoa belonging to the genus Leishmania. In Brazil, the transmission occurs mainly by the action of blood-sucking insects belonging to the subfamily Phlebotominae, particularly the Lutzomyia longipalpis species. However, the venereal and vertical transmission of the CanL is present. The main clinical signs observed in animals affected by the CanL are lymphadenopathy, skin diseases, hepatosplenomegaly, onychogryphosis and ophthalmopathy, however atypical manifestations can be observed, including the involvement of the genital system. Thus, the aim of this paper is to review on the major pathologies in genital male and female dogs with visceral leishmaniasis (VL.

  9. Can domestic dogs (Canis familiaris) use referential emotional expressions to locate hidden food?

    Science.gov (United States)

    Buttelmann, David; Tomasello, Michael

    2013-01-01

    Although many studies have investigated domestic dogs' (Canis familiaris) use of human communicative cues, little is known about their use of humans' emotional expressions. We conducted a study following the general paradigm of Repacholi in Dev Psychol 34:1017-1025, (1998) and tested four breeds of dogs in the laboratory and another breed in the open air. In our study, a human reacted emotionally (happy, neutral or disgust) to the hidden contents of two boxes, after which the dog was then allowed to choose one of the boxes. Dogs tested in the laboratory distinguished between the most distinct of the expressed emotions (Happy-Disgust condition) by choosing appropriately, but performed at chance level when the two emotions were less distinct (Happy-Neutral condition). The breed tested in the open air passed both conditions, but this breed's differing testing setup might have been responsible for their success. Although without meaningful emotional expressions, when given a choice, these subjects chose randomly, their performance did not differ from that in the experimental conditions. Based on the findings revealed in the laboratory, we suggest that some domestic dogs recognize both the directedness and the valence of some human emotional expressions. PMID:22960805

  10. Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands.

    Science.gov (United States)

    Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston

    2014-03-01

    Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history. PMID:23812648

  11. Effects of the Dog-Human Relationship on Problem-Solving Strategies in the Domestic Dog (Canis familiaris)

    OpenAIRE

    Cook, Amy

    2013-01-01

    Dogs (Canis familiaris) are strongly responsive to human influence in general, and they also readily form preferences for specific humans, yet these lines of inquiry have not often been combined. The goal of this dissertation was to advance a more specific theory regarding the nature of the dog-human bond - that it is one characterized by dependency - and to investigate whether such bonds would influence dogs to use social strategies to solve non-social problems.In Chapter 1, I describe the f...

  12. Effects of organohalogen pollutants on haematological and urine clinical-chemical parameters in Greenland sledge dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Kirkegaard, Maja;

    2008-01-01

    Seven West Greenland sledge dog bitches (Canis familiaris) and their three pups were fed 50-200 g of contaminated West Greenland minke whale (Balaenoptera acutorostrata) blubber, and in a control cohort eight sister bitches and their .ve pups were fed a similar amount pork fat. Blood plasma and...... control group, while glucose was signi.cantly highest (ANCOVA: po0:05) in the exposed group. Furthermore, the blood cholesterol levels indicate that exposure via the diet to marine mammal blubber has a preventive effect on the development of cardiovascular diseases. We therefore suggest that the...

  13. The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

    Science.gov (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

    2016-05-01

    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills. PMID:26742930

  14. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris).

    Science.gov (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X

    2016-01-01

    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  15. Aspectos imunoistoquímicos da hepatite infecciosa canina Immunohistochemical aspects of canine infectious hepatitis

    Directory of Open Access Journals (Sweden)

    Maria Andréia Inkelmann

    2008-12-01

    Full Text Available Tecidos de 27 cães que morreram de hepatite infecciosa canina (HIC foram avaliados por imunoistoquímica (IHQ para detecção de antígeno de adenovírus canino tipo 1 (CAV-1, por meio de um anticorpo monoclonal. Os tecidos examinados incluíram fígado, rim, baço, linfonodos, tonsilas, pulmão, intestino delgado, encéfalo e medula óssea. Para cada órgão foram atribuídos graus crescentes (de leve a acentuada de intensidade de imunomarcação. O antígeno de CAV-1 estava presente na maioria dos órgãos examinados, principalmente em células endoteliais. Relacionando o tempo de evolução clínica da HIC com a intensidade da imunomarcação, o maior número de casos com evolução clínica hiperaguda ou aguda coincidiu com a maior intensidade de marcação do antígeno viral. A IHQ demonstrou ser um teste adequado para a detecção do antígeno de CAV-1 e pode ser usado para o estudo da patogênese da doença.Tissues from 27 dogs died from infectious canine hepatitis (ICH were evaluated by immunohistochemestry (IHC for detection of canine adenovirus type 1 (CAV-1 antigen using a monoclonal antibody. Evaluated tissues included liver, kidney, spleen, lymph nodes, tonsils, lungs, small intestine, brain, and spinal cord. For each organ increasing degrees (from mild to marked of intensity of immune staining were ascribed. CAV-1 was detected in most of the evaluated organs, mainly in the endothelial cells. Considering the clinical course of ICH and the intensity of IHC staining, cases with acute and peracute courses had more marked staining. IHC proved to be a reliable test for CAV-1 antigen detection and can be used for pathogenesis studies on ICH either in the spontaneous and experimental disease.

  16. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.

  17. DETECCIÓN DE ANTICUERPOS ANTI-Leishmania (Trypanosomatidae EN POBLACIONES CANINAS DEL DEPARTAMENTO DE SUCRE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luís Enrique Paternina Tuirán

    2015-11-01

    Full Text Available RESUMENEl objetivo de la investigación fue determinar la prevalencia de anticuerpos anti-Leishmania en perros del departamento de Sucre, Colombia. Se analizaron 122 perros del área rural de los municipios de Ovejas, Sampués y Sincelejo, mediante la técnica de inmunofluorescencia indirecta (IFI. Anticuerpos anti-Leishmania fueron detectados en el 69,6 % (IC95 % = 61,1 – 78,2 de la población canina estudiada. En el municipio de Sincelejo la seropositividad fue del 72 % (IC95 % = 61,1 – 82,8, en el municipio de Sampués del 68,4 % (IC95 % = 52,3 – 84,5 y en el municipio de Ovejas del 55,5 % (IC95 % = 21,2 – 86,3. Los animales seropositivos fueron principalmente caninos jóvenes y adultos. El 17,6 % de los perros seropositivos mostró signos clínicos compatibles con leishmaniasis canina, entre los cuales la onicogrifosis, alopecia y caquexia fueron los más comunes. La alta frecuencia de caninos con anticuerpos a Leishmania detectada en el presente estudio, pone de manifiesto la hiperendemicidad de la leishmaniasis canina en esta zona del país, así como el alto riesgo de brotes epidémicos de la enfermedad.ABSTRACTThe aim of this survey was to determine prevalence of antibodies against Leishmania in dogs from Sucre, Colombia. We analyzed 122 dogs in rural areas from municipalities of Sampués, Ovejas and Sincelejo, by indirect immunofluorescence (IFA. Anti-Leishmania antibodies were detected in 69.6 % (95 % CI = 61.1 to 78.2 of the selected canine population. In the municipality of Sincelejo, Sampues and Ovejas, the seropositivities were 72 % (95 % CI = 61.1 to 82.8, 68.4 % (95 % CI = 52.3 to 84.5 and 55.5 % (95 % CI = 21.2 to 86.3 respectively. Seropositive animals were mainly young and adult dogs. The 17.6 % of seropositive dogs showed clinical signs compatible with canine leishmaniasis; onychogryphosis, alopecia and cachexia were the most common ones. The detected high frequency of canines with antibodies against Leishmania in the

  18. Factors genètics de la leishmaniosi canina: caracterització del Nramp1 com a gen candidat

    OpenAIRE

    Altet i Sanahujes, Laura

    2002-01-01

    Descripció del recurs: el 22 d'octubre de 2003 L'objectiu d'aquesta tesi és la recerca de gens candidats de resistència o susceptibilitat a leishmaniosi canina. Aquesta malaltia, que és endèmica en l'area mediterranea, és una zoonosi causada pel paràsit Leishmania infantum, on el gos és el principal reservori. A més, està guanyant molta importància en l'home, ja que ha esdevingut una de les coinfeccions principals en malalts del virus de la SIDA. El món dels gossos aporta un material molt ...

  19. Estudi de la resistència i la susceptibilitat genètica a la leishmaniosi canina

    OpenAIRE

    Sánchez i Robert, Elisenda

    2008-01-01

    Consultable des del TDX Descripció del recurs: el 8 octubre 2008 Títol obtingut de la portada digitalitzada La leishmaniosi canina és una zoonosi causada pel paràsit Leishmania infantum, sent el gos el principal reservori. És endèmica de la conca Mediterrània, de l'orient Mitjà i d'Amèrica del Sud arribant la prevalença de la infecció en aquestes zones al 67%. A més, és una malaltia en expansió ja que recentment s'han descrit casos als Estats Units i Regne Unit. L'objectiu d'aquesta ...

  20. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme

    2016-06-01

    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  1. The role of rose hip (Rosa canina L) powder in alleviating arthritis pain and inflammation – part II animal and human studies

    OpenAIRE

    Marstrand, Kristian

    2016-01-01

    Kristian Marstrand,1 Joan Campbell-Tofte2 1Department of Orthopaedic Surgery, Elverum Hospital, Elverum, Norway; 2Coordinating Research Unit, Frederiksberg University Hospital, Frederiksberg, Copenhagen, Denmark Abstract: Rosa canina fruits (often known as rose hip) have been used in herbal remedies since ancient times. On the basis of anecdotal reports about the effects of rose hip preparations on human health and citations to the same in ancient texts, in vitro and in vivo studies have bee...

  2. The role of rose hip (Rosa canina L) powder in alleviating arthritis pain and inflammation – part II animal and human studies

    OpenAIRE

    Marstr; De, K.; Campbell-Tofte J

    2016-01-01

    Kristian Marstrand,1 Joan Campbell-Tofte2 1Department of Orthopaedic Surgery, Elverum Hospital, Elverum, Norway; 2Coordinating Research Unit, Frederiksberg University Hospital, Frederiksberg, Copenhagen, Denmark Abstract: Rosa canina fruits (often known as rose hip) have been used in herbal remedies since ancient times. On the basis of anecdotal reports about the effects of rose hip preparations on human health and citations to the same in ancient texts, in vitro and in vivo studies have bee...

  3. AGLUTINACIÓN EN LÁTEX, ELISA Y HEMOAGLUTINACIÓN: ALTERNATIVAS PARA EL DIAGNÓSTICO DE LA PARVOVIROSIS CANINA EN HECES

    Directory of Open Access Journals (Sweden)

    Ramírez G. C.

    2005-12-01

    Full Text Available En vista de su alta morbilidad y letalidad, se han desarrollado varios métodos para el diagnóstico de la parvovirosis canina. Los más utilizados se basan en la detección de partículas virales excretadas en las heces durante la fase aguda de la enfermedad. Algunos requieren equipos especializados, lo que aumenta los costos y el tiempo de diagnóstico. Por esto, la simplificación de los métodos de diagnóstico con alta sensibilidad y especificidad es prioritaria. Este trabajo presenta el desarrollo de la técnica de aglutinación en látex para el diagnóstico de la parvovirosis canina en heces, comparada con un ELISA comercial y una hemoaglutinación. Sobre una población de 71 caninos con signos compatibles con parvovirosis canina, utilizando la prueba ELISA (SNAP® como referencia, se seleccionaron 21 caninos positivos. Empleando las muestras de materia fecal de los animales positivos se desarrollaron y compararon las pruebas de hemoaglutinación y aglutinación en látex. Se encontró una sensibili¬dad del 100% y una especificidad del 100% para aglutinación en látex y una sensibilidad del 95% y una especificidad del 100% para hemoaglutinación. Dada la sencillez de la prueba, los resultados obtenidos y sus costos, se recomienda la prueba de aglutinación en látex para el diagnóstico rápido y seguro de la parvovirosis canina.

  4. Extraction and Characterization of Phenolic Compounds from Rose Hip (Rosa canina L.) Using Liquid Chromatography Coupled with Electrospray Ionization - Mass Spectrometry

    OpenAIRE

    Stănilă, Andreea; Diaconeasa, Zoriţa; Roman, Ioana; Nicușor SIMA; Dănuț MĂNIUȚIU; Alin ROMAN; Rodica SIMA

    2015-01-01

    Wild berry are a rich of natural compounds which provide them high antioxidant potential. The compounds which provide them these proprieties are known to be vitamins, flavonoids, anthocyanins and phenolic acids. The aim of this study was to extract and characterize bioactive compounds from rose hip (Rosa canina L.) currently found in Romania. A qualitative high-performance liquid chromatography coupled with electrospray ionization mass spectrometric (ESI-MS) detection in positive ion mode has...

  5. Canine hypertrophic osteopathy associated with extra-thoracic lesions Osteopatia hipertrófica canina associada com lesões extratorácicas

    OpenAIRE

    Selwyn Arlington Headley; Eduardo Alcântara Ribeiro; Gustavo José Von G. dos Santos; Carlos Maia Bettini; Ewaldo de Mattos Júnior

    2005-01-01

    Canine hypertrophic osteopathy is described in a dog that presented extra-thoracic lesions, mainly in the liver. Hepatic lesions were characterized by necrosis, hemorrhage, severe hydropic degeneration of centrolobular hepatocytes, proliferation of epithelial cells of bile ducts, and mild biliary stasis. The disease syndrome was diagnosed based on clinical signs, radiological evaluation, and inspection of macerated bones.Osteopatia hipertrófica canina é descrita em um cão que apresentou lesõe...

  6. Familiarity-connected or stress-based contagious yawning in domestic dogs (Canis familiaris)? Some additional data.

    Science.gov (United States)

    Silva, Karine; Bessa, Joana; de Sousa, Liliana

    2013-11-01

    The present short note aimed at further exploring data from a recent study showing socially modulated auditory contagious yawning in domestic dogs (Canis familiaris). Two independent observers further extended the analysis of all video recordings made in the previous study and coded both the number of yawns performed by the dogs and the frequencies or durations of stress-related behaviors exhibited throughout the presentation of familiar and unfamiliar yawns. By showing no significant difference between conditions in the frequencies or durations of the coded behaviors, nor any association between the number of yawns and the frequencies or durations of stress-related behaviors, results raised doubt on the stress-induced yawn hypothesis, thus supporting social modulation. The exact mechanism underlying contagious yawning, however, needs further research. PMID:23982621

  7. Fluctuating feather asymmetry in relation to corticosterone levels is sex-dependent in Eurasian treecreeper (Certhia familiaris) nestlings

    Science.gov (United States)

    Helle, Samuli; Suorsa, Petri; Huhta, Esa; Hakkarainen, Harri

    2010-01-01

    Fluctuating asymmetry (FA) has been widely used as a stress-related phenotypic marker of developmental instability. However, previous studies relating FA to various stressful conditions have produced inconsistent results and we still lack quantitative individual-level evidence that high FA is related to stress in wild vertebrate species. We studied how baseline plasma levels of corticosterone predicted FA of wing and tail feathers in free-living Eurasian treecreeper (Certhia familiaris) nestlings. We found a sex-specific association between corticosterone levels and FA: high corticosterone levels were related to an increased FA in male but not in female nestlings. These results suggest that in treecreepers, FA may correlate with individual stress hormone levels, male developmental trajectory being potentially more sensitive to stress than that of the female. PMID:20129951

  8. Importance of social behaviour in eliciting A-not-B error in domestic dogs (Canis lupus familiaris) with “Unidentified Moving Object” (UMO) as partner

    OpenAIRE

    Compton, Anna Bjurgård

    2015-01-01

    Domestic dogs (Canis lupus familiaris) are highly sociable animals that are observed to be experts at interacting, understanding and cooperating with humans (Homo sapiens). Social behaviour is difficult to study due to the lack of full control over interactions, but is important for understanding and interacting effectively with dogs. Robots have recently been introduced into canine research as a tool to investigate dog social behaviour. Unidentified Moving Object (UMO) is a term to explain a...

  9. Primer registro de perro doméstico prehispánico (canis familiaris entre los grupos cazadores recolectores del humedal de Paraná inferior (Argentina

    Directory of Open Access Journals (Sweden)

    Alejandro Acosta

    2011-12-01

    Full Text Available The first reliable record of the dog (Canis familiaris recovered in a hunter gatherer site from the lower Paraná wetlands (Argentina is analyzed in this paper. We discuss several aspects related to the origin, chronology and types of interactions established between dogs and aboriginal groups in the context of scarce information currently available about their presence among hunter gatherer groups of Southern South America.

  10. Primer registro de perro doméstico prehispánico (canis familiaris) entre los grupos cazadores recolectores del humedal de Paraná inferior (Argentina)

    OpenAIRE

    Alejandro Acosta; Daniel Loponte; César García Esponda

    2011-01-01

    The first reliable record of the dog (Canis familiaris) recovered in a hunter gatherer site from the lower Paraná wetlands (Argentina) is analyzed in this paper. We discuss several aspects related to the origin, chronology and types of interactions established between dogs and aboriginal groups in the context of scarce information currently available about their presence among hunter gatherer groups of Southern South America.

  11. ESTUDIO PRELIMINAR DE LOS HALLAZGOS DE CANIS FAMILIARIS EN LA PIRÁMIDE CON RAMPA N°7, SANTUARIO DE PACHACAMAC, PERÚ/Preliminary study of Canis familiaris remains in the Pyramid with Ramp N°7, Pachacamac Sanctuary, Perú.

    Directory of Open Access Journals (Sweden)

    Denise Pozzi-Escot

    2012-11-01

    Full Text Available El Santuario arqueológico de Pachacamac tuvo una ocupación de alrededor de mil años, desde los primeros siglos de la era cristiana hasta la llegada de los conquistadores españoles al sitio. Durante el Horizonte Tardío (1470-1533 d.C., bajo el dominio Inca fue el más importante conjunto ceremonial de la costa central peruana, al cual acudían peregrinos de diversos y lejanos lugares. Recientemente, en el acceso a la Pirámide con Rampa N°7 (PCR 07, conectado a la principal vía de ingreso al santuario conocida como Calle Norte-Sur, se realizó el hallazgo de seis cánidos en muy buen estado de conservación que fueron identificados como Canis familiaris. El estudio de este contexto nos permite proponer una reconstrucción fenotípica de un perro prehispánico tardío; asimismo, nos permite evaluar el papel que jugaron estos animales en la época Inca, y relacionarlo al carácter sagrado del santuario. Abstract The Pachacamac Archeological Sanctuary was occupied of over a thousand years since the first centuries of the Christian era to the arrival of Spanish conquerors to the site. During the Late Horizon (1470-1533 AD, under the Inca rule, was the most important ceremonial complex of the central Peruvian coast, to which pilgrims arrived from different and distant places. Recently, in the access to the Pyramid with Ramp N°7, connected to the main entrance road to the sanctuary known as North-South Street, there was the discovery of six canines in very good condition that were identified as Canis familiaris. The study in this context allows us to propose a phenotypic reconstruction of a late pre-Hispanic dog, as well as evaluate the role played by these animals in the Inca period, and how they related to the sacredness of the sanctuary.

  12. ??ndice de distracci??n en el diagn??stico de la displasia de cadera en razas caninas aut??ctonas castellano-leonesas: el Perdiguero de Burgos

    OpenAIRE

    Melo Alonso, Beatriz

    2012-01-01

    376 p. Siendo el Perdiguero de Burgos (PB) es una de las razas caninas aut??ctonas de Castilla y Le??n m??s importantes, y no habi??ndose llevado a cabo un control radiogr??fico de la laxitud articular pasiva (LPA) de la cadera en la misma; y considerando que la LPA es el primer factor de riesgo para el desarrollo de la displasia de cadera (DC), y habi??ndose desarrollado t??cnicas diagn??sticas cl??nicas y radiogr??ficas para evaluarla, hemos considerado oportuno: En primer lugar, en 5...

  13. Caracterización de un dispositivo intrauterino para controlar la natalidad canina - Characterization of Intrauterine devices for the canine birth-rate control

    OpenAIRE

    Mendoza Escanell, Pastor Felipe; Ruiz Leon, Jerónimo Rafael

    2010-01-01

    ResumenEn Cuba no se notifica el uso de ningún dispositivo intrauterino comométodo para controlar la reproducción de las mascotas caninas,empleándose sin embargo con frecuencia la esterilización quirúrgica, apesar de los riesgos que ésta implica. Las causas son: falta deinformación, desconocimiento de las ventajas de un DIU, einexistencia de dispositivos adecuados. En este trabajo proponemos lautilización de Dispositivo Intrauterino Canino (DIUC) como medio pararesolver esa situación donde se...

  14. Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

    Directory of Open Access Journals (Sweden)

    Carine Fernandes B.

    2012-08-01

    Full Text Available Objetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquímica la técnica de la avidina- biotina- peroxidasa, con utilización del anticuerpo monoclonal 32-2B (anti-desmogléina-1. Resultados. A los estudios histológicos y morfológicos las células de la glándula mamaria normal humana demostraron semejanzas con las células de la glándula mamaria normal canina. Se observó adhesión y proliferación de células normales en ambas especies por aproximadamente tres meses de cultivo. Las células normales de las especies humana y canina mostraron baja actividad de proliferación cuando se compararon con las cancerosas de las especies en estudio. Los grupos de células epiteloides que se adhirieron al sustrato de los dos cultivos tuvieron dependencia de las células estromales, porque en la medida que las células fibroblastoides se retiraron, las células epiteloides detuvieron su crecimiento. Conclusiones. Comparando los resultados obtenidos por medio de análisis inmuno-histoquímico de células normales de mujeres y perras fue posible observar cambios en el patrón de coloración en células cancerosas en ambas especies, demostrando que las estructuras relacionadas con la adhesión celular (desmosomas pueden estar alteradas.

  15. Estudio histoquímico e inmunohistoquímico de los músculos de la lengua, paladar y faringe en el perro (Canis familiaris L.)

    OpenAIRE

    Sánchez Collado, Cayetano

    2009-01-01

    Un análisis de los tipos de fibras y de su distribución fue realizado en muestras de músculos de la lengua (mm. geniogloso, estilogloso, hiogloso y lingual propio), del paladar y fauces (mm. palatofaríngeo, palatino, elevador y tensor del velo palatino) y de la faringe (mm. terigofaríngeo, estilofaríngeo caudal, hiofaríngeo, tirofaríngeo y cricofaríngeo) en la especie canina. Asimismo, se procesaron muestras del músculo semitendinoso, que fue utilizado como músculo control. La tipificación fi...

  16. Análise espacial do risco de leptospirose canina na Vila Pantanal, Curitiba, Paraná

    Directory of Open Access Journals (Sweden)

    Daniele Bier

    2013-01-01

    Full Text Available A leptospirose é uma grave zoonose associada às áreas de baixa renda dos centros urbanos. Embora roedores urbanos sejam considerados como principal reservatório para a leptospirose, o cão também pode desenvolver a doença e se tornar carreador assintomático. O objetivo do presente trabalho foi utilizar a metodologia estatística baseada na teoria de processos pontuais espaciais, buscando identificar a forma como se distribuem os cães sororreagentes para a leptospirose e seus determinantes de risco em uma vila na cidade de Curitiba. A análise do modelo possibilitou identificar as regiões de sobre-risco, onde o risco de soropositividade canina à leptospirose é significativamente maior. A relação significativa do efeito espacial no desenvolvimento da doença, além das variáveis estudadas, revela que não apenas um, mas a ação conjunta dos fatores relacionados ao animal, ao proprietário e ao ambiente influencia o risco maior da doença nos locais de maior efeito espacial. O resultado da análise indica claramente os territórios em maior risco na região da Vila Pantanal, possibilitando o planejamento de ações mais específicas e dirigidas a essas áreas em um contexto de vigilância da saúde.

  17. Diagnóstico de la ehrlichiosis monocítica canina: una revisión actualizada

    Directory of Open Access Journals (Sweden)

    Roger Iván Rodríguez-Vivas

    2015-01-01

    Full Text Available La ehrlichiosis monocítica canina (EMC es causada por la infección de una rickettsia denominada Ehrlichia canis; este microorganismo se reproduce solamente en el citoplasma de los monocitos sanguíneos y macrófagos tisulares. La EMC ha sido reportada en todo el mundo, pero las frecuencias más altas se reportan en las regiones tropicales y subtropicales. La EMC no siempre es reconocida clínicamente, pues es difícil de diagnosticar debido a que los signos clínicos son variables, a que se presenta en diferentes fases y a la existencia de coinfecciones con otros patógenos transmitidos por garrapatas y otros agentes infecciosos. Las manifestaciones clínicas y las técnicas de diagnóstico tradicionales, como el diagnóstico hematológico y la demostración típica de mórulas de E. canis en el citoplasma de monocitos en frotis sanguíneos, se han utilizado para el diagnóstico de la EMC; sin embargo, las pruebas de diagnóstico por PCR y la serología mediante el uso de antígenos específicos son las pruebas más sensibles y específicas para el diagnóstico de la enfermedad. Este artículo presenta una revisión actualizada sobre el diagnóstico de la infección por E. canis en perros.

  18. GC×GC-TOF/MS Chromatographic Analysis, Antioxidant Capacity and Phenolic Content of Rosa Canina L. at Different Maturities

    Directory of Open Access Journals (Sweden)

    Dilek Ozyurt

    2016-01-01

    Full Text Available The relationship between food and health has become increasingly significant as consumers now demand healthy, tasty and natural foods which perform a useful function in the body. In Turkey, rose hip (Rosa canina L. is in popular use in foodstuffs such as marmalade, pestil (a traditional Turkish sweet and syrup or in traditional medicine, mainly as herbal tea. The composition, total antioxidant capacity (TAC and total phenolic content (TPC of volatiles of rose hip samples were compared in relation to their stage of maturity and collection location. Rose hip fruit and seed were analyzed using a direct thermal desorption technique coupled with comprehensive two-dimensional gas chromatography time-of-flight mass spectrometry (GCxGC-TOF/MS. The major components found in the volatile fraction released on extraction were free fatty acids. The various stages of maturity of rose hips (green, light yellow, yellow, orange and red coloured and the place of collection (Istanbul, Mersin, York resulted in some changes in volatile compound speciation, in TAC and TPC levels. Various extraction methods were compared; methanol extraction, traditional hot water infusion and boiling in water. Boiling in water for ten minutes was the method which demonstrated the highest extraction efficiency. TAC and TPC were determined using different electron transfer−based assays; the Cerium (IV ions reducing antioxidant capacity, Cupric Reducing Antioxidant Capacity and Folin-Ciocalteu methods. The highest TAC and TPC were found in the red coloured (fully ripe rose hip fruit, suggesting that colour is a suitable indicator for optimal harvesting time.

  19. Aspectos clínicos, morfológicos e imuno-histoquímicos da pitiose gastrintestinal canina

    Directory of Open Access Journals (Sweden)

    Maria E. Trost

    2009-08-01

    Full Text Available Através de um estudo retrospectivo dos casos de biópsias e necropsias de cães recebidos no Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria, constatou-se a ocorrência de dois casos confirmados e de quatro casos suspeitos de pitiose gastrintestinal canina. Os dois casos diagnosticados e publicados tiveram a etiologia confirmada através da cultura e indução de zoosporogênese ou por nested-PCR. Neste estudo utilizou-se a técnica de imuno-histoquímica com anticorpo policlonal anti-Pythium insidiosum para confirmação da etiologia dos quatro casos suspeitos. A epidemiologia, sinais clínicos, lesões macroscópicas e microscópicas, características histoquímicas e imuno-histoquímicas e diagnósticos diferenciais são relatados e discutidos.Four suspect and two confirmed cases of gastrointestinal pythiosis were found in a retrospective study of biopsy and necropsy cases of dogs received in the Laboratório de Patologia Veterinária at the Universidade Federal de Santa Maria. The two diagnosed and published cases have had the etiology confirmed by culture and zoosporogenesis induction or by nested-PCR. On this study, the etiologic diagnosis of four suspect cases was confirmed by immunohistochemistry using anti-Pythium insidiosum policlonal antibody. Epidemiology, clinical signs, gross and microscopic lesions, histochemistry, immunohistochemistry, and differential diagnoses are reported and discussed.

  20. Influenza delle misure preventive sulla prevalenza di leishmaniosi canina in un focolaio identificato in Nord Italia nel 2006

    Directory of Open Access Journals (Sweden)

    Rudi Cassini

    2013-06-01

    Full Text Available La leishmaniosi canina è un'infezione endemica nel bacino del Mediterraneo con una documentata tendenza a diffondersi verso nord. L'uso massiccio di misure di protezione contro i rischi del contatto con i flebotomi (collari e formulazioni spot-on è stato studiato in un focolaio registrato in una zona collinare dei Colli Euganei in Italia nord-orientale nel 2006. Nel 2006 e 2007 sono stati testati i sieri di 449 cani provenienti dalla stessa zona. Trentuno animali (6,9% sono risultati positivi al test di immunofluorescenza indiretta (IFI. L'analisi dei fattori di rischio ha chiaramente dimostrato come il focolaio fosse limitato alla località di Calaone, situata nel comune di Baone (PD. Per verificare l'efficacia delle misure preventive adottate, nel 2010, 63 cani di Calaone sono stati campionati e i loro proprietari intervistati. In base alle informazioni rilasciate dai proprietari, la protezione dei cani nei confronti della leishmaniosi ha avuto inizio nel 2006 (66,7% dei cani protetti crescendo negli anni seguenti (90% dei cani protetti. Il valore di sieroprevalenza (4,2% della classe di cani di età più giovane (<5 anni è risultato significativamente minore di quello delle altre classi, dimostrando che gli animali nati dopo il 2006 hanno avuto meno probabilità di infettarsi. Inoltre, i valori di sieroprevalenza riferiti esclusivamente ai cani di Calaone sono risultati del 32,4% (23/71 nel 2006-2007 e 20,6% (13/63 nel 2010, mostrando una tendenza decrescente. I risultati ottenuti mostrano un alto livello di sensibilizzazione dei proprietari dei cani e sembrano evidenziare come l'uso pervasivo di collari e spot-on agisca positivamente nel ridurre l'intensità di circolazione di Leishmania infantum.

  1. Physiologically-based pharmacokinetic modelling of distribution, bioaccumulation and excretion of POPs in Greenland sledge dogs (Canis familiaris).

    Science.gov (United States)

    Sonne, Christian; Gustavson, Kim; Letcher, Robert J; Dietz, Rune

    2015-10-01

    We used PBPK (physiologically-based pharmacokinetic) modelling to investigate distribution, bioaccumulation and excretion of the seven POPs (persistent organic pollutants) CB-99, CB-153, HCB, oxychlordane, p,p'-DDE, BDE-47 and BDE-99 in 4 adult captive Greenland sledge dog (Canis familiaris) bitches fed minke whale (Balaenoptera acuterostrata) blubber for 500-635 days. The PBPK modelled POP concentrations in adipose tissue, liver, kidney and plasma were mostly within a factor 2 of actual measured tissue levels even for those at the lower concentration end. The excretion route for oxychlordane and CB-153 was modelled to be via faeces while lung alveolar excretion dominated for BDE-47, BDE-99, HCB, p,p'-DDE and CB-99. Furthermore the model suggested the retained mass of POPs after 500 and 635 days of exposure, respectively, to be relatively low despite these POPs being highly recalcitrant. The retention increased in the following order (% of total intake); p,p'-DDE (1%)tool in risk assessment of POPs in arctic mammals. PMID:26210746

  2. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

    Science.gov (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

    2016-01-01

    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species. PMID:26364290

  3. Diagnóstico de criptococose canina pela citologia aspirativa por agulha fina Diagnosis of canine cryptococcosis by fine-needle aspiration cytology

    Directory of Open Access Journals (Sweden)

    Danieli Brolo Martins

    2008-06-01

    Full Text Available Relata-se um caso de criptococose canina de caráter sistêmico e neurológico diagnosticado com o auxílio da citologia aspirativa por agulha fina (CAAF. O paciente, da raça Labrador, 1 ano e 5 meses, macho, apresentava sinais de depressão/estupor, hiporexia, presença de uma massa cervical delimitada entre os dois linfonodos submandibulares e aumento de linfonodos. A punção aspirativa da massa cervical e dos linfonodos poplíteo, pré-escapular e submandibular revelaram presença de fungos compatíveis com Cryptococcus neoformans, o qual foi então confirmado pela cultura fúngica, e classificado como sorotipo D. A CAAF mostrou ser um método rápido, seguro e eficaz em casos de criptococose canina com presença de linfoadenomegalia.This paper aimed to described a 1.5 year-old Labrador male, diagnosed with cryptococcosis using fine-needle aspiration cytology (FNAC. The dog was showing signs of depression and hyporexia. Peripheral lymph nodes and a mass situated between the submandibular lymph nodes were aspirated. The cytology showed yeast-like structures resembling Cryptococcus sp. in all samples examined. These findings were confirmed by culture (C. neoformans, serotype D. The FNAC technique allowed a quick, safe and easy diagnosis in this case.

  4. Ileal, colonic and total tract nutrient digestibility in dogs (Canis familiaris) compared with total tract digestibility in mink (Neovison vison)

    DEFF Research Database (Denmark)

    Tjernsbekk, Maria Therese; Tauson, Anne-Helene; Ahlstrøm, Øystein

    2014-01-01

    Mink (Neovison vison) was studied as a model for the determination of ileal crude protein (CP) and amino acid (AA) digestibility in dogs (Canis familiaris). Apparent ileal digestibility (AID) and apparent colonic digestibility (ACD) in dogs and apparent total tract digestibility (ATTD) in dogs and...... found between methods for digestibility of CP and most AA (p < 0.01) and for AA ranking with respect to digestibility level (p < 0.001). In dogs, ether extract digestibility was approximately 96% at all sites, while DM, starch and total carbohydrate digestibility increased from ileal to faecal level (p...

  5. Citometria de fluxo no diagnóstico da leishmaniose visceral canina Flow cytometry used in canine visceral leishmaniasis diagnosis

    Directory of Open Access Journals (Sweden)

    A.V. Carvalho Neta

    2006-08-01

    Full Text Available Descreve-se a padronização de nova metodologia para detecção de anticorpos antiformas promastigotas fixadas de L. (L. chagasi, por citometria de fluxo (AAPF-IgG, sua aplicabilidade e desempenho na identificação de casos de leishmaniose visceral canina (LVC. Foram avaliados dois grupos de cães classificados pela reação de imunofluorescência indireta (RIFI, como: não reatores (NR, n=10 e reatores (R, n=50 dos quais foram coletadas amostras de sangue (soro para realização dos testes laboratoriais. Os resultados relacionados ao estabelecimento, aplicabilidade e desempenho da metodologia AAPF-IgG demonstraram que essa metodologia possibilita a identificação de uma região de reatividade diferencial entre cães NR e R, no soro diluído a 1:2048 e o valor de 20% de parasitos fluorescentes positivos (PPFP como ponto de corte entre resultados positivos e negativos, mostrando que a AAPF-IgG aplica-se na identificação de casos de LVC, possibilitando distinguir 96% de cães R como positivos e 100% de cães NR como negativos. Esses resultados em conjunto sugerem que a utilização da AAPF-IgG pode ser um novo instrumento para ensaios clínicos de diagnóstico sorológico da LVC.The current study evaluated the standardization of a new methodology for detection of anti-fixed L. (L. chagasi promastigote antibodies by flow cytometry (AAPF-IgG, as well its applicability and performance in the identification of cases of Canine Visceral Leishmaniasis (CVL. Two groups of dogs were classified by RIFI (gold standard as no reactors (NR, n=10 and reactors (R, n=50. Blood samples were collected and used for the laboratorial tests (RIFI and AAPF-IgG. The results showed that the new AAPF-IgG assay makes possible the identification of an area of differential reactivity between dogs NR and R at the dilution of 1:2048 and 20% of percentage of positive fluorescent parasite as the cut point among positive and negative results. The AAPF-IgG assay was able to

  6. The role of rose hip (Rosa canina L powder in alleviating arthritis pain and inflammation – part II animal and human studies

    Directory of Open Access Journals (Sweden)

    Marstr

    2016-05-01

    Full Text Available Kristian Marstrand,1 Joan Campbell-Tofte2 1Department of Orthopaedic Surgery, Elverum Hospital, Elverum, Norway; 2Coordinating Research Unit, Frederiksberg University Hospital, Frederiksberg, Copenhagen, Denmark Abstract: Rosa canina fruits (often known as rose hip have been used in herbal remedies since ancient times. On the basis of anecdotal reports about the effects of rose hip preparations on human health and citations to the same in ancient texts, in vitro and in vivo studies have been conducted that have made it possible to learn about some active ingredients in rose hip, as well as how the component compounds might exert their effects. From such studies, it has been documented that there is a great variation in active ingredients when comparing different rose hip products. Factors which affect the quality and quantity of active ingredients in the rose hip products include the subspecies of the particular R. canina from which the fruits are harvested, the environment during plant growth, time of harvesting, and the amount of seeds and shells/husks incorporated into the preparation. Studies in animals and in humans are of great importance for determining the true bio-effects of rose hip. Such in vivo studies that have only been performed during the last 2 decades indicate that the treatment of patients with different types of joint disease with rose hip powder based on a subspecies of R. canina (Lito containing a certain galactolipid (GOPO can alleviate pain, improve daily activity, and even reduce the consumption of regular pain relievers. As several rose hip components have been shown to be anti-inflammatory, it is suggested that anti-inflammatory mechanisms might explain some reductions in symptoms associated with administering rose hip to arthritic conditions. Although the number of publications of randomized and placebo-controlled clinic studies with rose hip is small, the overriding evidence is that the anti-inflammatory effects from

  7. Denervação capsular percutânea no tratamento da displasia coxofemoral canina Percutaneous hip denervation for the treatment of canine hip dysplasia

    OpenAIRE

    André Luis Selmi; Bianca Mota Penteado; Bruno Testoni Lins

    2009-01-01

    A displasia coxofemoral canina (DCF) é uma afecção ortopédica freqüente, comumente dolorosa, decorrente de instabilidade e que leva à doença articular degenerativa. Várias formas de tratamento cirúrgico são descritas, entre elas a denervação capsular a céu aberto. Neste trabalho, é descrita a denervação capsular percutânea e seus efeitos em 92 cães com sensibilidade dolorosa na articulação do quadril atribuída à DCF. Foram avaliados os seguintes aspectos: o grau de claudicação (CLAUD), a dor ...

  8. The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls

    DEFF Research Database (Denmark)

    Nielsen, Bente Kirkeskov; Christensen, Robin; Bügel, Susanne Gjedsted;

    2011-01-01

    OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains...... antioxidant nutrients and an anti-inflammatory galactolipid. Rheumatoid arthritis (RA) is an inflammatory disease where activated cells release reactive oxygen substances. Thus it could be relevant to investigate if rose hip had an anti-inflammatory and/or antioxidant effect in this situation. METHODS: In...... this open case-control study 20 female patients with RA and 10 female controls were given 10.5g rose hip powder daily (Litozin(®)) for 28 days. Blood samples were analysed at baseline and follow-up for the capacity of the antioxidant enzymes superoxide dismutase, glutathione peroxidase, glutathione...

  9. The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls: A prospective cohort study

    DEFF Research Database (Denmark)

    Kirkeskov, Bente; Christensen, Robin; Bügel, Susanne Gjedsted;

    2011-01-01

    OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains...... antioxidant nutrients and an anti-inflammatory galactolipid. Rheumatoid arthritis (RA) is an inflammatory disease where activated cells release reactive oxygen substances. Thus it could be relevant to investigate if rose hip had an anti-inflammatory and/or antioxidant effect in this situation. METHODS: In...... this open case-control study 20 female patients with RA and 10 female controls were given 10.5g rose hip powder daily (Litozin(®)) for 28 days. Blood samples were analysed at baseline and follow-up for the capacity of the antioxidant enzymes superoxide dismutase, glutathione peroxidase, glutathione...

  10. Extraction and Characterization of Phenolic Compounds from Rose Hip (Rosa canina L. Using Liquid Chromatography Coupled with Electrospray Ionization - Mass Spectrometry

    Directory of Open Access Journals (Sweden)

    Andreea STĂNILĂ

    2015-12-01

    Full Text Available Wild berry are a rich of natural compounds which provide them high antioxidant potential. The compounds which provide them these proprieties are known to be vitamins, flavonoids, anthocyanins and phenolic acids. The aim of this study was to extract and characterize bioactive compounds from rose hip (Rosa canina L. currently found in Romania. A qualitative high-performance liquid chromatography coupled with electrospray ionization mass spectrometric (ESI-MS detection in positive ion mode has been used to identify phenolic compounds from rose hip crude extract. The chromatograms revealed the presence of a large number of compounds (19, identified and grouped as phenolic acids and flavones/ols, flavan-3-ols and also anthocyanins. Based on obtained results these berries can be highly recommended as part of our diet. Also this finding represents a contribution to the chemical characterization of phenolic profile of rose hip.

  11. IRIS Biometric Recognition System Employing Canny Operator

    OpenAIRE

    Binsu C. Kovoor; Supriya M.H.; K Poulose Jacob

    2013-01-01

    Biometrics has become important in security applica tions. In comparison with many other biometric features, iris recognition has very high recognition accuracy because it depends on iris which is located in a place that still stable throughout human life and the probability to find two identical iris's is close to zero. The identifi cation system consists of several stages including segmentation stage which is the most serious and ...

  12. EVOLUCIÓN DE LA SOCIALIDAD, ESTRATEGIAS ALIMENTARIAS Y ANATOMÍA CRÁNEODENTAL EN LA SUBFAMILIA CANINAE Evolution of Sociality, Diet, and Craniodental Anatomy in the Subfamly Caninae

    Directory of Open Access Journals (Sweden)

    JOAO MUÑOZ-DURÁN

    2012-04-01

    organization of ancestral and modern mammal communities. Thus, it is important to identify what extinct carnivore species may have been social and to determine when, where and under which environmental contexts they evolved. The first step is to establish if there is an association between morphological traits, susceptible of being preserved in the fossil record, and differences in the degree of sociality of present day carnivores. The aim of this research was to establish if there is an association between variation in shape and variables related to mechanical properties of the skulls, and differences in sociality level, diet and sex in modern canids. The sample included 972 specimens of 33 canid species. We analyzed the shape of the lateral side of the cranium, zygomatic arch, dentary bone and mandibular corpus, as well as 20 variables related to mechanical properties of the skull. Results suggest that hypercarnivorous social canids have shapes and mechanical properties that are different from other modern canids. We found that morphological variation is not affected by sex. Results may be used to identify extinct Caninae species that were social and hypercarnivorous. Results also suggest that the evolution of sociality is dependent on phylogenetic relationships and ecological context, particularly the abundance of large prey and the presence of sympatric carnivores.

  13. Microbiological and histopathological aspects of canine pyometra Aspectos microbiológicos e histopatológicos da piometria canina

    Directory of Open Access Journals (Sweden)

    Jennifer Anne Coggan

    2008-09-01

    Full Text Available As pyometra is recognized as one of the main causes of disease and death in the bitch the purposes of this study were to evaluate microbiological and histopathological aspects of canine pyometra and to research the virulence factors of the E. coli isolates identifying possible risks to human health. The microbiological isolation from the intrauterine contents of 100 dogs with pyometra was carried out and the virulence factors in the E. coli strains were identified using PCR method. This study also consisted of the counting of microorganisms colonies forming units in samples of intrauterine content, tests of antimicrobial susceptibility of the E. coli isolates and the histological examination of the uterus. E. coli was the most prevalent microorganism isolated (76.6% and 120 strains (79.5% were positive for sfa, 86 (56.9% were positive for cnf, 87 (57.6% were positive for pap, 52 (34.4% were positive for hly, 51 (33.8% were positive for iuc and 5 (3.3% were positive for afa genes. One observed more sensitivity of E. coli to norfloxacin, polimixin B, sulphazotrin, chloranfenicol and enrofloxacin. In 42% of the samples of uterine walls where microorganisms were isolated, the sizes of the areas of the inflammatory responses corresponded to 39-56%. Virulence factors were identified in 98.0% of the strains evaluated, demonstrating a high frequency of potentially pathogenic E. coli. It must be considered that dogs are animals that are living in close proximity to man for thousands of years and have an important role in the transmission of E. coli to other animals and to man.A piometra é uma enfermidade da cadela adulta, sendo a doença reconhecida como uma das causas mais comuns de morte desta espécie animal. Os objetivos deste trabalho foram a avaliação de aspectos microbiológicos e histopatológicos da piometra canina e pesquisa de fatores de virulência de E. coli, identificando possíveis riscos para a saúde humana. Foi realizado o exame

  14. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber.

    Science.gov (United States)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette; Jenssen, Bjørn Munro; Letcher, Robert J; Dietz, Rune

    2014-06-01

    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw, respectively, which was significantly higher than the mean concentration of 53ng/g lw for all controls (peffects on immunity and reproduction and more focus should be conducted on this compound in Arctic wildlife. PMID:24725758

  15. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Rigét, Frank F; Beck Jensen, Jens-Erik;

    2008-01-01

    DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n=26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n=15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata...... individuals in the bitch generation were found (linear mixed effect model: both p>0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMD(femur), BMD(vertebrae) and groups of OHCs...

  16. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

    Science.gov (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

    2015-10-01

    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests. PMID:26092534

  17. Aspectos epidemiológicos sobre mordeduras caninas durante el año 2011 en la ciudad de Temuco, Chile.

    Directory of Open Access Journals (Sweden)

    Waldo Armstrong,

    2016-03-01

    Full Text Available Los accidentes causados por mordeduras de perros y gatos son un problema de salud pública y concretamente las mordeduras de perro constituyen el riesgo más grave que estos animales suponen para la salud de las personas. A los costes económicos derivados del tratamiento de las lesiones físicas debemos añadir las secuelas psicológicas que muchas veces aparecen tras las agresiones. La prevención es el único camino para resolver este problema y puede efectuarse mejor cuando se conocen los diversos factores involucrados en la génesis de este tipo de accidentedebido a lo anterior el objetivo del estudio fue describir las características epidemiológicas asociadas a las personas mordidas por perros. La metodología utilizada para la recolección de datos fue la aplicación de una encuesta a 9 centros asistenciales de la ciudad de Temuco. Se solicitó información sobre pacientes atendidos por mordeduras caninas durante el año 2011 y los datos recolectados se ingresaron en una planilla de cálculos. Los resultados indican que niños y adultos presentan 52% de las mordeduras durante el año. Los hombres presentan una mayor incidencia con un 47% a diferencia de las mujeres con un 44%. Con respecto a la región corporal afectada los miembros superiores alcanzan un 25% de frecuencia ante el ataque y los miembros inferiores un 31.3%. Por otra parte, las mordeduras por perros presentaron una marcada estacionalidad en los meses de verano con un 30% de casos. Se concluye que las mordeduras caninas son un problema frecuente y de real importancia en el ámbito de salud pública, generando en la población secuelas físicas y psicológicas por las lesiones generadas durante el ataque.

  18. Evaluación del método del tubo para concentrar plaquetas caninas: estudio celular Evaluation of the tube method for concentrating canine platelets: cellular study

    Directory of Open Access Journals (Sweden)

    RF Silva

    2011-01-01

    Full Text Available El objetivo de este estudio fue evaluar un método manual para concentrar plaquetas caninas y en consecuencia producir concentrados autólogos de plaquetas (APCs para propósitos clínicos y experimentales. Los APCs fueron obtenidos a partir de sangre venosa depositada en tubos con solución ACD que fueron centrifugados a 191 g durante 6 minutos. Para los recuentos celulares de sangre entera y APCs, se encontraron diferencias estadísticamente significativas (P The aim of this study was to evaluate a manual method for concentrating canine platelets and consequently produce autologous platelet concentrates (APCs for clinical and experimental proposals. The APCs were obtained by venous blood collection in tubes with ACD solution and were spun at 191 g for 6 minutes. The cell counts of whole blood and APCs, were statistically different (P < 0.01 between the values for platelets, leukocytes, granulocytes, monocytes, but not for lymphocytes. A strong negative correlation (ρ = -0.702 P = 0.011 between the number of lymphocytes and platelets in the APCs was found. The collection efficiency of platelets was 29.9% and the concentration of platelets was 49.4% higher in APCs when compared to the whole blood samples. The results indicated that this simple centrifugation method allows concentrating canine platelets.

  19. To be or not to be the odd one out - Allele-specific transcription in pentaploid dogroses (Rosa L. sect. Caninae (DC. Ser

    Directory of Open Access Journals (Sweden)

    Theißen Günter

    2011-02-01

    Full Text Available Abstract Background Multiple hybridization events gave rise to pentaploid dogroses which can reproduce sexually despite their uneven ploidy level by the unique canina meiosis. Two homologous chromosome sets are involved in bivalent formation and are transmitted by the haploid pollen grains and the tetraploid egg cells. In addition the egg cells contain three sets of univalent chromosomes which are excluded from recombination. In this study we investigated whether differential behavior of chromosomes as bivalents or univalents is reflected by sequence divergence or transcription intensity between homeologous alleles of two single copy genes (LEAFY, cGAPDH and one ribosomal DNA locus (nrITS. Results We detected a maximum number of four different alleles of all investigated loci in pentaploid dogroses and identified the respective allele with two copies, which is presumably located on bivalent forming chromosomes. For the alleles of the ribosomal DNA locus and cGAPDH only slight, if any, differential transcription was determined, whereas the LEAFY alleles with one copy were found to be significantly stronger expressed than the LEAFY allele with two copies. Moreover, we found for the three marker genes that all alleles have been under similar regimes of purifying selection. Conclusions Analyses of both molecular sequence evolution and expression patterns did not support the hypothesis that unique alleles probably located on non-recombining chromosomes are less functional than duplicate alleles presumably located on recombining chromosomes.

  20. Biogas production from spent rose hips (Rosa canina L.): fraction separation, organic loading and co-digestion with N-rich microbial biomass.

    Science.gov (United States)

    Osojnik Črnivec, Ilja Gasan; Muri, Petra; Djinović, Petar; Pintar, Albin

    2014-11-01

    Complex waste streams originating from extraction processes containing residual organic solvents and increased C/N ratios have not yet been considered as feedstock for biogas production to a great extent. In this study, spent rosehip (Rosa canina L.) solid residue (64%VS, 22 MJ/kg HHV, 30C/1N) was obtained from an industrial ethanol aided extraction process, and extensively examined in an automated batch bioreactor system for biogas production. Fraction separation of the compact lignocellulosic seeds increased the available sugar and ethanol content, resulting in high biogas potential of the sieved residue (516 NL/kg VS'). In co-digestion of spent rosehip substrate with non-deactivated nitrogen rich microbial co-substrates, methanogenesis was favored (Y(m) > 68%(CH4)). In individual digestion of microbial co-substrates, this was not the case, as biogas with 28 vol.% N2 was produced from activated sludge supplement. Therefore, effective inhibition of exogenous microbiota was achieved in the presence of carbonaceous spent rose hip. PMID:25218210

  1. Application of Natural Antioxidants from Strawberry Tree (Arbutus unedo L.) and Dog Rose (Rosa canina L.) to Frankfurters Subjected to Refrigerated Storage

    Institute of Scientific and Technical Information of China (English)

    Mónica Armenteros; David Morcuende; Sonia Ventanas; Mario Estévez

    2013-01-01

    The effect of the addition of natural antioxidants from strawberry tree (Arbutus unedo L.; AU) and dog rose (Rosa canina L.; RC), in frankfurters elaborated with or without the addition of antioxidant additives (sodium ascorbate and nitrite) was studied. Six different types of experimental frankfurters were prepared depending on the addition of phenolic-rich extracts from RC and AU and the presence (P) or absence (C) of antioxidant additives. Thiobarbituric acid reactive substances (TBARS)-numbers signiifcantly increased during chilled storage of C-frankfurters while additives and fruit phenolics inhibited lipid oxidation in P-frankfurters. The amount of protein carbonyls signiifcantly increased in all treatments except in P-AU frankfurters. The discoloration process that occurred during the chilled storage was reduced by the addition of substances with proven antioxidant activity (P-frankfurters). Texture characteristics as hardness, springiness, cohesiveness and gumminess also suffered a signiifcant deterioration in C-frankfurters. The use of phenolic fruit extracts in combination with traditional antioxidant additives is a successful strategy to enhance the oxidative stability of frankfurters without modifying their color and texture properties.

  2. Effects of Fruit of Rosa Canina L.Extract on the Level of Plasma Glucose in Male Diabet-Induced Rats

    Directory of Open Access Journals (Sweden)

    A Mohammad Eini

    2016-03-01

    Full Text Available Introduction: Diabetes mellitus is one of the most prevalent chronic and complex metabolic diseases of human , which hyperglycemia can be mentioned as its prominent characteristic. Therefore, this study aimed to evaluate the hypoglycemic effects of fruit of Rosa canina (R.c. extract in healthy and diabetic rats. Method: A total of 72 Wistar male rats were divided into six group: control,  STZ (diabetic control,  R.c. control (50 mg/kg, R.c. control (100 mg/kg and two experimental groups with 50, and 100 mg/kg of extract dose. Diabetes was induced using streptozotocine (60 mg/kg; IP, and blood collection was carried out on 0, 2 and 4 hours after the oral administration of the extracts. Results: The levels of plasma glucose were determined by spectrophotometric method. In order to statistically analyze the study data, ANOVA test was performed. There was a significant difference between groups concerning the plasma glucose concentration (P<0.0001, which the lowest concentration between diabetes groups was observed in the two experimental groups. Moreover, R.c. had a marked hypoglycemic effect on diabetes mellitus. Conclusion: R.c. extract in hyperglycemic status demands to be further studied in order to control and prevent its complications.

  3. Manejo de la traqueobronquitis infecciosa canina (TIC “Tos de las Perreras” (Canine infectious tracheobronchitis management “Kennel Cough”

    Directory of Open Access Journals (Sweden)

    Leonardo D. Mauro

    2006-02-01

    Full Text Available Sumario. La traqueobronquitis infecciosa canina es una enfermedad muy contagiosa del sistema respiratorio superior, que puede afectar a perros de diferentes edades, en forma individual, o mas seriamente a poblaciones donde conviven muchos animales y en las que puede ser un problema muy complejo de solucionar. En este trabajo, luego de incursionar en las diferentes etiologías y tratamientos, se intenta unificar toda la información disponible sobre el manejo profiláctico de esta patología, junto a nuestra experiencia de muchos años con poblaciones animales dentro de un local de exposición y venta de cachorros. Summary. The canine infectious traqueobronquitis is a very contagious disease of the high respiratory system that can affect dogs of different ages, in individual form, or more seriously to populations where many animals coexist and in which can be a very complex problem to solve. In this work, after incursionar in the different etiology and treatments, it is tried to unify all the information available on the prophylactic handling of this pathology, next to our experience of many years with populations animals within the premises of exhibition and sale of puppies.

  4. Canine hypertrophic osteopathy associated with extra-thoracic lesions Osteopatia hipertrófica canina associada com lesões extratorácicas

    Directory of Open Access Journals (Sweden)

    Selwyn Arlington Headley

    2005-08-01

    Full Text Available Canine hypertrophic osteopathy is described in a dog that presented extra-thoracic lesions, mainly in the liver. Hepatic lesions were characterized by necrosis, hemorrhage, severe hydropic degeneration of centrolobular hepatocytes, proliferation of epithelial cells of bile ducts, and mild biliary stasis. The disease syndrome was diagnosed based on clinical signs, radiological evaluation, and inspection of macerated bones.Osteopatia hipertrófica canina é descrita em um cão que apresentou lesões extratorácicas, principalmente no fígado. As alterações hepáticas foram caracterizadas por necrose, hemorragia, degeneração hepatocelular severa, proliferação das células epiteliais dos ductos biliares e estase biliar. O diagnóstico desta síndrome foi baseado nos sinais clínicos, a avaliação radiológica e a inspeção dos ossos macerados.

  5. Aspectos biomecânicos compressivos de diáfises femorais caninas conservadas em glicerina a 98% ou em mel Biomechanical compressive aspects of canine femoral shafts preserved in 98% glycerin or honey

    OpenAIRE

    Gustavo Frassetto Amendola; Alceu Gaspar Raiser; José Mario Doley Soares; Diego Vilibaldo Beckmann

    2008-01-01

    Neste estudo foi comparada a resistência compressiva axial de diáfises femorais caninas a fresco (grupo F), conservadas por trinta dias em glicerina a 98% (grupo G) ou em mel (grupo M). Cada grupo continha 50 amostras que foram submetidas a testes biomecânicos compressivos, em uma prensa de compressão axial, até ocorrer fissura. Os ossos conservados em glicerina ou mel foram reidratados antes da avaliação. Pelos resultados obtidos, foi verificada maior resistência nos ossos conservados em gli...

  6. Botanical Extracts from Rosehip (Rosa canina), Willow Bark (Salix alba), and Nettle Leaf (Urtica dioica) Suppress IL-1 beta-Induced NF-kappa B Activation in Canine Articular Chondrocytes

    OpenAIRE

    Shakibaei, Mehdi; Allaway, David; Nebrich, Simone; Mobasheri, Ali

    2012-01-01

    The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina), willow bark (Salix alba), and nettle leaf (Urtica dioica) in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1 beta for up to 72h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG), beta 1-integrin, SOX-9, COX-2, and MMP-9 and MMP-1...

  7. Botanical Extracts from Rosehip (Rosa canina), Willow Bark (Salix alba), and Nettle Leaf (Urtica dioica) Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes

    OpenAIRE

    Mehdi Shakibaei; David Allaway; Simone Nebrich; Ali Mobasheri

    2012-01-01

    The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina), willow bark (Salix alba), and nettle leaf (Urtica dioica) in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG), β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was e...

  8. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.

    2013-07-01

    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  9. Métodos de diagnóstico para detecção de prostatopatias caninas Canine prostatic disease: diagnosis methods

    Directory of Open Access Journals (Sweden)

    Ceres Mussel

    2010-12-01

    Full Text Available As doenças prostáticas são comuns em cães, desenvolvendo-se após a maturidade sexual. Entre as afecções que acometem a próstata desses animais, a mais frequente é a hiperplasia prostática benigna (HPB. As neoplasias prostáticas, apesar de menos frequentes, são altamente malignas e um diagnóstico tardio está associado a um prognóstico ruim. Os principais métodos de diagnóstico das enfermidades prostáticas em cães incluem um exame clínico detalhado, ultrassonografia, punção aspirativa e biópsia. A utilização de biomarcadores séricos vem sendo estudada como uma maneira de se detectar a doença precocemente, evitando possíveis complicações no quadro clínico dos pacientes. Assim, estudos visando ao diagnóstico precoce de prostatopatias caninas, especialmente o câncer prostático, são cruciais para um tratamento eficaz e melhora da qualidade de vida do animal acometido.Prostatic diseases are common in older dogs, developing after sexual maturity. The most common affecting canine prostate is benign prostatic hyperplasia (BPH. Although less frequent, prostatic neoplasias are highly malignant, and a late diagnosis is closely associated with a poor prognosis. The main methods of diagnosis of the canine prostatic disease include a detailed clinical exam, ultrasound, prostatic fine-needle aspirate and biopsy. Studies towards early diagnosis of this condition are crucial for effective treatment and improvement of quality of life of affected animals. The use of biomarkers has been studied for early detection of the disease, avoiding possible complications in clinical patients.

  10. Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda

    Directory of Open Access Journals (Sweden)

    EVORA Paulo Roberto B.

    1999-01-01

    Full Text Available Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers" e ensaios biológicos: 1 os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2 os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3 o A23187, vasodilatador independente de receptor, induziu relaxamentos dependentes do endotélio; 4 dopamina, dobutamina, papaverina e a poli-L-arginina induziram vasodilatações independentes do endotélio; 5 a NOR induziu intensa vasoconstrição comparável à causada pelo KCI e pela endotelina; 6 em 83% de 24 ensaios, a liberação basal de NO foi maior na AMI esquerda, em comparação com a AMI direita; 7 ensaios biológicos de AMIs demonstraram a importância da PGI2 nas condições de hipóxia, uma vez que a indometacina aboliu vasodilatação adicional em resposta à hipóxia em condições de vasodilatação induzida pela liberação basal de NO; 8 não ocorreram diferenças significantes de resposta, comparando-se estudos realizados em AMIs direita e esquerda.

  11. Contagious yawning in domestic dog puppies (Canis lupus familiaris): the effect of ontogeny and emotional closeness on low-level imitation in dogs.

    Science.gov (United States)

    Madsen, Elainie Alenkær; Persson, Tomas

    2013-03-01

    Contagious yawning is a well-documented phenomenon in humans and has recently attracted much attention from developmental and comparative sciences. The function, development and underlying mechanisms of the phenomenon, however, remain largely unclear. Contagious yawning has been demonstrated in dogs and several non-human primate species, and theoretically and empirically associated with empathy in humans and non-human primates. Evidence of emotional closeness modulating contagious yawning in dogs has, nonetheless, been contradictory. Humans show a developmental increase in susceptibility to yawn contagion, with typically developing children displaying a substantial increase at the age of four, when a number of cognitive abilities (e.g. accurate identification of others' emotions) begin to clearly manifest. Explicit tests of yawn contagion in non-human animals have, however, thus far only involved adult individuals. Here, we report a study of the ontogeny of domestic dogs' (Canis lupus familiaris) susceptibility to yawn contagion, and whether emotional closeness to the yawning model affects this. Thirty-five dogs, aged 4-14 months, observed a familiar and unfamiliar human repeatedly yawn or gape. The dogs yawned contagiously, but emotional closeness with the model did not affect the strength of contagion, raising questions as to recent evidence of emotionally modulated auditory contagious yawning in dogs. The dogs showed a developmental effect, with only dogs above 7 months evidencing contagion. The results support the notion of a developmental increase in dogs' attention to others and identification of others' emotional states and suggest that yawn contagion is underpinned by developmental processes shared by humans and other animals. PMID:23076724

  12. Avaliação da leishmaniose visceral canina em Poxoréo, Estado do Mato Grosso, Brazil Canine visceral leishmaniasis evaluation in Poxoréo, Mato Grosso State, Brazil

    Directory of Open Access Journals (Sweden)

    Márcia Ávila A. de Azevedo

    2008-09-01

    Full Text Available O cão doméstico desempenha importante papel como reservatório na transmissão da leishmaniose visceral ao homem, zoonose de grande importância em saúde pública. Realizou-se avaliação epidemiológica da leishmaniose visceral em 1.112 cães domiciliados no município de Poxoréo, estado do Mato Grosso e observou-se prevalência de 7,8%. Observou-se ainda associação estatisticamente significativa entre a prevalência de leishmaniose visceral canina e as variáveis faixa etária, presença de sinais clínicos e presença de outra espécie animal co-habitando com os cães avaliados, tendo sido as galinhas mais freqüentemente observadas entre os animais soropositivos. O sexo, a coleta de lixo domiciliar bem como a renda familiar não apresentaram associação estatisticamente significativa com a prevalência da leishmaniose visceral canina. A análise dos resultados sugere que cães com idade superior a sete anos e a , presença de outra espécie animal co-habitando com os cães podem ser fatores de risco para a leishmaniose visceral canina.Dogs play an important role as reservoir in the domestic cycle of visceral leishmaniasis, a serious public health problem. An epidemiological survey in 1,112 dogs was conducted at the Municipality of Poxoréo State of Mato Grosso, Brazil, using indirect immunofluorescence antibody test where the prevalence was 7.8%. Significant association was found between prevalence of canine visceral leishmaniasis and age of the dogs. Clinical signs and presence of other animals in the backyard, like chicken being more likely associated with seropositivity. Gender, garbage collection in the residence and family financial income were not associated with visceral leishmaniasis prevalence. Analysis of the results suggests that dogs aging more than 7 years and presence of another animal species co-inhabiting with the dogs may be risk factors for canine visceral leishmaniasis.

  13. Evaluación del efecto analgésico postoperatorio de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía Evaluation of postoperative analgesic effect of intraoperative infusions of tramadol and tramadol/lidocaine/ketamine compared with morphine/lidocaine/ketamine in female dogs undergoing ovariohysterectomy

    OpenAIRE

    MA Fajardo; MA Lesmes; LA Cardona

    2012-01-01

    El objetivo de este estudio fue evaluar y comparar la eficacia analgésica postoperatoria de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía. Se usaron 30 hembras caninas sin distinción de raza con una edad entre 1 y 10 años y un peso entre 2,5 y 37 kilogramos, conformando tres grupos aleatorios de 10 animales cada uno: grupo tramadol, grupo tramadol/lidocaína/ ketamina y grup...

  14. Matrix metalloproteinases 2 and 9 expression in canine normal prostate and with proliferative disorders Expressão de metaloproteinases de matriz 2 e 9 na próstata canina normal e com lesões proliferativas

    Directory of Open Access Journals (Sweden)

    Mariana Batista Rodrigues Faleiro

    2013-06-01

    Full Text Available In this study the expression of metalloproteinases 2 (MMP-2 and 9 (MMP-9 in canine normal prostates and with proliferative disorders was evaluated to verify the role of these enzymes in extracellular matrix remodeling (ECM and in the tissue invasion process. A total of 355 prostatic samples were obtained, from which 36 (10.1% were normal prostates, 46 (13.0% with benign prostatic hyperplasia (BPH, 128 (36.1% with proliferative inflammatory atrophy (PIA, 74 (20.8% with prostatic intraepithelial neoplasia (PIN, and 71 (20.0% with prostatic carcinoma (PC. Difference in cytoplasmic immunohistochemical staining of MMP-2 and MMP-9 between acinar epithelium and periacinar stroma was found regarding the different diagnosis. The correlation between MMP-2 and MMP-9 expression in relation to the number of labeled cells in acinar epithelium and periacinar stroma, as well as to the staining intensity in the periacinar stromal cells was evidenced in canine prostates with PIA. In conclusion, MMP-2 and MMP-9 expression has a variation in canine prostate according to the lesion, with lower expression in normal tissue and with BPH, and higher expression in those with PIA, PIN and PC. Moreover, the inflammatory microenvironment of the PIA has influence in the activity of both enzymes.Este estudo teve como objetivo avaliar a expressão das metaloproteinases 2 (MMP-2 e 9 (MMP-9 em próstatas caninas normais e com desordens proliferativas, verificando o papel dessas enzimas na remodelação da matriz extracelular (MEC e no processo de invasão tecidual. Um total de 355 amostras prostáticas foram obtidas, sendo 36 (10,1% normais, 46 (13,0% com hiperplasia prostática benigna (HPB, 128 (36,1% com atrofia inflamatória proliferativa (PIA, 74 (20,8% com neoplasia intraepitelial prostática (PIN e 71 (20,0% com carcinoma prostático (CP. Houve diferença de imunomarcação citoplasmática para MMP-2 e MMP-9 entre o epitélio acinar e o estroma periacinar, quanto aos

  15. Accidentes por mordedura canina, casos registrados en un hospital de niños de Lima, Perú 1995 - 2009 Dog bite accidents in a children hospital at Lima, Peru. Retrospective study from 1995 - 2009

    OpenAIRE

    Carmen Morales; Néstor Falcón; Henry Hernández; Carla Férnandez

    2011-01-01

    Entre 1995 a 2009 se registraron 206 hospitalizaciones en el Instituto Nacional de Salud del Niño debido a accidentes por mordedura canina. La mediana de edad de los pacientes fue cuatro años y para los días de hospitalización tres. El 61,7 % fueron varones. Los accidentes ocurrieron en el domicilio de una tercera persona (39,3 %), en vía pública (33,5 %) y en el domicilio del agredido (27,2 %). El 66,5 % de los episodios fueron precedidos por un estímulo del niño y el 88,8 % causado por anim...

  16. Lesões histológicas no sistema nervoso central de cães com encefalite e diagnóstico molecular da infecção pelo vírus da cinomose canina

    OpenAIRE

    Gebara C.M.S.; Wosiacki S.R.; Negrão F.J.; Alfieri A.A.; Alfieri A.F.

    2004-01-01

    Dez amostras de urina de cães que apresentavam sinais clínicos sistêmicos e neurológicos indicativos da infecção pelo vírus da cinomose canina (CDV) foram analisadas pela técnica da reação em cadeia pela polimerase precedida de transcrição reversa (RT-PCR) para a detecção do RNA do CDV. O exame histopatológico foi realizado em fragmentos de cérebro, cerebelo e bexiga. Como controle negativo foram colhidos fragmentos de órgãos e urina de quatro cães sem sinais clínicos de doença infecciosa e q...

  17. Isolation of Candida spp from vaginal microbiota of healthy canine females during estrous cycle Isolamento de Candida spp da microbiota vaginal de fêmeas caninas hígidas durante o ciclo estral

    Directory of Open Access Journals (Sweden)

    Marlete Brum Cleff

    2005-06-01

    Full Text Available Yeasts are commensal organisms found in the skin, genital and gastrointestinal tracts, and other mucosa in mammalians. Candida spp has been frequently isolated from domestic and sylvan animals. Yeast isolation from vaginal mucus is frequent in women, especially of Candida genus. In canine females, however, studies about vaginal fungal microbiota are rare and the connection with estrous cycle is unknown. The purpose of this study was to isolate yeast 5 of Candida genus from healthy canine females and identify the isolated species, establishing their connection with estrous cycle phases. Two hundred twenty-four samples taken from vaginal mucus of 14 canine females were analyzed in this study. Candida spp was observed in 83 (37% from these samples; nine samples were taken in proestrus, 14 in oestrus, 31 in dioestrus, 24 in anoestrus and five samples were obtained during pregnancy. Candida parapsilosis the most frequently isolated specie (21.7%, followed by C. guillermondii (8.4%, C. kefir (6% and C. albicans (4.8%. We concluded that Candida spp is a commion component of healthy canine females' vaginal microbiota, and isolation varies according to the estrous cycle phase.As leveduras são organismos comensais da pele, trato genital e gastrointestinal, e de outras mucosas de mamíferos. O gênero Candida vem sendo isolado freqüentemente de animais domésticos e silvestres. O isolamento de Candida spp da mucosa vaginal de mulheres é freqüente, porém na espécie canina são escassos os estudos referentes à microbiota fúngica vaginal, especialmente do gênero candida, não se tendo conhecimento de sua relação com o ciclo reprodutivo. O presente trabalho teve como objetivo isolar leveduras do gênero Candida em fêmeas caninas hígidas e identificar as espécies isoladas, relacionando-as com as diferentes fases do ciclo estral. Foram analisadas 224 amostras obtidas da mucosa vaginal de 14 fêmeas caninas. Candida spp foi observada em 83 (37

  18. Bioloģiski aktīvo vielu satura izvērtējums mežrozīšu augļu (Rosa canina) ekstraktos

    OpenAIRE

    Oliņa, Madara

    2016-01-01

    Bioloģiski aktīvo vielu satura izvērtējums mežrozīšu augļu (Rosa canina) ekstraktos. Oliņa M., darba vadītāja Dr. ķīm., asoc. prof. Jākobsone I., Maģistra darbs, 83 lappuses, 29 attēli, 10 tabulas, 79 literatūras avoti, 8 pielikumi. Latviešu valodā. Darbā ir apkopota informāciju par dažāda veida augu ekstraktiem, ekstrakciju, ekstrakcijas metodēm, mežrozītes augļiem, tajos esošajām bioloģiski aktīvajām vielām un to satura noteikšanas metodēm. Titrimetriski noteikts askorbīnskābes un brīvo org...

  19. Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris).

    Science.gov (United States)

    Dubey, Jitender P; Sykes, Jane E; Shelton, G Diane; Sharp, Nick; Verma, Shiv K; Calero-Bernal, Rafael; Viviano, Jenifer; Sundar, Natarajan; Khan, Asis; Grigg, Michael E

    2015-01-01

    There are several reports of Sarcocystis sarcocysts in muscles of dogs, but these species have not been named. Additionally, there are two reports of Sarcocystis neurona in dogs. Here, we propose two new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in four domestic dogs (Canis familiaris), one each from Montana and Colorado in the USA, and two from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy (TEM), and polymerase chain reaction. Based on collective results two new species, S. caninum and S. svanai were designated. Sarcocystis caninum and S. svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By TEM, the sarcocyst wall was "type 9", 1-2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7-9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were "type 1", thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multilocus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to Sarcocystis canis or Sarcocystis arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica, a

  20. Canine ehrlichiosis: clinical, hematological, serological and molecular aspects Erliquiose canina: aspectos clínicos, hematológicos, sorológicos e moleculares

    Directory of Open Access Journals (Sweden)

    Andréa Cristina Higa Nakaghi

    2008-06-01

    écnicas, concluiu-se que a sorologia e a nPCR são testes adequados para a confirmação do diagnóstico da erliquiose canina. Entretanto, os resultados destas técnicas devem sempre ser complementares ao exame clínico e hematológico. A sorologia tem um importante papel nas fases subclínica e crônica da doença, por isso recomenda-se a nPCR para o diagnóstico na fase aguda e, especialmente, para a identificação da espécie de erliquia envolvida.

  1. Retrospective study (1998-2001 on canine ehrlichiosis in Belo Horizonte, MG, Brazil Estudo retrospectivo (1998 a 2001 da erliquiose canina em Belo Horizonte

    Directory of Open Access Journals (Sweden)

    S.M. Moreira

    2003-04-01

    . O número de diagnósticos de erliquiose aumentou consideravelmente a partir de 2000, sendo que 24,4% dos casos ocorreram em animais entre 13 e 24 meses de idade na cidade de Belo Horizonte e áreas peri-urbanas, verificando-se maior risco de infecção em animais que residiam em casas. Os sintomas mais freqüentes foram febre, anorexia, apatia, dor abdominal, linfadenopatia e dispnéia. Quanto às alterações hematológicas, 70,3% apresentaram anemia, 50% trombocitopenia e 30% leucopenia e a maioria das infecções por E. canis foi visualizada em monócitos. Os resultados apontam para a necessidade de maior atenção por parte dos clínicos e técnicos para a erliquiose canina uma vez que 35,9% dos cães atendidos com suspeita de hemoparasitoses apresentavam infecções por E. canis ou E. platys.

  2. Denervação capsular percutânea no tratamento da displasia coxofemoral canina Percutaneous hip denervation for the treatment of canine hip dysplasia

    Directory of Open Access Journals (Sweden)

    André Luis Selmi

    2009-04-01

    Full Text Available A displasia coxofemoral canina (DCF é uma afecção ortopédica freqüente, comumente dolorosa, decorrente de instabilidade e que leva à doença articular degenerativa. Várias formas de tratamento cirúrgico são descritas, entre elas a denervação capsular a céu aberto. Neste trabalho, é descrita a denervação capsular percutânea e seus efeitos em 92 cães com sensibilidade dolorosa na articulação do quadril atribuída à DCF. Foram avaliados os seguintes aspectos: o grau de claudicação (CLAUD, a dor por escala analógica visual, a perimetria da coxa (PC e os graus máximos de extensão (GME e flexão (GMF passiva do quadril imediatamente antes da cirurgia e aos sete, 15, 30, 180 e 360 dias de pós-operatório (p.o.. Os animais foram pré-medicados e submetidos à anestesia geral inalatória e, posteriormente, a borda acetabular crânio-dorsal foi denervada por meio da introdução percutânea de um pino de Steinman com aproximadamente 4,5mm de diâmetro. A CLAUD e a dor foram analisadas por meio da ANOVA e do teste de Friedman. A PC, a GME e a GMF foram analisadas por meio da ANOVA e do teste de Tukey. Foi observada melhora significativa na CLAUD e dor a partir dos 15 dias de p.o. A GME apresentou aumento significativo já aos 30 dias de p.o., enquanto que a PC apresentou aumento significativo após os 60 dias de p.o. Conclui-se que a denervação capsular percutânea é alternativa cirúrgica eficaz em restabelecer a movimentação do quadril displásico e promove melhora significativa da dor e claudicação.Canine hip dysplasia is a common painfull orthopedic disorder, resulting from articular instability and causing degenerative joint disease. Several treatment options are available, including capsular denervation. This study describes the results of percutaneous capsular denervation in 92 dogs diagnosed with hip dysplasia. Lameness (LAM and pain on palpation (PN were determined using a visual analogue scale (VAS, muscle girth

  3. Caracterización de un dispositivo intrauterino para controlar la natalidad canina - Characterization of Intrauterine devices for the canine birth-rate control

    Directory of Open Access Journals (Sweden)

    Mendoza Escanell, Pastor Felipe

    2010-03-01

    Full Text Available ResumenEn Cuba no se notifica el uso de ningún dispositivo intrauterino comométodo para controlar la reproducción de las mascotas caninas,empleándose sin embargo con frecuencia la esterilización quirúrgica, apesar de los riesgos que ésta implica. Las causas son: falta deinformación, desconocimiento de las ventajas de un DIU, einexistencia de dispositivos adecuados. En este trabajo proponemos lautilización de Dispositivo Intrauterino Canino (DIUC como medio pararesolver esa situación donde se evaluó la efectividad del dispositivo y se comparó con la técnica de ovario - histerectomía (OVH en cuanto a riesgos de realización, tiempo de recuperación, complicaciones,aumento de peso del animal y una valoración parcial de los costos. Eltrabajo se desarrolló durante un año en la clínica de animales afectivos del municipio de las Tunas con 21 perras adultas fértiles entre 10 y 25 Kg de peso. El DIUC fue elaborado en plástico recubierto de cobre y con un dispositivo adicional para su implantación. La recuperación total con el DIUC fue como máximo de 6 horas, mientras con la OVH fue necesario un mínimo de 8 días hasta la retirada de los puntos. Las complicaciones con el DIUC fueron casi nulas no así en el caso de OVH y las perras con OVH incrementaron significativamente su peso corporal.SummaryIn Cuba there is not record the use of any IUD as a method to controlof the reproduction canine mascots, however, surgery sterilization iscommonly used. There are many reasons for not using this method: The lack information, people don’t know the advantages of IUD, thereis not adequate devices. In our work we propose the use ofintrauterine canine devices (IUCD as a way to resolve this situation,where it we evaluated the effectiveness of this device and alsocompared with the ovary-hysterectomy (OVH when applying it, timeof recovering, complications, increment of animal’s weight, and costs – benefits relation. This work was developed

  4. Biomarkers in Canis lupus familiaris

    OpenAIRE

    Fernandes, Mónica Figueiredo

    2014-01-01

    Introdução- Os animais de companhia como o cão desempenham hoje um papel a nível familiar e social importante podendo atuar como agentes em programas terapêuticos e de socorrismo. A qualidade de vida dos animais de companhia e o correspondente impacto na saúde pública pode beneficiar com o diagnóstico precoce e a intervenção terapêutica adequada. Com a evolução das abordagens Ómicas, nomeadamente dos estudos de proteómica foi gerado um grande volume de dados que retratam ...

  5. Estimativa de populações canina e felina domiciliadas em zona urbana do Estado de São Paulo Estimate of the owned canine and feline populations in urban area in Brazil

    Directory of Open Access Journals (Sweden)

    Ricardo Augusto Dias

    2004-08-01

    Full Text Available OBJETIVO: Dada a importância do conhecimento acerca da população de cães e gatos domiciliados para o adequado planejamento e avaliação das ações de controle da raiva em áreas urbanas, propõe-se a utilização de um valor preciso de estimativa dessas populações com base em indicadores populacionais humanos. MÉTODOS: Foi calculada a razão entre as populações humana e animal (canina e felina por meio de inspeções domiciliares, no Município de Taboão da Serra, SP. O município foi dividido em duas áreas homogêneas distintas socioeconomicamente, de acordo com o algoritmo da média k, de modo a permitir a comparação das razões homem:animal (cão e gato das áreas homogêneas. RESULTADOS: A razão entre a população humana e a população canina foi 5,14 e a entre a humana e a felina foi 30,57. Não foi observada diferença significativa ao comparar-se as razões entre as populações humana e animal das áreas homogêneas. CONCLUSÕES: A adoção de uma metodologia de estimativa populacional canina e felina domiciliada, baseada em indicadores populacionais humanos, é a mais indicada e facilmente exeqüível quando comparada ao censo canino.OBJECTIVE: Given the importance of assessing owned dog and cat populations to adequate planning and evaluation of rabies control measures in urban areas, it is proposed the use of an estimate of these populations based on human population parameters. METHODS: The ratio between human population and owned animal (dogs and cats population was calculated in the municipality of Taboão da Serra, state of São Paulo, Brazil. This municipality was divided into two distinct social and economic homogeneous areas through k-mean algorithm, allowing for comparison between the ratios of the two homogeneous areas. RESULTS: A 5.14 ratio was calculated for human and dog populations and a 30.57ratio for human and feline populations. A significant difference was not observed when comparing the ratios for

  6. Accidentes por mordedura canina, casos registrados en un hospital de niños de Lima, Perú 1995 - 2009 Dog bite accidents in a children hospital at Lima, Peru. Retrospective study from 1995 - 2009

    Directory of Open Access Journals (Sweden)

    Carmen Morales

    2011-12-01

    Full Text Available Entre 1995 a 2009 se registraron 206 hospitalizaciones en el Instituto Nacional de Salud del Niño debido a accidentes por mordedura canina. La mediana de edad de los pacientes fue cuatro años y para los días de hospitalización tres. El 61,7 % fueron varones. Los accidentes ocurrieron en el domicilio de una tercera persona (39,3 %, en vía pública (33,5 % y en el domicilio del agredido (27,2 %. El 66,5 % de los episodios fueron precedidos por un estímulo del niño y el 88,8 % causado por animales reconocidos por los lesionados. El 34,0 % reconoció la raza del animal (52,9 % animales cruzados. El 79,1 % fueron lesiones múltiples y la región anatómica más afectada fueron la cabeza y cuello (79,1 %. Se registraron complicaciones en un 20,4 % y secuelas estéticas en el 94,7 %. Las mordeduras caninas afectan la salud física de los niños.From 1995 to 2009, 206 cases of dog bites were recorded among hospitalized patients at the Children National Health of, Lima-Peru. The median of age was 4 years, and for hospitalization time was 3 days. Most patients were males (61.7 %. The bites occurred in the house of a third person (39.3 %, on the street (33.5 %, or in the victim’s house (27.2 %. A 66.5 % of the bites were provoked and 88.8 % were from animals known to the victim. The dog breed was recognized in 34 % (52.9 % were mongrel dogs. Multiple lesions were identified in 79.1 %, and the most frequently bitten areas were head and neck (79.1 %. Complications were reported in 20.4 % and aesthetic sequelae in 94.7 %.

  7. Iris Recognition System using canny edge detection for Biometric Identification

    OpenAIRE

    Bhawna Chouhan; Dr.(Mrs) Shailja Shukla

    2011-01-01

    biometric system provides automatic identification of an individual based on a unique feature or characteristic possessed by the individual. Iris recognition is regarded as the most reliable and accurate biometric identification system available. Most commercial iris recognition systems use patented algorithms developed by Daugman, and these algorithms are able to produce perfect recognition rates. Especially it focuses on image segmentation and feature extraction for iris recognition process...

  8. Image Steganography based on a Parameterized Canny Edge Detection Algorithm

    OpenAIRE

    Bassil, Youssef

    2012-01-01

    Steganography is the science of hiding digital information in such a way that no one can suspect its existence. Unlike cryptography which may arouse suspicions, steganography is a stealthy method that enables data communication in total secrecy. Steganography has many requirements, the foremost one is irrecoverability which refers to how hard it is for someone apart from the original communicating parties to detect and recover the hidden data out of the secret communication. A good strategy t...

  9. Aspectos biomecânicos compressivos de diáfises femorais caninas conservadas em glicerina a 98% ou em mel Biomechanical compressive aspects of canine femoral shafts preserved in 98% glycerin or honey

    Directory of Open Access Journals (Sweden)

    Gustavo Frassetto Amendola

    2008-08-01

    Full Text Available Neste estudo foi comparada a resistência compressiva axial de diáfises femorais caninas a fresco (grupo F, conservadas por trinta dias em glicerina a 98% (grupo G ou em mel (grupo M. Cada grupo continha 50 amostras que foram submetidas a testes biomecânicos compressivos, em uma prensa de compressão axial, até ocorrer fissura. Os ossos conservados em glicerina ou mel foram reidratados antes da avaliação. Pelos resultados obtidos, foi verificada maior resistência nos ossos conservados em glicerina, depois nos ossos conservados em mel, sendo mais frágeis aqueles testados a fresco.This study aimed at evaluating the axial compressive resistance of fresh canine femoral shafts (group F, canine femoral shafts preserved in 98% glycerin (group G or honey (group M for a 30-day period. The femoral shafts (50 samples in each group were submitted to biomechanical evaluation in a machine of axial compression in order to observe the pressure necessary to determine bone fissure. The shafts preserved in 98% glycerin or honey were rehydrated in saline 0.9% before evaluation. Bones stored in 98% glycerin have more resistance than bones preserved in honey and fresh implants presented the worst performance.

  10. Investigação de áreas de risco como metodologia complementar ao controle da leishmaniose visceral canina Investigation of risk areas as complemental methodology for the control of canine visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Fred S. Julião

    2007-08-01

    Full Text Available Foram investigadas áreas de risco de leishmaniose visceral canina no município de Camaçari, Bahia. Um total de 278 cães distribuídos em 141 residências, pertencentes a 20 áreas de risco investigadas, foi examinado sorologicamente (ELISA. A soroprevalência geral foi 21,7% (56/258 depois da exclusão dos 20 cães usados no início do estudo para delimitar a área. Os resultados respectivos das análises univariada e multivariada dos fatores relacionados à infecção do cão por Leishmania chagasi, a captura e distribuição do vetor na área e a metodologia usada para localizar os focos caninos são discutidos.Risk areas of canine visceral leishmaniasis in the city of Camaçari, Bahia, Brazil, were investigated. A total of 278 dogs from 141 homes pertaining to 20 investigated risk areas was serologically screened (ELISA. The general seroprevalence was 21.7% (56/258 after exclusion of 20 dogs used at the beginning of the survey to limit the study area. The respective results of the univariated and multivariated analysis of factors related to infection of dogs by Leishmania chagasi, to vector distribu-tion pattern in the area and to the methodology used to localize the canine focuses are discussed.

  11. Botanical Extracts from Rosehip (Rosa canina, Willow Bark (Salix alba, and Nettle Leaf (Urtica dioica Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes

    Directory of Open Access Journals (Sweden)

    Mehdi Shakibaei

    2012-01-01

    Full Text Available The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina, willow bark (Salix alba, and nettle leaf (Urtica dioica in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG, β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was examined by western blotting. Results. The botanical extracts suppressed IL-1β-induced NF-κB activation by inhibition of IκBα phosphorylation, IκBα degradation, p65 phosphorylation, and p65 nuclear translocation. These events correlated with downregulation of NF-κB targets including COX-2 and MMPs. The extracts also reversed the IL-1β-induced downregulation of collagen type II, CSPG, β1-integrin, and cartilage-specific transcription factor SOX-9 protein expression. In high-density cultures botanical extracts stimulated new cartilage formation even in the presence of IL-1β. Conclusions. Botanical extracts exerted anti-inflammatory and anabolic effects on chondrocytes. The observed reduction of IL-1β-induced NF-κB activation suggests that further studies are warranted to demonstrate the effectiveness of plant extracts in the treatment of OA and other conditions in which NF-κB plays pathophysiological roles.

  12. Factores que influyen sobre la epidemiología de la leishmaniosis canina y sus vectores en la Comunidad de Madrid: obtención de modelos predictivos de riesgo mediante sistemas de información geográfica

    OpenAIRE

    Gálvez Esteban, Rosa

    2010-01-01

    La leishmaniosis es una zoonosis endémica en la cuenca mediterránea. El perro es el principal reservorio doméstico de Leishmania infantum. La leishmaniosis canina (Lcan) representa no sólo un problema de índole veterinario sino también de salud pública, debido al alto porcentaje de perros infectados en zonas endémicas. En los trabajos presentados en esta Tesis Doctoral se evalúan los factores sociodemográficos, epidemiológicos, medioambientales y meteorológicos que pueden estar influyendo sob...

  13. Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda Vascular reactivity of the internal mammary artery: comparative pharmacological studies between canine right and left arteries

    OpenAIRE

    Evora, Paulo Roberto B.; PEARSON Paul J.; OELTJEN Marilyn; DISCIGIL Berent; Schaff, Hartzell V.

    1999-01-01

    Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI) canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers") e ensaios biológicos: 1) os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2) os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3) o A23187, vasodila...

  14. Prevalência da infecção canina em áreas endêmicas de leishmaniose tegumentar americana, do município de Paracambi, Estado do Rio de Janeiro, no período entre 1992 e 1993

    OpenAIRE

    Santos Ginelza Peres Lima dos; Sanavria Argemiro; Marzochi Mauro Célio de Almeida; Santos Elizabeth Glória Oliveira Barbosa dos; Silva Valmir Laurentino; Pacheco Raquel da Silva; Mouta-Confort Eliame; Espíndola Cleber Barreto; Souza Marcos Barbosa de; Ponte Cesar Santos; Conceição Nilton Francisco da; Andrade Moacir Vieira de

    2005-01-01

    No município de Paracambi, Estado do Rio de Janeiro, foi realizado um inquérito epidemiológico sobre a leishmaniose tegumentar americana na população canina residente em áreas endêmicas rural e semiurbana. Foram cadastrados 179 cães e 138 (77,1%) foram examinados, segundo seus aspectos clínicos e desenvolvimento de hipersensibilidade tardia ao antígeno Imunoleish® e respostas sorológicas à reação de imunofluorescência indireta e ao ensaio imunoenzimático. Dos 9 (6,5.%) animais portadores de l...

  15. Prevalência da infecção canina em áreas endêmicas de leishmaniose tegumentar americana, do município de Paracambi, Estado do Rio de Janeiro, no período entre 1992 e 1993 Prevalence of canine infection from endemic areas of American cutaneous leishmaniasis in Paracambi District, Rio de Janeiro State, between 1992 and 1993

    OpenAIRE

    Ginelza Peres Lima dos Santos; Argemiro Sanavria; Mauro Célio de Almeida Marzochi; Elizabeth Glória Oliveira Barbosa dos Santos; Valmir Laurentino Silva; Raquel da Silva Pacheco; Eliame Mouta-Confort; Cleber Barreto Espíndola; Marcos Barbosa de Souza; Cesar Santos Ponte; Nilton Francisco da Conceição; Moacir Vieira de Andrade

    2005-01-01

    No município de Paracambi, Estado do Rio de Janeiro, foi realizado um inquérito epidemiológico sobre a leishmaniose tegumentar americana na população canina residente em áreas endêmicas rural e semiurbana. Foram cadastrados 179 cães e 138 (77,1%) foram examinados, segundo seus aspectos clínicos e desenvolvimento de hipersensibilidade tardia ao antígeno Imunoleish® e respostas sorológicas à reação de imunofluorescência indireta e ao ensaio imunoenzimático. Dos 9 (6,5.%) animais portadores de l...

  16. Effects of glutamine combined with panthenol on intestinal injury in burned canis familiaris%谷氨酰胺联合泛醇对烧伤家犬肠道损伤的影响及机制研究

    Institute of Scientific and Technical Information of China (English)

    王裴; 赵云; 戚华兵; 彭曦; 尤忠义; 汪仕良

    2012-01-01

    目的 观察应用谷氨酰胺、泛醇及其复方制剂对减轻烧伤家犬肠道损伤的疗效并探讨其机制.方法 采用30%体表面积Ⅲ度烧伤家犬模型,动物随机分为正常对照、烧伤对照、泛醇、谷氨酰胺、泛醇+谷氨酰胺5个组,每组6只家犬,观察伤后7 d各组动物肠道损伤和修复指标.结果 烧伤家犬乙酰胆碱、肠黏膜蛋白含量明显降低,血浆二胺氯化酶(DAO)含量和损伤指数则明显增高(P<0.05),给予谷氨酰胺、泛醇以及复方药物均可明减轻烧伤后肠道损伤,降低血浆DAO活性和黏膜损伤指数(P<0.05);给予泛醇则能明显增加乙酰胆碱合成.与单方组相比,复方制剂组上述各项指标均明显优于单方组.结论 烧伤后肠道损伤明显,给予谷氨酰胺能明显减轻肠道损伤,给予泛醇能明显促进乙酰胆碱合成,促进胃肠运动,复方制剂疗效明显优于单方.%Objective To observe the effects of glutamine , panthenol and its compound preparation on lessening intestinal injury in burned canis familiaris . Methods Thirty canis familiaris were randomly divided into five groups , i. e. normal control ( C) group, burn control (B) group, glutamine group , panthenol group and its compound preparation group. Burned canis familiaris were inflicted with 30% TBSA full thickness burn injury. Observe the intestinal injury and repair post burn 7 d. Results After burn injury , the activity of plasma diamine oxidase (DAO) , intestine mucosal damage index were significantly higher , and the contents of intestine mucosal protein and plasma acetylcholine were remarkable decrease than those of C group (P < 0. 05 ). Compare with B group , the activity of plasma DAO, intestine mucosal damage index were markedly decreased in glutamine group , and the plasma acetylcholine contents was significantly increased in panthenol group . Compare with simple recipe group , there were more conspicuous therapeutic effect on compound preparation

  17. Efectos terapéuticos del Oleozón en la Piodermitis Canina, considerando algunos procedimientos microbiológicos y micológicos - Therapeutic effects Oleozon in Piodermitis Dog, considering somme microbiological processes and mycological

    Directory of Open Access Journals (Sweden)

    Camps, Ana María

    2009-12-01

    Full Text Available ResumenLa investigación se realizó en el Consejo Popular Pedro Pompaperteneciente al municipio de Bayamo. Fueron analizados 70 canesmestizos, de ellos, 20 resultaron positivos a la Piodermitis Canina. Se tuvo en cuenta la edad, características de la lesión y factorespredisponentes. Se formaron cuatro grupos de cinco animales cada uno(A, (B, (C, (D. A cada mascota se le realizó el examen clínico porsistemas incluyendo la tríada (frecuencia respiratoria, frecuencia delpulso y temperatura. Luego se analizó la anamnesis de cada caso conmucha profundidad tratando de sensibilizar a los propietarios paraaportar la totalidad de los datos a la investigación. Al grupo (A, se le aplicó Oleozón 1 vez al día; al grupo (B Oleozón 2 veces al día; al grupo (C, Gentamicina Crema al 0.1% 1 vez al día y al grupo (DGentamicina Crema al 0.1% 2 veces al día. La duración de lostratamientos fue de siete días. Se evaluó la efectividad de los diferentes tratamientos, obteniéndose los mejores resultados en el grupo B (4.2 días para p < 0.05 con relación a los restantes concluye que el uso tópico del Oleozón durante siete días fue efectivo para el tratamiento de la Piodermitis Canina. El principal agente causal aislado fue el Staphylococcus intermedius, teniendo como causas primarias: parasitosis externa, heridas por peleas, intoxicación y quemaduras. SummaryThe investigation was carried out in the Popular Council Pedro Pompabelonging to the municipality of Bayamo. Seventhly mestizo dogs wereanalyzed, of them, 20 were positive to the Canine Piodermitis. One kept in mind the age, characteristic of the lesion and factors predisponentes.They were formed four groups of five animals each one (A, (B, (C,(D. To each mascot was carried out the clinical exam by systemsincluding the triad (breathing frequency, frequency of the pulse andtemperature. Then the anamnesis of each case was analyzed with a lotof depth trying to sensitize the proprietors to

  18. Identificación por PCR de Brucella canis en sangre y leche canina: Reporte de un caso PCR identification of Brucella canis in canine blood and milk: A case report

    Directory of Open Access Journals (Sweden)

    M Olivera

    2011-01-01

    Full Text Available La brucelosis canina, producida por Brucella canis, es una enfermedad asociada a problemas reproductivos y de carácter zoonótico. Estas bacterias son excretadas en orina, leche, fetos o semen de los animales infectados y la transmisión ocurre por contacto vía sexual, oral, nasal o conjuntival. El diagnóstico de rutina se realiza por serología, pero la confirmación requiere aislamiento del cultivo bacterial, lo cual es costoso y requiere laboratorios con nivel 3 de bioseguridad. Las técnicas moleculares son una posibilidad reconocida para determinar el ADN bacterial, con alta especificidad y sensibilidad. Este reporte evaluó como prueba de aplicación clínica una técnica de PCR desarrollada para cultivos bacteriales. A una hembra canina asintomática, con historia previa de la enfermedad, amamantando una camada sana de 4 días de nacidos, se le realizó la prueba serológica rápida en placa con 2ß-mercaptoetanol, hemocultivo y PCR, de leche y de sangre. Todas las pruebas fueron positivas a Brucella canis. Este es el primer reporte de diagnóstico en leche por PCR, lo que corrobora que animales clínicamente asintomáticos eliminan la bacteria por esta vía, lo que constituye un riesgo de infección para los neonatos y el riesgo zoonótico para veterinarios, propietarios del animal o personas que intervengan en el parto si no se toman medidas higiénicas preventivas.Canine brucellosis is a disease caused by Brucella canis that is associated to reproductive problems in dogs, and it is also known as zoonosis. These bacteria are excreted in urine, milk, fetus or semen of infected animals, and the transmission occurs via sexual, oral, nasal or conjunctival contact. Diagnosis is usually done through serology but confirmation requires isolation of bacterial culture, a costly process that requires laboratory biosafety level 3. Molecular techniques are a valid method to determine the bacterial DNA, offering high specificity and sensitivity

  19. Análisis coste-beneficio y coste-efectividad, de las nuevas alternativas de inmunización surgidas en el mercado para la prevención de la leishmaniosis canina en las Fuerzas Armadas

    Directory of Open Access Journals (Sweden)

    M.B. Salinas Granell

    2013-12-01

    Full Text Available Antecedentes y objetivos: La incorporación de estudios epidemiológicos y métodos de análisis de costes suponen herramientas de primer orden dentro de la Sanidad Militar. Permiten optimizar los recursos y estructuras disponibles, manteniendo así la eficacia y efectividad en la lucha frente a las enfermedades, una de ellas la Leishmaniosis. La epidemiología de campo, se nos presenta como una útil herramienta para alcanzar nuestro objetivo sanitario estratégico que es el de controlar esta enfermedad. La leishmaniosis canina es una de las parasitosis de mayor repercusión en las Fuerzas Armadas tanto desde el punto de vista de salud pública como de operatividad de nuestros perros de trabajo militar. El trabajo tiene como objetivo comparar el coste-beneficio (C-B de dos tipos de vacunas con los costes que supondría la externalización de los servicios. Para ello se analiza el coste-efectividad (C-E, que supondría ampliar el actual programa de vacunación, con la incorporación de la nueva vacuna frente a LI (CaniLeish®, y analizar el coste-efectividad (C-E que supondría ampliar el actual programa preventivo antivectorial con la adquisición de un nuevo medicamento preventivo frente a LI (Leisguard®. Material y Método: Se ha estimado mediante el análisis coste-beneficio y coste-efectividad, la eficiencia que supondría, teniendo en cuenta la seroprevalencia actual, el ampliar el existente programa preventivo con la adquisición de las nuevas alternativas de inmunización (vacunación y uso de domperidona surgidas en el mercado frente a la leishmaniosis canina. Requiriéndose una valoración monetaria apropiada de los efectos sobre la salud de las alternativas evaluadas. Resultados: Se obtuvo que los costes globales de ambas alternativas son superiores al coste del tratamiento de la enfermedad, con relaciones coste-beneficio y coste-efectividad negativas (en términos de coste por mantenimiento de operatividad del efectivo canino, es

  20. Amiodarona causa vasodilatação dependente do endotélio em artérias coronárias caninas Amiodarone causes endothelium-dependent vasodilation in canine coronary arteries

    Directory of Open Access Journals (Sweden)

    Alfredo José Rodrigues

    2005-03-01

    Full Text Available OBJETIVO: Avaliar os efeitos vasodilatadores da amiodarona em artérias coronárias caninas empregando soluções de amiodarona dissolvida em polisorbato 80 ou em água. MÉTODOS: Anéis de artéria coronária, com e sem o endotélio íntegro, foram imersos em solução de krebs e conectadas a um transdutor para aferição de força isométrica promovida por contração vascular. As artérias foram expostas a concentrações crescentes de polisorbato 80, amiodarona dissolvida em água, amiodarona dissolvida em polisorbato 80 e uma apresentação comercial da amiodarona (Cordarone®. Os experimentos foram conduzidos na presença e na ausência dos seguintes bloqueadores enzimáticos: apenas indometacina, Nômega-nitro-L-arginina associada à indometacina e apenas Nômega-nitro-L-arginina. RESULTADOS: O polisorbato 80 causou pequeno relaxamento não dependente do endotélio. O Cordarone®, a amiodarona dissolvida em água e em polisorbato 80 promoveram relaxamento dependente do endotélio, que foi de maior magnitude para a amiodarona dissolvida em polisorbato e para o Cordarone®. Apenas a associação de indometacina com a Nômega-nitro-L-arginina foi capaz de abolir o relaxamento dependente do endotélio provocado pela amiodarona dissolvida em polisorbato 80. CONCLUSÃO: Os resultados obtidos indicam que a vasodilatação promovida pela amiodarona em artérias coronárias caninas é causada principalmente pela estimulação da liberação de óxido nítrico e fatores endoteliais relaxantes dependentes das ciclo-oxigenases.OBJECTIVE: To assess the vasodilating effects of amiodarone on canine coronary arteries by using solutions of amiodarone dissolved in polysorbate 80 or water. METHODS: Rings of coronary arteries, with or without intact endothelium, were immersed in Krebs solution and connected to a transducer for measuring the isometric force promoted by a vascular contraction. The arteries were exposed to increasing concentrations of

  1. Focos de dirofilariose canina na Ilha do Marajó: um fator de risco para a saúde humana Focus of canine heartworm disease in Marajó Island, North of Brazil: a risk factor for human health

    Directory of Open Access Journals (Sweden)

    Lourdes Maria Garcez

    2006-08-01

    Full Text Available A ocorrência de dirofilariose pulmonar humana relaciona-se com a prevalência de infecção por Dirofilaria immitis na população canina. Várias espécies de mosquitos são vetores desse nematóide. Analisaram-se amostras de sangue canino coletados nas vilas Pingo d'Água e União, município de Salvaterra (Ilha do Marajó, PA, em junho, 2004 (n=34 e abril, 2005 (N=90. Os diagnósticos parasitológico e imunológico (ELISA - kit SNAP® 3DX™, Biobrasil foram comparados (chi2, alfa=0,05 no exame de 34 amostras. A prevalência na população (N=90 foi avaliada pelo ELISA. O ELISA revelou mais positivos (25/34; 73,5% que a gota espessa (23/34, 67,6% e o Knott (21/34, 61,8%, mas a diferença não foi significativa (p>0,05. A freqüência de infecção por D. immitis na faixa de 0 a 2 anos foi 58%, enquanto em cães mais velhos foi 100%. A prevalência da dirofilariose canina em Pingo d'Água e Vila União foi alta (53,5%, indicando risco de transmissão do parasito às pessoas nessa área.The occurrence of human pulmonary dirofilariasis maintains a relation with the prevalence of Dirofilaria immitis infection in the canine population. Several mosquito species are vectors of this nematode. Canine blood samples collected in Pingo d'Água and União villages, Salvaterra municipality (Marajó Island, Pará, in June, 2004 (n=34 and April, 2005 (N=90 were analyzed. Parasitological and immunological (ELISA - kit SNAP® 3DX™, Biobrasil diagnoses were compared following the examination of 34 samples. The prevalence in the population (N=90 was evaluated by means of ELISA. ELISA revealed more positive samples (25/34; 73.5% than thick smears (23/34, 67.6% or Knott (21/34, 61.8%, but the differences were not significant (p>0.05. The frequency of D. immitis infection was 58% in dogs ranging from 0-2 years old, whereas in older dogs it was 100%. The prevalence of canine dirofilariasis was high in Pingo d'Água and Vila União (53.5%, indicating the risk of

  2. Achados patológicos e imuno-histoquímicos em cães infectados naturalmente pelo vírus da cinomose canina Pathologic and immunohistochemistry findings in dogs naturally infected by canine distemper virus

    Directory of Open Access Journals (Sweden)

    Luciana Sonne

    2009-02-01

    Full Text Available A cinomose canina é uma doença viral e afeta principalmente os sistemas respiratório, gastrintestinal e nervoso. Neste trabalho foram analisados os achados patológicos e imuno-histoquímicos de 54 cães com cinomose de um total de 760 cães necropsiados no período de julho de 2006 a outubro de 2007. As lesões macroscópicas observadas foram caracterizadas por corrimento ocular e nasal mucopurulentas, hiperqueratose dos coxins digitais, pulmões avermelhados e não colapsados, atrofia do timo, conteúdo intestinal diarréico e placas de Peyer proeminentes. Os achados histológicos caracterizavam-se principalmente por pneumonia intersticial, rarefação linfóide, desmielinização da substância branca, manguitos perivasculares e corpúsculos de inclusão intranucleares e intracitoplasmáticos, que se localizam principalmente na mucosa do estômago, epitélios da bexiga, brônquios e bronquíolos, pelve renal, coxins digitais, pálpebra, orelha e tonsila no sistema nervoso central e em células mononucleares dos linfonodos, baço e tonsilas. Os tecidos foram marcados pela técnica imuno-histoquímica utilizando anticorpo monoclonal anti-cinomose canina. O coxim digital foi o tecido com maior número de casos marcados positivamente (67,4% dos casos, seguido pelo estômago com 62,7%. A imuno-histoquímica mostrou ser uma ferramenta importante para o estudo da distribuição do antígeno em cães infectados pela cinomose bem como indicou o melhor tecido para a confirmação do diagnóstico de casos suspeitos.Canine distemper is a viral disease that affects mainly respiratory, gastrointestinal and nervous system. The present study analyzes pathologic and immunohistochemical findings in 54 dogs with canine distemper of a total of 760 canine necropsies performed from July 2006 to October 2007. The gross lesions were characterized by mucopurulent oculonasal discharge, hyperkeratosis of footpads, red and not collapsed lungs, thymic atrophy, watery

  3. Alpha linolenic acid (ALA) from Rosa canina, sacha inchi and chia oils may increase ALA accretion and its conversion into n-3 LCPUFA in diverse tissues of the rat.

    Science.gov (United States)

    Valenzuela B, Rodrigo; Barrera R, Cynthia; González-Astorga, Marcela; Sanhueza C, Julio; Valenzuela B, Alfonso

    2014-07-25

    Alpha-linolenic acid (ALA) is an essential n-3 PUFA; its n-3 LCPUFA derivatives EPA and DHA, which have diverse beneficial effects, are scarce in the human diet. In recent years nontraditional vegetable oils rich in ALA (up to 45%) have been developed as new alternatives to increase ALA consumption. This work evaluated the accretion of ALA, EPA and DHA into the phospholipids extracted from erythrocytes, liver, kidney, small intestine, heart, quadriceps and the brain in rats fed sunflower (SFO), canola (CO), Rosa canina (RCO), sacha inchi (Plukenetia volubilis, SIO) and chia (Salvia hispánica, ChO) oils. Five experimental groups (n = 12 per group) were fed for 21 days with SFO (1% ALA), CO (10% ALA), RCO (33% ALA), SIO (49% ALA), and ChO (64% ALA). SIO and ChO allowed higher ALA accretion in all tissues, except the brain, and a reduction in the content of arachidonic acid in all tissues except the brain. EPA was increased in erythrocytes, liver, kidney, small intestine, heart and quadriceps, but not in the brain. DHA was increased in the liver, small intestine and brain tissues. Our results demonstrate that ALA, when provided in significant amounts, can be converted into n-3 LCPUFA, mostly DHA in the liver and brain. It is suggested that oils rich in ALA, such as SIO and ChO, are good sources for obtaining higher tissue levels of ALA, also allowing its selective conversion into n-3 LCPUFA in some tissues of the rat. PMID:24855655

  4. Análise espacial do risco de leptospirose canina na Vila Pantanal, Curitiba, Paraná Spatial analysis of the risk of canine leptospirosis in the Vila Pantanal, Curitiba, Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Daniele Bier

    2013-01-01

    Full Text Available A leptospirose é uma grave zoonose associada às áreas de baixa renda dos centros urbanos. Embora roedores urbanos sejam considerados como principal reservatório para a leptospirose, o cão também pode desenvolver a doença e se tornar carreador assintomático. O objetivo do presente trabalho foi utilizar a metodologia estatística baseada na teoria de processos pontuais espaciais, buscando identificar a forma como se distribuem os cães sororreagentes para a leptospirose e seus determinantes de risco em uma vila na cidade de Curitiba. A análise do modelo possibilitou identificar as regiões de sobre-risco, onde o risco de soropositividade canina à leptospirose é significativamente maior. A relação significativa do efeito espacial no desenvolvimento da doença, além das variáveis estudadas, revela que não apenas um, mas a ação conjunta dos fatores relacionados ao animal, ao proprietário e ao ambiente influencia o risco maior da doença nos locais de maior efeito espacial. O resultado da análise indica claramente os territórios em maior risco na região da Vila Pantanal, possibilitando o planejamento de ações mais específicas e dirigidas a essas áreas em um contexto de vigilância da saúde.Leptospirosis is a serious zoonotic disease associated to low income areas of urban settings. Although rodents are considered the main reservoir for urban leptospirosis, dogs may also develop the disease and become asymptomatic carriers. The objective of this study was to apply a statistical method based on the spatial point processes theory for canine leptospirosis to identify how seroreagents dogs are spatially distributed and their risk determinants in a village of Curitiba city. The model analysis allowed the identification of over-risk regions, where seropositivity risk for canine leptospirosis was significantly higher, revealing that not just one, but the combination of animal, owner and environment factors influenced the disease

  5. Risk factors and clinical disorders of canine ehrlichiosis in the South of Bahia, Brazil Fatores de risco e alterações clínicas da erhlichiose canina no sul da Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Renata Santiago Alberto Carlos

    2011-09-01

    Full Text Available The aim of this work was to study the clinical disorders and risk factors of canine ehrlichiosis in Ilhéus and Itabuna, Bahia, and compare different diagnostic methods. Blood samples were collected from 200 dogs. Each dog was clinically examined. A questionnaire was used to evaluate the risk factors. The blood samples were analyzed using the Dot-ELISA test; hematometry, platelet counts and searches for morulae on blood smears were performed. Nested PCR was carried out on 50 serologically positive samples and 50 negative samples. Three positive PCRs were sequenced. Thirty-six percent were serologically positivity and 5.5% from blood smears. The animals were anemic and thrombocytopenic. Presence of ticks and living in areas on the urban periphery were considered to be risk factors (p Objetivou-se com este trabalho estudar as alterações clínicas, fatores de risco da ehrlichiose canina nos municípios de Ilhéus e Itabuna, Bahia, e comparar diferentes métodos de diagnóstico. Amostras de sangue foram coletadas de 200 cães e cada animal foi examinado clinicamente. Foi preenchido um questionário para avaliar os fatores de risco. As amostras de sangue foram analisadas pelo teste Dot-ELISA e foram realizadas hematimetria, contagem de plaquetas e procura de mórulas em esfregaço de sangue. Nested-PCR foi realizada em 50 amostras positivas e 50 negativas na sorologia. Três amostras PCRs positivas foram seqüenciadas. Foi encontrado 36,0% de positividade na sorologia e 5,5% nos esfregaços sanguíneos. Os animais apresentavam anemia e trombocitopenia. Ter carrapatos e residir em áreas suburbanas foram considerados fatores de risco (p < 0,05. A Nested-PCR identificou 11 cães positivos, sendo 9 com sorologia positiva e 2 negativos. O sequenciamento de DNA foi compatível com a presença de Ehrlichia canis.

  6. Spatial distribution of human and canine visceral leishmaniasis in Belo Horizonte, Minas Gerais State, Brasil, 1994-1997 Distribuição espacial da leishmaniose visceral humana e canina em Belo Horizonte, Minas Gerais, Brasil, 1994-1997

    Directory of Open Access Journals (Sweden)

    Cláudia Di Lorenzo Oliveira

    2001-10-01

    Full Text Available In this paper, we present spatial analysis of the association between all incidents cases of human Visceral Leishmaniasis and seropositive dogs, from 1994 to 1997 in Belo Horizonte, a large Brazilian city. We geocoded 158 human cases and 11,048 seropositive dogs and compared canine prevalence rates with Human Bayesian Incidence rates in the same areas. We also used Knox's test to evaluate the hypothesis of space-time clustering of human cases in the period. Additionally, we used Kernel's maps for seropositive dogs distribution and located the human cases in the resulting smooth maps. We concluded that human and dog rates are correlated. Also, the Visceral Leishmaniasis in Belo Horizonte spread quickly, but apart from the rates' magnitude, it has kept the same spatial pattern through time. We believe it is possible to use this technique to choose areas to implement control measures against Visceral Leishmaniasis in a more efficient way.Neste artigo, apresentamos uma análise espacial da associação entre todos os casos incidentes de leishmaniose visceral e em cães soropositivos ocorridos em Belo Horizonte no período de 1994 a 1997. Geocodificamos 158 casos humanos e 11.048 cães positivos, comparamos as taxas de prevalência canina por área e as taxas Bayesianas de incidência da doença humana nas mesmas áreas. Usamos o teste de Knox para testar a hipótese de cluster espaço temporal entre os casos humanos no período examinado. Adicionalmente, construímos Mapas de Kernel para cães soropositivos e sobrepusemos os casos humanos em quatro áreas. Os resultados apontam para correlação entre casos humanos e caninos. Além disso, a leishmaniose visceral espalhou-se rapidamente em Belo Horizonte, embora tenha mantido o mesmo padrão durante os anos analisados. Acreditamos ser possível o uso das técnicas empregadas para priorizar áreas onde as medidas de controle devem ser implementadas.

  7. Etiology, antimicrobial susceptibility profile and epidemiological aspects in canine otitis: a retrospective study of 616 casesEtiologia, perfil de sensibilidade aos antimicrobianos e aspectos epidemiológicos na otite canina: estudo retrospectivo de 616 casos

    Directory of Open Access Journals (Sweden)

    Verônica Baldim de Oliveira

    2012-12-01

    Full Text Available A retrospective study of etiology, antimicrobial susceptibility profile and multiple drug resistance, and major epidemiological aspects were investigated in 616 cases of canine otitis. Staphylococcus ? hemolitic (26.27%, Malassezia pachydermatis (12.35%, and Pseudomonas aeruginosa (8.8% were the most common microorganisms identified. The isolates were susceptible mainly to norfloxacin (89.62%, gentamicin (83.25%, and ofloxacin (80.16%. High occurrence of resistance of isolates was observed to neomicin (30.84% and cephalexin (27.63%. Multiple drug resistance to three or more and five or more of antimicrobials tested was observed in 34.9% and 15.5% of isolates, respectively. The cases of canine otitis occurred predominantly in first years of age, in mixed breeds animals, at autumn season. The presence of itch, bad smell, and secretion in ear conduct were the major signs observed at clinical examination. Estudo retrospectivo da etiologia, perfil de sensibilidade microbiana, ocorrência de multirresistência dos isolados e os principais aspectos epidemiológicos foram investigados em 616 casos de otite canina. Staphylococcus ? hemolítico (26,27%, Malassezia pachydermatis (12,35% e Pseudomonas aeruginosa (8,8% foram os micro-organismos mais frequentes. Os isolados foram sensíveis “in vitro” principalmente a norfloxacina (89,62%, gentamicina (83,25% e ofloxacina (80,16%. Alta ocorrência de resistência das linhagens foi observada frente à neomicina (30,84% e cefalexina (27,63%. A ocorrência de resistência múltipla a três ou mais e cinco ou mais dos antimicrobianos foi observada em, respectivamente, 34,9% e 15,5% dos isolados. Os casos ocorreram predominantemente nos primeiros anos de idade, em animais sem raça definida, no período do outono. A presença de prurido, mau cheiro e secreção no conduto auditivo foram os principais sinais observados ao exame clínico.

  8. Disfunção endotelial após isquemia global e reperfusão em cirurgia cardíaca com circulação extracorpórea: estudo do papel do magnésio em artérias coronarianas caninas

    OpenAIRE

    Marco A Volpe; João J. Carneiro; MAGNA Luiz Alberto; Fernanda VIARO; Eliana Aparecida Lopes ORIGUELA; Paulo R. B. Evora

    2002-01-01

    OBJETIVO: Estudar a disfunção endotelial conseqüente à lesão provocada por isquemia global seguida de reperfusão e a potencial influência protetora do magnésio sobre a integridade funcional do endotélio em coronárias isoladas de cães. MÉTODO: Segmentos de artérias coronárias caninas foram suspensos em banhos orgânicos para medida de força isométrica. A disfunção endotelial foi avaliada pela capacidade destes segmentos produzirem óxido nítrico, alterando a força isométrica inicial. Foram selec...

  9. Relación de las patologías caninas más frecuentes que se presentan en la clínica de pequeños animales en la zona noroeste de la Comunidad de Madrid, con las variables edad, raza, sexo y tamaño

    OpenAIRE

    Gonzalez Hernández, Juan Francisco

    2015-01-01

    En el presente trabajo se hace un estudio de la prevalencia de las patologías caninas más frecuentes que se presentan en la clínica de pequeños animales. El lugar de donde se extrajeron los datos fue una clínica veterinaria situada en la zona noroeste de la Comunidad de Madrid, durante el período de tiempo comprendido entre los años 2005-2011. La prevalencia de las patologías se relacionó con cuatro variables de la reseña del animal como son la edad, el sexo, el tamaño y la raza. Se hizo...

  10. Dirofilariose canina na Ilha de São Luís, Nordeste do Brasil: uma zoonose potencial Canine heartworm on São Luís Island, Northeastern Brazil: a potential zoonosis

    Directory of Open Access Journals (Sweden)

    Silvia Maria Mendes Ahid

    1999-04-01

    Full Text Available Um inquérito sobre a prevalência da dirofilariose canina foi realizado entre 1.495 cães de 64 localidades na Ilha de São Luís, de 1991 a 1994, através da pesquisa de microfilárias. Desses, 1.358 cães (12,8% positivos não tinham história pregressa conhecida, sendo 1.265 errantes (10,3% microfilarêmicos e 93 domiciliados (37,8%. A dirofilariose foi detectada em 46 das localidade, porém a prevalência da infecção aumenta consideravelmente quando se trata de cães da orla marítima, de onde procederam 47% dos animais positivos. Em alguns bairros costeiros, a prevalência é elevada, como em Olho d'Água e Calhau (46% e 43% positivos, respectivamente. A pesquisa de microfilárias em 137 cães estritamente domiciliados (DO e com história pregressa conhecida (43% microfilarêmicos permitiu a comprovação da existência de transmissão na Ilha. Este estudo é o primeiro dessa natureza e abrangência realizado no Nordeste do País. Sabendo-se que a dirofilariose é uma zoonose, e diante da elevada prevalência de cães microfilarêmicos, particularmente os domiciliados da orla marítima da Ilha, chama-se a atenção para que se considere tal parasitose como possível causa de lesões pulmonares solitárias na população humana local e naquelas assentadas em áreas com clima e paisagem semelhantes no Nordeste.A survey on the prevalence of canine heartworm was conducted in 1,495 dogs from Maranhão Island, State of Maranhão, Northeastern Brazil, from 1991 to 1994, by testing for microfilariae in blood. Of the total, 1,358 (12.8% of which were infected were dogs with no known history; they included 1,265 homeless animals (10.3% with microfilariae and 93 kept by owners at the time the survey was conducted (37.8% of which were infected. Prevalence is high among dogs captured and/or living along the seashore. Examples of such high coastal prevalence rates were found in Olho d'Água and Calhau (46% and 43%, respectively. The search for

  11. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006 Dog fouling and helminth contamination in parks and sidewalks of Buenos Aires City, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.The aim of this study was to provide data on canine fecal and helminthic contamination from parks and sidewalks in Buenos Aires City, collected by the Laboratory of General Parasitology, School of Sciences, University of Buenos Aires. A census of dog feces was performed in 1-11 parks per year between 1991 and 2006, a single day each year. In the period 2000-2006, the census included feces on sidewalks surrounding the park. Thirty fresh fecal

  12. Aspectos epidemiológicos da leishmaniose visceral canina no município de Pedro Leopoldo, Minas Gerais, 2003 Epidemiologic aspects of canine visceral leishmaniasis in Pedro Leopoldo district, Minas Gerais, 2003

    Directory of Open Access Journals (Sweden)

    L.A.B. Naveda

    2006-12-01

    Full Text Available Determinou-se a prevalência da leishmaniose visceral canina (LVC no município de Pedro Leopoldo, MG, 2003, por meio de inquérito soro-epidemiológico. Coletaram-se amostras de sangue de 2.185 cães e aplicou-se questionário semi-estruturado em cada residência. Os animais foram divididos em quatro grupos, sendo o grupo A constituído de 1240 cães das áreas urbana e rural; o grupo B de 705 cães de áreas em torno dos focos; o grupo C, de 134 cães, cujas amostras foram coletadas durante o dia da vacinação anti-rábica oficial; e o grupo D composto de 111 cães errantes. Os dados foram armazenados em banco de dados EPIINFO 6.04b. Os 36 cães positivos foram localizados espacialmente com auxílio de GPS (Global Positioning System, e o georreferenciamento realizado por meio do programa AUTOCAD 2000. A prevalência global da LVC foi de 1,4% e variou de 1,1% na área urbana e 4,2% na rural. Estes resultados permitiram concluir que Pedro Leopoldo, de acordo com a classificação oficial do Ministério da Saúde, é área silenciosa, receptiva e vulnerável para LVC. A distribuição espacial dos casos é diferenciada e requer medidas sanitárias de acordo com cada área de risco.The prevalence of canine visceral leishmaniasis (CVL in Pedro Leopoldo district, 2003 was evaluated. A serum-epidemic inquiry was accomplished by collecting blood samples of dogs and by applying a semi structured questionnaire, according to groups, in each visited residence: group A, constituted of 1240 dogs of the urban and rural areas; group B, constituted of 705 dogs sampled around the focuses; group C, constituted of 134 dogs, wich samples were collected during the canine/feline antirabic vaccination; and group D, constituted of 111 wandering dogs. The data were stored in the EPI INFO 6.04b database. Positive dogs were spatially located using GPS (Global Positioning System and the geographycal reference was made through the AUTOCAD 2000 program. The district global

  13. The effect of the synthetic oviductal fluid medium (SOF supplemented with insulin-like growth factor-I (IGF-I on in vitro maturation of canine oocytes (Canis familiaris/ Influência do fator de crescimento semelhante à insulina I (IGF-I adicionado ao meio fluido sintético de tuba uterina (SOF sobre a maturação in vitro de oócitos caninos (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Kellen Oliveira

    2007-08-01

    Full Text Available The follicular growth and oocyte maturation knowledge are very important to the development and improvement ofnew biotechnologies such as in vitro fertilization and somatic cell nuclear transfer. In order to the necessity of clarifythe basic mechanisms related to canine oocyte maturation, this investigation focuses on the evaluation of the effectof insulin-like growth factor-i (IGF-I, added to synthetic oviductal fluid medium (SOF on the in vitro maturation ofdomestic dog oocytes. Thirty-seven bitches undergoing ovariohysterectomy for castration or due to pathologicalconditions of the uterus were selected as oocytes’ donors (n=875. The oocytes were allocated in the followinggroups: M0 (stained in the collection’s time, Control (72h in SOF and Experimental (72h in SOF plus 100 ng IGF-I.After 72 hours of maturation the oocytes’ nuclear status were assessed by Hoechst 33342 dye. The best results interms of oocyte harvest were observed in those juvenile donors, females in estrus, nuliparous and pure breeds. Nosignificant differences were observed between treatments control (SOF or experimental (IGF-I.O conhecimento da regulação do crescimento folicular e da maturação oocitária é de grande importância no desenvolvimento e aperfeiçoamento de novas biotecnologias como a fecundação in vitro e a transferência nuclear. Considerando-se a necessidade de elucidação dos mecanismos básicos envolvidos na maturação oocitária na espécie canina, a presente pesquisa foi desenvolvida com o objetivo de avaliar o efeito do fator de crescimento semelhante à insulina-I (IGF-I, adicionado ao meio fluido sintético de tuba uterina (SOF, sobre a maturação de oócitos caninos. Foram utilizadas 37 cadelas submetidas à ovariohisterectomia, eletivas e terapêuticas, como doadoras dos complexos cumulus oócitos grau 1 (n=875 que foram alocados em três grupos: M0 (coloração no momento da colheita, Controle (72 h no meio SOF e Experimental (72h no

  14. Enfermedad valvular degenerativa canina: reporte de caso

    Directory of Open Access Journals (Sweden)

    Carmenza Janneth Benavides Melo

    2014-07-01

    Full Text Available En caninos, la enfermedad valvular degenerativa o endocardiosis es la patología cardiovascular con mayor prevalencia. Se caracteriza por regurgitación de la sangre hacia las aurículas, con disminución del gasto cardiaco, lo que lleva a sobrecarga de volumen con hipertrofia excéntrica e insuficiencia cardiaca congestiva. Este reporte tiene como objetivo describir los hallazgos clínicos y de necropsia de un canino, sugestivos de una endocardiosis valvular. El paciente ingresó por consulta externa a la Clínica Veterinaria Carlos Martínez Hoyos, de la Universidad de Nariño (Pasto, Colombia. Su propietario lo reportó enfermo desde hacía dos meses, con signos de enfermedad respiratoria, pérdida de peso y decaimiento. En el examen clínico se encontraron membranas mucosas muy pálidas, disnea inspiratoria, estertores, desdoblamiento de S2, soplo de regurgitación mesosistólico grado 4 y dilatación abdominal con signo de choque de onda positivo. En la necropsia se evidenció abundante cantidad de material de aspecto acuoso traslúcido en cavidad abdominal, torácica y pericárdica, corazón severamente aumentado de tamaño, redondeado, con engrosamiento de válvulas atrioventriculares, hígado con moderada disminución de tamaño y evidencia de lobulillación, riñones severamente disminuidos de tamaño y pálidos de superficie irregular con presencia de múltiples áreas quísticas en región corticomedular. Se tomaron muestras de estos tejidos y se fijaron en formol bufferado al 10 %, para después ser procesadas para análisis histopatólogico en el Laboratorio de Patología de la Universidad de Nariño, mediante la técnica de hematoxilina y eosina de rutina. De esta manera se diagnostica como enfermedad valvular degenerativa.

  15. Do dogs (Canis familiaris) show contagious yawning?

    Science.gov (United States)

    Harr, Aimee L; Gilbert, Valerie R; Phillips, Kimberley A

    2009-11-01

    We report an experimental investigation into whether domesticated dogs display contagious yawning. Fifteen dogs were shown video clips of (1) humans and (2) dogs displaying yawns and open-mouth expressions (not yawns) to investigate whether dogs showed contagious yawning to either of these social stimuli. Only one dog performed significantly more yawns during or shortly after viewing yawning videos than to the open-mouth videos, and most of these yawns occurred to the human videos. No dogs showed significantly more yawning to the open-mouth videos (human or dog). The percentage of dogs showing contagious yawning was less than chimpanzees and humans showing this behavior, and considerably less than a recently published report investigating this behavior in dogs (Joly-Mascheroni et al. in Biol Lett 4:446-448, 2008). PMID:19452178

  16. Do dogs (Canis lupus familiaris) prefer family?

    Science.gov (United States)

    Hamilton, Jennifer; Vonk, Jennifer

    2015-10-01

    Kin recognition requires the ability to discriminate between one's own genetic relatives and non-relatives. There are two mechanisms that aid in kin discrimination: phenotype matching and familiarity. Dogs may be a good model for assessing these mechanisms as dogs are a promiscuous social species with a keen sense of smell. Domestic dogs of both sexes were presented with two scents (close kin, distant-kin) and preference was assessed through three measures (latency to approach, number of visits, time spent). Experiment 1 explored the possibility of phenotype matching as subjects had no contact with sires, whose scent was presented alongside a control male's scent. Experiment 2 explored recognition of siblings raised with the subjects and then separated at seven weeks of age. Whereas female dogs in this experiment did not show a statistically significant preference, male dogs showed a preference for distant-kin when presented with sire and female sibling samples. PMID:26277060

  17. Prevalência da infecção canina em áreas endêmicas de leishmaniose tegumentar americana, do município de Paracambi, Estado do Rio de Janeiro, no período entre 1992 e 1993 Prevalence of canine infection from endemic areas of American cutaneous leishmaniasis in Paracambi District, Rio de Janeiro State, between 1992 and 1993

    Directory of Open Access Journals (Sweden)

    Ginelza Peres Lima dos Santos

    2005-04-01

    Full Text Available No município de Paracambi, Estado do Rio de Janeiro, foi realizado um inquérito epidemiológico sobre a leishmaniose tegumentar americana na população canina residente em áreas endêmicas rural e semiurbana. Foram cadastrados 179 cães e 138 (77,1% foram examinados, segundo seus aspectos clínicos e desenvolvimento de hipersensibilidade tardia ao antígeno Imunoleish® e respostas sorológicas à reação de imunofluorescência indireta e ao ensaio imunoenzimático. Dos 9 (6,5.% animais portadores de lesões/cicatrizes suspeitas, 66,7% foram causadas por Leishmania sp; 44,4% produziram infecção em hamsters e apresentaram crescimento em meio de cultura, compatíveis com o comportamento de Leishmania do complexo braziliensis. A caracterização molecular (análises isoenzimáticas e do perfil de restrição do KDNA identificou 2 amostras como similares à Leishmania (Viannia braziliensis. A prevalência da infecção canina observada através do teste cutâneo, RIFI e ELISA foi, respectivamente, 10,1%, 16,7% e 27,8%. A presença das formas clínica/subclínica da LTA na população canina associada à infecção humana sugere que o cão pode atuar como possível fonte de infecção, assim como na disseminação da doença.In the district of Paracambi, State of Rio de Janeiro an epidemiological survey for American tegumentary leishmaniasis in canine population was carried out in endemic localities. A total of 179 dogs was registered and 138 (77.1% examined for their clinical aspects, development of delayed hypersensitivity (DHS with Imunoleish® antigen and serological responses by indirect immunofluorescent reaction and enzyme-linked immunosorbent assay. In 9 (6.5% dogs with active cutaneous lesions or suspect scars, 66.7% were caused by Leishmania sp; 44.4% produced infection in hamsters and showed growth in culture media, which was considered to be compatible with the species of Leishmania braziliensis complex. The molecular

  18. Estudo descritivo da estrutura populacional canina da área urbana de Araçatuba, São Paulo, Brasil, no período de 1994 a 2004 A descriptive profile of the canine population in Araçatuba, São Paulo State, Brazil, from 1994 to 2004

    Directory of Open Access Journals (Sweden)

    Andréa Maria Andrade

    2008-04-01

    Full Text Available No período de 1994 a 2004, a população canina de Araçatuba, São Paulo, Brasil, registrou duas importantes zoonoses: a raiva e a leishmaniose visceral. Analisaram-se as mudanças ocorridas nessa população durante esse período, utilizando resultados de censos caninos e de coletas censitárias de sangue realizados em 1994, 1999 e 2004. A relação cão/10 habitantes variou significativamente, passando de 1,7 em 1994 para 2,0 em 1999 e para 1,8 em 2004. A porcentagem de cães com até um ano de idade passou de 20% para 32,5% e o número de eutanásias realizadas também aumentou após 1999, com a introdução da leishmaniose visceral. O número de cães e a estrutura etária variaram nos diversos setores do município e aqueles com maior porcentagem de animais com até dois anos de idade apresentaram maior ocorrência de casos de leishmaniose visceral humana e canina. Tais resultados decorrem de ações de controle adotadas nos setores com casos humanos de leishmaniose visceral, porém, o aumento da população canina mais jovem pode resultar em aumento da susceptibilidade destes cães à doença, favorecendo a manutenção da mesma na área.From 1994 to 2004, the canine population in Araçatuba, São Paulo State, Brazil, suffered two major canine zoonoses: rabies and visceral leishmaniasis. Changes in the dog population during this period were evaluated using canine census data from 1994 and 2004 and the results of blood samples for diagnosis of canine visceral leishmaniasis in 1999. The ratio of dogs per 10 inhabitants varied from 1.7 in 1994 to 2.0 in 1999 and 1.8 in 2004. The percentage of puppies less than 1 year of age increased from 20% to 32.5%, and the number of euthanized dogs also increased after 1999, when visceral leishmaniasis began to appear. The number of dogs and percentage of puppies varied between different areas of the city, and neighborhoods with a higher percentage of young animals showed more cases of both human and

  19. Epidemiological features and the neuropathological manifestations of canine distemper virus-induced infections in Brazil: a reviewAspectos epidemiológicos e as manifestações neuropatológicas associadas à infecção pelo vírus da cinomose canina no Brasil: uma revisão

    Directory of Open Access Journals (Sweden)

    Selwyn Arligton Headley

    2012-10-01

    Full Text Available This article provides a critical review of current epidemiological trends of canine distemper virus (CDV and syndromes related to canine distemper encephalitis (CDE with specific reference to the situation in Brazil. Epidemiological data relative to susceptible animal populations, prevalence, seasonal occurrence, and age-related patterns associated with CDV are discussed. The participation of mongrel dogs in maintaining CDV within rural and semi-urban canine populations and their importance in the epidemiology of canine distemper is highlighted. The economic impact of treating the clinical manifestations associated with CDV-induced infections in Brazil is estimated. Additionally, neurological and neuropathological manifestations of CDV in Brazil are discussed, and a novel manifestation of CDE is proposed. Esse manuscrito fornece uma revisão crítica das tendências epidemiológicas associadas ao vírus da cinomose canina (CDV e às síndromes relacionadas à encefalite por cinomose com referência específica à situação no Brasil. Os dados epidemiológicos relativos às populações de animais suscetíveis, prevalência, sazonalidade e os padrões relacionados à idade foram discutidos. Também é enfocada nessa revisão a participação de cães de rua na manutenção do CDV nas populações caninas nas áreas rurais e nas regiões semiurbanas e a sua importância na epidemiologia da cinomose. Foi ainda estimado o impacto econômico relacionado ao tratamento das manifestações clínicas associadas à cinomose no Brasil. Adicionalmente, as manifestações neurológicas e neuropatológicas da cinomose no Brasil são discutidas e uma manifestação neuropatológica inédita da infecção é sugerida.

  20. Virus isolation and molecular characterization of canine distemper virus by RT-PCR from a mature dog with multifocal encephalomyelit Isolamento e caracterização molecular do vírus da cinomose canina por RT-PCR a partir de um cão adulto com encefalomielite multifocal

    Directory of Open Access Journals (Sweden)

    Alexandre Mendes Amude

    2007-06-01

    Full Text Available A case of multifocal distemper encephalomyelitis in a mature dog is described. In the presented case the ante mortem clinical diagnosis of canine distemper virus (CDV infection could not be ideally performed due to the absence of typical signs of distemper, such as myoclonus and systemic signs accompanying the nervous signs. The definitive diagnosis of distemper encephalomyelitis was only carried out at post mortem through virus isolation in cell culture from fresh central nervous system (CNS fragments and CDV nucleoprotein gene detection in the CNS by RT-PCR.Descreve-se um caso de encefalomielite multifocal pela cinomose em um cão adulto. No caso apresentado o diagnóstico clínico da infecção pelo vírus da cinomose canina (CDV não pode ser adequadamente realizado devido à ausência de sinais típicos da enfermidade, tais como mioclonia e sinais sistêmicos. O diagnóstico definitivo somente foi possível post mortem pelo isolamento do CDV em cultivo celular a partir dos fragmentos frescos do sistema nervoso central (SNC e pela detecção do gene da nucleoproteína do CDV em fragmentos do SNC por meio da RT-PCR.

  1. Canine distemper virus infection in a lesser grison (Galictis cuja: first report and virus phylogeny Infecção pelo vírus da cinomose canina em um furão (Galictis cuja: primeiro relato e filogenia viral

    Directory of Open Access Journals (Sweden)

    Jane Megid

    2013-02-01

    Full Text Available Infectious diseases in wild animals have been increasing as a result of their habitat alterations and closer contact with domestic animals. Canine distemper virus (CDV has been reported in several species of wild carnivores, presenting a threat to wildlife conservation. We described the first case of canine distemper virus infection in lesser grison (Galictis cuja. A free-ranging individual, with no visible clinical sigs, presented sudden death after one day in captivity. Molecular diagnosis for CDV infection was performed using whole blood collected by postmortem intracardiac puncture, which resulted positive. The virus phylogeny indicated that domestic dogs were the probable source of infection.Doenças infecciosas em animais selvagens têm aumentado devido às alterações em seu habitat e ao maior contato com animais domésticos. A cinomose já foi descrita em diversas espécies de carnívoros selvagens, representando uma ameaça à conservação da vida selvagem. Nesse estudo é descrito o primeiro caso de infecção pelo vírus da cinomose em um furão (Galictis cuja. Um indivíduo de vida livre, sem sinais clínicos aparentes, apresentou morte súbita após um dia em cativeiro. Foi realizado o diagnóstico molecular para detecção do vírus da cinomose canina, sendo o resultado positivo. A filogenia do vírus indicou que cães domésticos foram a provável fonte de infecção.

  2. 利用蔷薇科植物基因5'UTR快速扩增狗蔷薇RcPIN1和RcPLT的5’末端%Rapid Coning of 5' Ends of Homologous Genes to PIN1 and PLT in Rosa canina based on 5'UTR of Plants Belonging to Rosaceae Family

    Institute of Scientific and Technical Information of China (English)

    刘凤栾; 郗琳; 阿不都热扎克·依沙克; 陈晓丽; 马男; 赵梁军

    2012-01-01

    Protocorm-like bodies (PLBs) can be efficiently induced by TDZ from Rosa canina rhizoids. More understandings on the molecular biological mechanism of PLBs induction contributes to the establishment of protocorm-like bodies protocols of cut roses. One important premise of the mechanism study in the molecular biological level is to quickly and accurately clone and screen the key genes during PLBs induction. On the basis of'conserved sequences' in 5' untranslated regions (5'UTR) of homologous genes with high scores of Malusx domestica, Prunus persica and Fragaria vesca, we designed the forward degenerate primers to directly isolate the cDNA 5'ends of PIN 1 (pin-formed) and PLT (plethora) of R, canina by PCR amplification using the cDNA template catalyzed by M-MLV reverse transcriptase. The results showed that there were some conserved fragments in the 5' rapid amplification of cDNA ends (5'UTR) of RcPINl, RcPLT and their homologous genes with high scores of Malusxdomestica, Fragaria vesca and Prunus persica, which indicated the above method was practicable. With this method, costly 5'RACE kits were entirely unnecessary because no homopolymer sequence and abridged anchor primers were to be introduced to the 5' ends of cDNA template, for genes from plants of Rosacease family. As a result, this method took advantages of speediness and economy. It is believed that this method will be a practical pathway and worthy reference to identify cDNA 5'ends for some Rosaceae plants.%狗蔷薇不定根可被噻苯隆(TDZ)高效诱导形成类原球茎,深入探讨其诱导阶段的分子生物学机制,有利于指导切花月季建立类似高效再生和遗传转化体系.快速、准确克隆和筛选狗蔷薇类原球茎发生的关键基因是进行分子生物学水平研究的一个重要前提.利用苹果(Malus×domestica)、桃(Prunus persica)和草莓(Fragaria vesca)高同源性基因5'UTR(非翻译区)的相对保守性,在其内保守区域设计上游简并引物,以M

  3. Correlation of clinical and hematological with definitive diagnosis of canine ehrlichiosis by PCRCorrelação dos achados clínicos e hematológicos com diagnóstico definitivo de erliquiose canina por meio de PCR

    Directory of Open Access Journals (Sweden)

    Carla Fredrichsen Moya-Araujo

    2012-12-01

    Full Text Available The Ehrlichiosis is a worldwide diseases of great importance in a veterinary medicine is an important infectious diseases whose prevalence has increased significant in the last year in the Brazilian states. Due to the fact that this study was designed to correlate the findings hematological clinical signs and PCR, being the most sensitive. This study evaluated twenty dogs seen at veterinary hospital UNESP – Botucatu campus during the 03 from august to September 28 2009. Animal cited 65% were positive in the PCR test. Among the most prominent clinical findings 76.92% (10/13 with anorexia, 53.84% (7/13 with hepatoesplenomegaly, 46.15% (6/13 with apathy and 38.46% (5/13 epistaxis. The thirteen animals positive PCR 92.30% (12/13 showed thrombocytopenia ( A Erliquiose é uma doença cosmopolita de grande importância na clínica médica veterinária, sendo uma importante enfermidade infecciosa, cuja prevalência tem aumentado significantemente nos últimos anos nos estados brasileiros. Devido a esse fato, o presente trabalho teve o intuito de correlacionar os achados hematológicos, sinais clínicos e PCR, sendo este último o mais sensível. No trabalho foram avaliados 20 cães com suspeita de Erliquiose que foram atendidos no setor de Moléstias Infecciosas do Hospital Veterinário da UNESP – Campus Botucatu SP, durante oito semanas. Dos animais citados, 65,00% (13/20 foram positivos em exame da PCR, nestes os achados clínicos mais evidentes foram 76,92% (10/13 anorexia, 53,84% (7/13 hepatoesplenomegalia, 46,15% (6/13 apatia e 38,46% (5/13 epistaxes. Dos treze animais positivos na PCR 92,30% (12/13 apresentaram-se trombocitopênicos (<150.000 plaquetas e 61,53% (8/13 anêmicos (<5.50 x106. Frente ao exposto, conclui-se que a técnica de PCR foi um bom método diferencial na detecção de Erliquiose canina podendo ser adotada, juntamente com os achados clínicos e hematológicos para o diagnóstico preciso da enfermidade em questão.

  4. Autochthonous canine visceral leishmaniasis in a non-endemic area: Bom Sucesso, Minas Gerais State, Brazil Ocorrência de leishmaniose visceral canina autóctone em uma área não-endêmica: Bom Sucesso, Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Marcio Roberto Silva

    2008-02-01

    sintomas característicos de leishmaniose visceral canina. Os resultados desta investigação epidemiológica foram enviados às autoridades locais e estaduais de saúde pública requerendo medidas preventivas e de controle para leishmaniose visceral de forma a interromper a transmissão da doença e evitar a ocorrência de casos humanos.

  5. 狗蔷薇PaWUS基因的超量表达诱导转基因烟草根尖形成不定芽%Overexpression of RaWUS Gene of Rosa canina Inducing Shoot Regeneration from Root Tip of Transgenic Tobacco

    Institute of Scientific and Technical Information of China (English)

    姜福星; 刘凤栾; 赵梁军

    2011-01-01

    WUSCHEL is plant stem cell organizer gene, and its expression determines stem cell formation andmorphogenesis during plant development. We cloned its homologue gene from protocorm-like body in Rosa canina, and named it as RaWUS gene through homoiogy comparison of amino acid sequences alignment and phylogenetic analysis. A chemical inducible expression vector was constructed under XVE system. Under the system, overexpression of RaWUS gene was able to induce adventitious shoots from root tips of transgenic tobacco, and microobservation results showed that spherical meristem stem cell mass was produced in cortex in the root. Our research result suggests overexpression of RaWUS gene can transform parenchymatous cell into meristematic stem cell and induce shoot stem cell activity and development plasticity in the root.%WUSCHEL是植物干细胞命运的决定基因,在植物发育过程中WUSCHEL基因的表达决定着干细胞的形成和器官的发生.从狗蔷薇的类原球茎中克隆出其同源基因;经过对其进行蛋白质序列比对和系统发育分析,将其命名为Ra WUS基因.构建在XVE系统下的化学调控的表达载体.在该系统下,Ra WUS基因的超量表达能诱导转基因烟草根尖形成不定芽;同时显微观察表明,根部的皮层中有圆球形的分生组织干细胞团的产生.结果表明:Ra WUS基因的过量表达能够促使根的皮层中薄壁细胞转变成为分生组织干细胞而形成不定芽在根尖异位发生,说明其能够在植物的根尖中诱导茎尖分生组织干细胞的活性和发育的可塑性.

  6. Flebotomíneos de áreas com notificações de casos autóctones de leishmaniose visceral canina e leishmaniose tegumentar americana em Angra dos Reis, Rio de Janeiro, Brasil Phlebotomine fauna in areas of autochthonous cases of canine visceral leishmaniasis and American cutaneous leishmaniasis in Angra dos Reis, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Marcos Barbosa de Souza

    2009-01-01

    Full Text Available Flebótomos de áreas com notificações de casos autóctones de leishmaniose visceral canina e leishmaniose tegumentar americana em Angra dos Reis, Rio de Janeiro, Brasil. O município de Angra dos Reis apresenta casos humanos de leishmaniose tegumentar americana desde 1945. Inquéritos flebotomínicos realizados em 1978 revelaram a presença de Nyssomyia intermedia e a primeira notificação de Lutzomyia longipalpis no Rio de Janeiro, Ilha Grande, Angra dos Reis. Em agosto de 2002 foi notificado o primeiro caso canino de leishmaniose visceral na Ilha Grande, Angra dos Reis. Inquéritos flebotomínicos realizados nos peridomicílios, no período de novembro de 2002 a maio de 2003, em quatro localidades de Angra dos Reis, resultaram em 12.554 flebotomíneos e a presença de nove espécies: Brumptomyia sp.; Nyssomyia intermedia, Migonemyia migonei, Micropygomyia schreiberi, Pintomyia fischeri, Psychodopygus davisi, Psychodopygus ayrosai, Evandromyia tupinambay, Psathyromyia pelloni. foi Nyssomyia intermedia, predominante em todas as localidades, seguida por M.migonei. O principal vetor da LVA, Lutzomyia longipalpis, não foi detectado nas localidades, incluindo áreas do entorno, onde um cão infectado residia.The city of Angra dos Reis presents human cases of American cutaneous leishmaniasis since 1945. Phlebotomine surveys in 1978 had disclosed the presence of Nyssomyia intermedia and the first notification of Lutzomyia longipalpis in Rio de Janeiro, Ilha Grande, Angra dos Reis. In August of 2002 the first canine case of visceral leishmaniasis in the Ilha Grande, Angra dos Reis was notified. Surveys of phlebotomines in the peridomiciliary areas, in the period of November, 2002, through May, 2003, in four localities of Angra dos Reis, resulted in 12,554 specimens belonging to nine species: Brumptomyia sp. Nyssomyia intermedia, Migonemyia migonei, Micropygomyia schreiberi, Pintomyia fischeri, Psychodopygus davisi, Psychodopygus ayrosai

  7. Detecção do vírus da cinomose canina por RT-PCR utilizando-se oligonucleotídeos para os genes da fosfoproteína, hemaglutinina e neuraminidase Detection of canine distemper virus by RT-PCR using oligonucleotides targeted to the phosphoprotein, hemagglutinin and neuraminidase genes

    Directory of Open Access Journals (Sweden)

    M. Pozza

    2007-10-01

    Full Text Available Empregou-se a técnica de reação em cadeia pela polimerase precedida de transcrição reversa para detecção do vírus da cinomose canina (CC. Para a padronização da técnica foram selecionados quatro pares de oligonucleotídeos (P1, P2, N1, H1, baseados em seqüências dos genes da fosfoproteína, neuraminidase e hemaglutinina, sendo utilizadas três cepas vacinais de vírus da CC como controles positivos. Foram analisadas três amostras isoladas de cães com cinomose e quatro amostras provenientes de cães com suspeita clínica de cinomose. Não houve amplificação nas amostras com suspeita clínica da doença. Os resultados obtidos com os oligonucleotídeos P1 e N1 foram superiores aos de H1. Os oligonucleotídeos P2 foram considerados inapropriados para a detecção do vírus da CC. Os amplicons obtidos com os oligonucleotídeos P1, N1 e H1 foram clivados com endonucleases de restrição, sendo os perfis das amostras virais comparados aos da amostra vacinal Lederle, utilizada como referência. Um padrão similar de restrição foi observado em todas as amostras analisadas.The reverse transcription-polymerase chain reaction was used to detect canine distemper virus (CDV. Four oligonucleotide pairs were selected (P1, P2, N1, H1, based on the sequences of the phosphoprotein, hemagglutinin and nuraminidase genes for assay standardization, and three CDV vaccine strains were used as positive controls. Three viral isolates from dogs with canine distemper and four samples from animals clinically suspected of distemper were analysed. No amplification was detected in suspected samples. Results obtained by using P1 and N1 oligonucleotides were superior to those with H1 ones. P2 oligonucleotides were considered inadequate for CDV detection. Amplicons resulting from amplification of P1, N1 and H1 oligonucleotides were submitted to cleavage by restriction endonucleases and restriction patterns of viral samples were compared to that of Lederle strain

  8. Ondas ultra-sônicas de alta freqüência causam disfunção endotelial em artérias coronárias caninas epicárdicas High-frequency ultrasonic waves cause endothelial dysfunction on canine epicardial coronary arteries

    Directory of Open Access Journals (Sweden)

    Berent Discigil

    2008-06-01

    Full Text Available OBJETIVO: Aplicação de energia por ultra-som pode facilitar a remoção da placa ateromatosa, mas o efeito desse procedimento em vasos próximos ainda é matéria de estudos experimentais. MÉTODOS: Para determinar se a energia ultra-sônica compromete a produção de óxido nítrico, segmentos de artérias coronárias caninas foram expostos a baixos (0-10 W e altos (25 W níveis de energia por 15 segundos, utilizando-se protótipo de aparelho para a realização de endarterectomia. Após exposição, segmentos das artérias coronarianas foram estudados em organ chambers. Para os ensaios farmacológicos foram utilizadas as seguintes drogas:difosfato de adenosina (ADP, acetilcolina (Ach e fluoreto de sódio (NaF para a avaliação do relaxamento dependente do endotélio. O nitroprussiato de sódio (NPS e o isoproterenol foram utilizados para a avaliação do relaxamento independente do endotélio. RESULTADOS: A aplicação de alta energia ultra-sônica comprometeu o relaxamento dependente do endotélio induzido por ADP (10-9 - 10-4 M, Ach (10-9 - 10-4 M e NaF (0,5 -9,5 mM em artérias coronarianas epicárdicas. Entretanto, baixos valores de energia ultra-sônica não alteraram o relaxamento dependente do endotélio (nem o relaxamento máximo e nem a EC50 induzido pelos mesmos agonistas. O relaxamento da musculatura lisa vascular induzido por isoproterenol (10-9 - 10-5 M ou NPS (10-9 - 10-6 M não foi comprometido, tanto por baixos, quanto por altos níveis de energia ultra-sônica. CONCLUSÃO: Os experimentos demonstram que altas energias ultra-sônicas alteram a função endotelial. Entretanto, o ultra-som não altera a habilidade de relaxamento da musculatura lisa vascular de artérias caninas epicárdicas.OBJECTIVE: Application of ultrasound energy by an endarterectomy probe can facilitate the removal of atheromatous plaque, but the effect of this procedure on surrounding vessel structure and function is still a matter of experimental

  9. Perfil de restrição de um fragmento do gene da hemaglutinina amplificado pela RT-PCR a partir de estirpes vacinais e selvagens do vírus da cinomose canina Restriction pattern of a hemagglutinin gene amplified by RT-PCR from vaccine strains and wild-type canine distemper virus

    Directory of Open Access Journals (Sweden)

    F.J. Negrão

    2006-12-01

    Full Text Available Fragmentos com 721 pares de bases do gene da hemaglutinina (H do vírus da cinomose canina (CDV, amplificados pela RT-PCR a partir de três estirpes vacinais (Snyder Hill, Onderstepoort e Rockborn e de 27 amostras de campo, provenientes de cães com cinomose, foram clivados com as endonucleases Hinf I and Rsa I. A seleção das enzimas foi realizada por meio de análises in silico de seqüências do CDV depositadas em bases públicas de dados. Tanto as estirpes vacinais quanto as amostras selvagens do CDV apresentaram com a enzima Hinf I o mesmo perfil de restrição, confirmando a identidade do fragmento amplificado pela RT-PCR, uma vez que todas as estirpes com seqüências disponíveis (GenBank têm sítios de restrição para essa enzima nas mesmas posições. O perfil de restrição das estirpes vacinais Snyder Hill e Onderstepoort, que diferem entre si, foi confirmado com a enzima Rsa I que também clivou a estirpe Rockborn nas mesmas posições que a estirpe Snyder Hill. Todas as 27 amostras de campo do CDV apresentaram com a enzima Rsa I o mesmo perfil de restrição, indicando conservar os mesmos sítios de restrição para essa enzima. O perfil das amostras de campo foi diferente daquele obtido nas três estirpes vacinais. Os perfis de restrição do gene que codifica a hemaglutinina do CDV, gerados pela enzima Rsa I, sugerem diferenças moleculares entre as estirpes vacinais e as selvagens circulantes na região norte do estado do Paraná e abrem a perspectiva da elaboração de análises moleculares comparativas mais complexas, como o seqüenciamento de todo o gene H, de estirpes do CDV identificadas em diferentes regiões brasileiras.The restriction fragment length polymorphism (RFLP assay of a 721 bp fragment from hemagglutinin (H gene of canine distemper virus (CDV amplified by RT-PCR was analyzed with Hinf I and Rsa I enzymes. Clinical samples from 27 dogs with natural canine distemper infection, and three vaccine (Snyder Hill

  10. Sensitivity evaluation of a single-step PCR assay using Ehrlichia canis p28 gene as a target and its application in diagnosis of canine ehrlichiosis Avaliação da sensibilidade da PCR em uma etapa com base no gene p28 de Ehrlichia canis e sua aplicação no diagnóstico da erliquiose canina

    Directory of Open Access Journals (Sweden)

    Andrea Cristina Higa Nakaghi

    2010-06-01

    alternativa no diagnóstico da erliquiose canina.

  11. Detecção do gene da nucleoproteína do vírus da cinomose canina por RT-PCR em urina de cães com sinais clínicos de cinomose Detection of canine distemper virus nucleoprotein gene by RT-PCR in urine of dogs with distemper clinical signs

    Directory of Open Access Journals (Sweden)

    C.M.S. Gebara

    2004-08-01

    Full Text Available A presença do vírus da cinomose canina (CDV foi avaliada pela reação em cadeia da polimerase, precedida de transcrição reversa (RT-PCR, em 87 amostras de urina de cães que apresentavam sinais clínicos sugestivos de cinomose. Os animais foram distribuídos em três grupos. No grupo A foram incluídos 41 cães com alterações sistêmicas; no grupo B, 37 cães com alterações neurológicas; e no grupo C, nove cães com alterações sistêmicas e neurológicas simultâneas. O grupo D (controle foi composto por 20 cães assintomáticos. Os resultados da RT-PCR foram correlacionados com a forma clínica da infecção e com as alterações hematológicas encontradas. Foi possível a amplificação parcial do gene da nucleoproteína do CDV em 41 (47,1% das 87 amostras de urina provenientes de cães com sinais clínicos sugestivos de cinomose. Todas as amostras obtidas de animais assintomáticos foram negativas na RT-PCR. Amostras positivas foram encontradas nos três grupos de animais com sinais clínicos na proporção de 51,2% (24/41, 29% (11/37 e 100% (9/9 para os grupos A, B e C, respectivamente. A leucocitose foi a alteração hematológica mais freqüente nos três grupos de cães com sinais clínicos porém, não foi possível estabelecer correlação entre o resultado da RT-PCR e as alterações hematológicas. Os resultados demonstraram que, independente da forma de apresentação clínica, a técnica da RT-PCR realizada em urina pode ser utilizada no diagnóstico ante mortem da infecção pelo CDV.The urine of 87 dogs with clinical signs suggestive of canine distemper was analyzed by RT-PCR for detection of canine distemper virus (CDV nucleoprotein gene. The samples were allotted to the following groups: group A- with 41 dogs with systemic symptoms, group B- with 37 dogs with neurological signs, and group C- with 9 dogs with simultaneous systemic and neurological clinical signs. Group D (control included 20 assymptomatic dogs. A chi2

  12. Toxoplasmose em animais silvestres e domésticos da região de Botucatu, estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Ednir Salata

    1985-02-01

    Full Text Available Os Autores analisaram soros de 47 Cannis familiaris, de 9 Felis cattus, de 64 Didelphis marsupialis aurita, de 9 Dasypus novemcinctus, de 4 Cabassous tatouay e de 29 Rattus rattus, através da reação de imunofluorescência indireta, para pesquisar a presença de anticorpos anti Toxoplasma gondii. Estes foram encontrados apenas em C. familiaris (63,8% e em D. m. aurita (4,7%. Frente aos resultados obtidos, os Autores sugerem que novas pesquisas nesta área sejam realizadas, para que se conheça melhor a importância epidemiológica de várias espécies animais na disseminação da toxoplasmose.

  13. Evaluación del efecto analgésico postoperatorio de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía Evaluation of postoperative analgesic effect of intraoperative infusions of tramadol and tramadol/lidocaine/ketamine compared with morphine/lidocaine/ketamine in female dogs undergoing ovariohysterectomy

    Directory of Open Access Journals (Sweden)

    MA Fajardo

    2012-01-01

    Full Text Available El objetivo de este estudio fue evaluar y comparar la eficacia analgésica postoperatoria de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía. Se usaron 30 hembras caninas sin distinción de raza con una edad entre 1 y 10 años y un peso entre 2,5 y 37 kilogramos, conformando tres grupos aleatorios de 10 animales cada uno: grupo tramadol, grupo tramadol/lidocaína/ ketamina y grupo morfina/lidocaína/ketamina, bajo anestesia general inhalada y ovariohisterectomía realizada por un mismo cirujano para todos los pacientes. El efecto analgésico postoperatorio se determinó mediante la escala de dolor de la Universidad de Melbourne, iniciando 30 minutos posteriores a la extubación endotraqueal del paciente, para luego tomar datos cada 30 minutos hasta completar un período de seis horas. El análisis estadístico se realizó con un test de Kruskal-Wallis para los datos no paramétricos. Los resultados obtenidos mostraron que los puntajes en el grupo tramadol presentaron diferencias estadísticamente significativas (P The goal of this study was to evaluate and compare the post-operative analgesic efficacy of intra operative infusions of tramadol and tramadol/lidocaine/ketamine compared to morphine/lidocaine/ketamine in female canines undergoing ovariohysterectomy. 30 female canines were used, without breed distinction with an average age between 1 and 10 years and weight between 2.5 y 37 kgs, creating 3 randomly allocated groups of 10 animals each: tramadol group, tramadol/lidocaine/ketamine group and morphine/lidocaine/ketamine group. All the animals were anesthetized using a standard technique and maintained with inhaled anesthetics, the surgical procedure was performed by the same trained surgeon. The postoperative analgesic effect was determined using the Melbourne Pain Scale, starting 30 minutes after endotracheal

  14. Esporotricose canina: relato de caso Canine sporotrichosis: case report

    Directory of Open Access Journals (Sweden)

    N.T. Souza

    2009-06-01

    Full Text Available Relata-se um caso de esporotricose em um cão da raça Boxer, macho, com seis anos, encaminhado para uma consulta por causa de massa na região nasal e de dispneia. Após o exame físico, o animal foi internado para a realização de citologia, histologia e radiografia. Nos exames citológico e radiográfico, não foram constatadas alterações que justificassem a massa e a dispneia. Na histologia, observou-se a presença de um granuloma contendo dois esporos de Sporothrix schenckii. Foi realizado tratamento com itraconazol 5mg/kg BID por 60 dias. Após esse período, a massa desapareceu e a respiração do animal melhorou, tendo sido recomendada a manutenção da terapia por mais 30 dias, para evitar recidiva.A case of canine sporotrichosis was reported in a six-year-old male Boxer, referred to a veterinary hospital because of a mass in the region of the nose and dyspnea. After physical examination, the animal was submitted to cytological, histological, and radiographic exams. The cytological and radiographic exams showed no alterations that could justify the mass and the dyspnea. The histological exam showed the presence of a granuloma with two Sporothrix schenckii spores. The dog was treated with itraconazol 5mg/kg BID during 60 days. After this period, the mass disappeared and breathing improved. The therapy was maintained for 30 other days to avoid relapse.

  15. Rosa canina as an adjunctive treatment of asthma: A hypothesis

    OpenAIRE

    Samin Hamidi; Haleh Vaez; Parina Asgharian

    2015-01-01

    Asthma is one of the most common chronic disorders and about 7% of the US population suffers from asthma. Initial response to allergy is associated with mediators like histamine, prostaglandin (PG) D2 and leukotriene (LT) C4. In asthmatic patients, 5-lipo-oxygenase (5-LO) pathway produces more LTC4 than the healthy people. Also, pro-inflammatory factors like interleukin (IL)-1, IL-6 and Tumor Necrosis Factor (TNF)-α play a remarkable role in bronchoconstriction. The common asthma medications ...

  16. USO DE FIPRONIL SPRAY NO TRATAMENTO DA ESCABIOSE CANINA

    Directory of Open Access Journals (Sweden)

    Silvia Franco Andrade

    2005-06-01

    Full Text Available The objective of this work was to prove the effectiveness of the fipronil spray (FRONTLINE, a new synthetic molecule, as a safe acaricide in dogs. Were analyzed 10 dogs from the attendance of the service of Dermatology of the Veterinary Hospital and of the kennel of UNOESTE, Presidente Prudente, SP, with symptomatic and tested positive for scabies by scrapings, and used the fipronil spray in the whole body of the animal, besides external ear conduct, weekly until the disappearance of the symptoms and scrapings from the skin tested negative for scabies. The remission of the symptoms jointly with scraped of skin negative it happened on average from 4 to 6 weeks, demonstrating to be the fipronil spray effective and practical could be a safe alternative in the treatment of the canine scabies.

  17. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  18. Word generalization by a dog (Canis familiaris): is shape important?

    Science.gov (United States)

    van der Zee, Emile; Zulch, Helen; Mills, Daniel

    2012-01-01

    We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321

  19. Canny edge detection based on OpenCV in Ubuntu%Ubuntu下基于OpenCV的Canny边缘检测

    Institute of Scientific and Technical Information of China (English)

    许才敬

    2011-01-01

    详细地介绍了用于数字图像处理的开放源代码的计算机视觉类岸-OpenCV.利用OpenCV中的数字图像处理函数使复杂的问题变得简单化.介绍了OpenCV的特点和功能,讨论了在Ubuntu环境下如何配置OpenCV,最后在此基础上给出了一个CAnny边缘检测应用实例,其对数字图像处理的研究具有一定的实用价值.

  20. Disfunção endotelial após isquemia global e reperfusão em cirurgia cardíaca com circulação extracorpórea: estudo do papel do magnésio em artérias coronarianas caninas

    Directory of Open Access Journals (Sweden)

    Marco A. VOLPE

    2002-09-01

    Full Text Available OBJETIVO: Estudar a disfunção endotelial conseqüente à lesão provocada por isquemia global seguida de reperfusão e a potencial influência protetora do magnésio sobre a integridade funcional do endotélio em coronárias isoladas de cães. MÉTODO: Segmentos de artérias coronárias caninas foram suspensos em banhos orgânicos para medida de força isométrica. A disfunção endotelial foi avaliada pela capacidade destes segmentos produzirem óxido nítrico, alterando a força isométrica inicial. Foram selecionados quatro grupos com seis cães em cada um: SEM CEC (controle, CEC (110 minutos de perfusão sem isquemia, ISQ (45 minutos de isquemia, ISQ/REP (45 minutos de isquemia seguidos de 60 minutos de reperfusão. A ação do magnésio foi avaliada em três fases: I (banho orgânico com magnésio, II (banho orgânico sem magnésio e III (banho orgânico com magnésio restaurado. Foram utilizados três agonistas farmacológicos que representam os principais passos da via de produção do óxido nítrico: receptor de membrana da célula endotelial - acetilcolina (ACh; transdução do sinal entre o receptor e os processos intracelulares através da G-proteína - fluoreto de sódio (NaF; liberação dos estoques intracelulares de cálcio - cálcio ionóforo (A23187. Ao estudo da função endotelial associou-se a avaliação da atividade da musculatura lisa dependente de GMPc - nitroprussiato de sódio (NPS. RESULTADOS: Os principais achados desta investigação foram: 1 a presença de magnésio no perfusato pareceu atenuar a disfunção endotelial causada por isquemia global seguida de reperfusão; 2 a presença de magnésio no banho orgânico (fase I associou-se a maior relaxamento em resposta aos agonistas da produção de óxido nítrico; 3 a remoção de magnésio do banho orgânico (fase II esteve associada à redução na intensidade do relaxamento em resposta aos agonistas da produção de óxido nítrico; 4 a restauração de magn

  1. High Penetrance of a Pan-Canina Type rDNA Family in Intersection Rosa Hybrids Suggests Strong Selection of Bivalent Chromosomes in the Section Caninae

    Czech Academy of Sciences Publication Activity Database

    Crhák Khaitová, Lucie; Werlemark, G.; Kovaříková, Alena; Nybom, H.; Kovařík, Aleš

    2014-01-01

    Roč. 143, 1-3 (2014), s. 104-113. ISSN 1424-8581 R&D Projects: GA ČR(CZ) GA13-10057S Institutional support: RVO:68081707 Keywords : Asymmetrical meiosis * Dogrose * Interspecies hybrid Subject RIV: BO - Biophysics Impact factor: 1.561, year: 2014

  2. Neosporosis canina: Presencia de anticuerpos sericos en poblaciones caninas rurales y urbanas de Chile Neosporosis canine: detection of sera antibodies in rural and urban canine population of chile

    Directory of Open Access Journals (Sweden)

    A.N. Patitucci

    2001-01-01

    Full Text Available Neospora caninum es un protozoo parásito cuya infección se ha reportado en vacunos, caninos y otras especies en diversas partes del mundo. Los perros actúan como huéspedes definitivos e intermediario a la vez. En esta especie la enfermedad se caracteriza por paresia y/o parálisis de los miembros posteriores y puede ser fatal tanto en cachorros infectados transplacentariamente como en adultos. En Chile, no existe información sobre Neospora en caninos pero se ha demostrado la presencia de anticuerpos contra el protozoo en bovinos, por tal motivo se propuso la identificación de la infección mediante la detección de anticuerpos séricos contra N. caninum en perros. Se estudiaron 201 sueros caninos de diferentes edades, sexo, raza, ambiente ("rural" vs. "urbano" y tipo de alimentación ("carne cruda" vs. "no cruda" en una dilución 1:50 mediante la técnica de Inmuno Fluorescencia Indirecta (IFA. Del total de perros estudiados, el 18% (36/201 presentó anticuerpos contra N. caninum. Además se demostró asociación entre la cantidad de positivos y el ambiente y con el tipo de alimentación; no obstante, no hubo relación con el sexo, raza y edad. Los resultados indican que el pertenecer al ambiente rural y/o consumir carne cruda pueden ser importantes factores de riesgo dentro de la epidemiología de la infección por N.caninum. Complementariamente se procesaron dos sueros de zorros (Pseudolapex fulvipes mediante la técnica del Aglutinación de taquizoitos de Neospora (NAT que resultaron positivos hasta la máxima dilución analizada (1:320, demostrando que los animales estaban infectados al momento de la toma de muestra y abriendo interrogantes en la epidemiología de la enfermedad a nivel local.Neospora caninum is a protozoan parasite whose infection has been detected in canine, bovine and others species around the world. In Chile, the presence of the disease has been already demonstrated in cows of the IX Region of the country. In the present study we investigated the presence of antibodies against N. caninum in dog sera. Blood samples of 201 dogs were taken from different local veterinary clinics and in rural areas of IX Region of the country, data about the dog sex, age, breed, "rural" or "urban" habitat and if they consume or not "raw meat" was collected. The 18% (36/201 of the studied animals had 1:50 dilution IFA test antibodies. There was difference in the amount of positives between rural 26% (21/81 and urban 12,5% (34/120 dog populations (OR=2,45. Only in 68% (136/201 of the cases, it was possible to determine the dog’s feed, and there was also difference in the seropositives between "raw meat" (29,5%; 21/71 vs. "no raw meat" (7%; 9/65 (OR = 2,613. There were no differences by sex, breed and age. A Neospora Aglutination Test (NAT in two sera of Chiloe’s fox (Pseudolapex fulvipes were positive (1:320, these animals are native of Chile but they were owned by a local zoo. This study shows that dogs of IX Region of Chile were infected with N. caninum, and although limited, the results suggest that the canine rural population and/or those fed with raw meat have more risk of being infected. On the other hand the positivity of the two studied foxes open interesting questions about their potential role as diffusers of the disease.

  3. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L.S.

    1988-12-31

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  4. Canny边缘检测算法在机器人视觉中的应用%Application of Canny Edge Detection Algorithm in Robot Version

    Institute of Scientific and Technical Information of China (English)

    陈宏申; 李环

    2011-01-01

    OpenCV是一个以C函数为主,提供多语言接口,轻量并高效的计算机视觉库.实现了图像处理和计算机视觉方面的多种通用算法。利用其Canny边缘检测算法.实现模糊图像的边缘检测,参照L2BOT视觉机器人实例,对单一背景模式下基于OpenCV的条形码与障碍物识别进行研究,并对机器人移动路线最优选择提供一种参考模型。%OpenCV is a lightweight and efficient library of programming functions, mainly aim at real time computer vision, which realizes a series of general algorithm in the field of image processing and computer vision, it consists of C function mainly and prov

  5. Alternativas Terapéuticas en las neoplasias vesicales caninas Therapeutic options in canine bladder tumors

    OpenAIRE

    R.L. Rovere; A. ALCOBA

    2002-01-01

    Las neoplasias vesicales en caninos representan menos del 1% de los tumores presentes en esta especie. El tratamiento quirúrgico se indica en tumores benignos y como complemento de la quimioterapia y radioterapia. Para la quimioterapia se emplean más frecuentemente la doxorrubicina, el 5-fluorouracilo, la ciclofosfamida, la vincristina y cisplatino. La asociación de la doxorrubicina-ciclofosfamida por vía sistémica en asociación con el cisplatino intravesical, sería un tratamiento recomendabl...

  6. Soroprevalência de brucelose canina na cidade de Alfenas, MG: dados preliminares

    Directory of Open Access Journals (Sweden)

    Almeida A.C.

    2001-01-01

    Full Text Available One hundred and two blood serum samples from dogs referred to the Veterinary Teaching Hospital of Alfenas University, were submitted to the agarose immune diffusion and to the fast serum-agglutination tests addressed to find antibodies anti- Brucella canis and B. abortus, respectively. Five samples (4.9% were positives for B. canis and none for B. abortus. This prevalence is considered by some as an alert for an epidemiologic and public healthy problems, considering the serious zoonotic aspect of canine brucellosis

  7. Clinical approach to canine vaginitisAbordagem clínica da vaginite canina

    Directory of Open Access Journals (Sweden)

    Maria Isabel Mello Martins

    2012-08-01

    Full Text Available Vaginitis is a rare disease in adult female dogs. However, knowledge regarding this illness is important because, if secondary to reproductive tract anomalies that go uncorrected, it can cause ascending uterine infections and, consequently, subfertility or even infertility. Usually, these infections are caused by Enterobacter or microorganisms from the urogenital inferior system, such as Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, etc. In some cases, vaginitis may be caused by primary infections with Brucella canis, which is zoonotic, or by canine herpesvirus; both of these agents have the potential to cause reproductive failure. The disease can occur in any age, breed or ovarian condition and can be identified by vaginal cytology, vaginoscopy and culture of vaginal secretions. The most common clinical signs are erythema of the vaginal mucous, vaginal discharge, pollakiuria, licking of the vulva and attraction of male dogs, independent of the phase of the estrous cycle. This disease is generally self-limiting, and the treatment, when necessary, consists of antibiotic therapy, vaginal cleaning with antiseptic and, eventually, surgical correction of predisposing abnormalities. A vaginite é uma afecção rara em cadelas adultas. É uma causa importante de subfertilidade ou infertilidade, quando secundária à anomalias do trato reprodutivo. Normalmente, são causadas por enterobactérias ou pela microbiota do sistema urogenital inferior, tais como Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, entre outras. Em alguns casos, pode ser primária como infecções por Brucella canis, a qual é uma zoonose ou herpesvírus canino, importante causa de falhas reprodutivas. A afecção acomete fêmeas de qualquer idade, raça ou condição ovariana. Os sinais clínicos envolvem mucosa vaginal hiperêmica, corrimento vulvar, polaquiúria, lambedura vulvar, e atração de machos independente da fase do ciclo estral. Pode ser diagnosticada por citologia vaginal, vaginoscopia e cultura da secreção. A enfermidade, muitas vezes, é autolimitante e o tratamento, quando necessário, e’ realizado com infusão vaginal de antissépticos ou antibióticos e, eventualmente, correção cirúrgica de anormalidades predisponentes.

  8. Alternativas Terapéuticas en las neoplasias vesicales caninas Therapeutic options in canine bladder tumors

    Directory of Open Access Journals (Sweden)

    R.L. Rovere

    2002-01-01

    Full Text Available Las neoplasias vesicales en caninos representan menos del 1% de los tumores presentes en esta especie. El tratamiento quirúrgico se indica en tumores benignos y como complemento de la quimioterapia y radioterapia. Para la quimioterapia se emplean más frecuentemente la doxorrubicina, el 5-fluorouracilo, la ciclofosfamida, la vincristina y cisplatino. La asociación de la doxorrubicina-ciclofosfamida por vía sistémica en asociación con el cisplatino intravesical, sería un tratamiento recomendable, en particular en los casos de carcinoma de células de transiciónThe canine urinary bladder tumors represent less than 1% of all tumors present in this species. Surgical treatment is indicated in benign tumors and combined with chemotherapy or radiotherapy. Doxorubicin, 5 fluorouracil, cyclophosphamide, vincristine and cisplatin are the drugs mostly used for chemotherapy. Systemic Doxorubicin-ciclophosphamide therapy in association with intravesical cisplatin therapy are recommended, particularly in transitional cell carcinoma

  9. Isolamento, cultivo e diferenciação de células tronco mesenquimais caninas

    OpenAIRE

    Patricio, Lia Fordiani Lenati

    2012-01-01

    Resumo: As celulas tronco sao celulas nao diferenciadas de embrioes, fetos ou tecidos adultos, com o potencial de gerar celulas de diversos tecidos sob o estimulo bioquimico, hormonal e mecanico adequado, in vitro ou in vivo. As celulas tronco embrionarias e fetais sao pluripotentes e as celulas tronco adultas sao multipotentes e nao especializadas. Dentre as celulas tronco adultas, as celulas tronco mesenquimais (CTMs) ja foram identificadas em diferentes orgaos e tecidos, como tecido adipos...

  10. ABORDAGEM ATUAL DA INSUFICIÊNCIA RENAL CRÔNICA CANINA

    Directory of Open Access Journals (Sweden)

    BRUM, Alexandre Martini de

    2009-05-01

    Full Text Available Nucleus Animalium, v.1, n.1, maio 2009The chronic renal failure is a consequence of a lack of renal diseases, that culminates in loss ofthe kidney excretory and concentrator functions. It’s considered the main renal dog affection and it’s marked for itsprogression, in such a way that independently of the cause, leads to the gradual and irreversible destruction of thenefrons. Much discussion is made on therapies for delaying the disease advance, although the survival of animalswith renal failure does not depend on only the choice of the ideal therapeutics but on the conscious of their ownersand veterinarians in relation to the importance of the early diagnostic, identification of the original renal disease,the nutrition of this patient and clinic – laboratory aspects in its several phases. This article proposes to reviewthe main changes caused by chronic renal failure, marking the principal points on physiopathology, diagnosticmethods, therapeutic and clinic management of the chronic renal patient, in order to retard the disease progression and providing best life quality.A insuficiência renal crônica (IRC é a consequência de uma gama de doenças renais, culminado naperda das funções excretora e concentradora dos rins. Considerada a principal afecção renal dos cães, destaca-sepor sua progressão, e que independentemente da causa, leva à destruição lenta e irreversível dos néfrons. Muito sediscute sobre terapias que retardem o avanço do quadro, porém a sobrevida dos animais insuficientes renais nãodepende somente da escolha da terapêutica medicamentosa ideal, mas da conscientização de proprietários e médicosveterinários em relação à importância do diagnóstico precoce, da identificação da doença renal desencadeadorado processo, da nutrição deste paciente e das manifestações clínico–laboratoriais apresentadas em suas diversasfases. Propõe-se com este artigo revisar as principais alterações decorrentes da IRC, enfocando pontos chaves dafisiopatologia, meios diagnósticos, terapêutica e manejo clínico do paciente renal crônico, visando ao retardamento da progressão da doença e propiciando maior qualidade de vida ao paciente.

  11. Meio de contraste ioversol em neuroradiologia canina Ioversol contrast medium in canine neuroradiology

    Directory of Open Access Journals (Sweden)

    Eduardo Alberto Tudury

    1997-12-01

    Full Text Available O ioversol, contraste iodado hidrossolúvel não iônico, na concentração de 320mg I/ml foi utilizado para a realização de 26 estudos neuroradiográficos contrastados (mielografias, epidurografias, e ventrículografia cerebral em 22 cães. Devido à rápida absorção do contraste, as melhores radiografias foram obtidas nos primeiros 30 minutos. O produto ofereceu apropriadas radiopacidade, tempo de permanência, difusão e miscibilidade no líqüor, facilitando os diagnósticos, assim como mínima ocorrência de reações indesejáveis durante e após o procedimento radiológico. Apesar de terem sido utilizados para a anestesia, as associações zolazepam-tiletamina e levomepromazina; xilazina ou diazepam-tiopental sódico, nenhum paciente desenvolveu convulsões. A apresentação do ioversol em frasco arnpola foi também outra vantagem, por diminuir o desperdício e facilitar a reesterilização do excedente na autoclave.Ioversol, a non-ionic, hydrosoluble iodine contrast medium at a concentration of 320mg I/ml was used to perform 26 contrast neuroradiographic studies (myelography, epidurography and cerebral ventriculography in 22 dogs. Since this contrast medium is rapidly absorbed, proper radiographs were obtained within 30 minutes of injection. The product showed adequate radio-opacity, retention time, diffusion and liquor miscibility. Minimal side effects both during and after the radiographic procedures were observed. Not one patient developed seizures, in spite of the use of anesthetic protocols that included either zolarepan-tiletamine or levomepromazin- zilazine- or diazepam-sodium thiopental. The presentation of the contrast medium in a multiple dose vial was considered an advantage, since it decreases losses and allows repeated sterilization in autoclave.

  12. Meio de contraste ioversol em neuroradiologia canina Ioversol contrast medium in canine neuroradiology

    OpenAIRE

    Eduardo Alberto Tudury; Mônica Vicky Bahr Arias; Pedro Luis de Camargo; Maria de Lourdes Estrella Faria; Carmen Esther Grumadas Machado

    1997-01-01

    O ioversol, contraste iodado hidrossolúvel não iônico, na concentração de 320mg I/ml foi utilizado para a realização de 26 estudos neuroradiográficos contrastados (mielografias, epidurografias, e ventrículografia cerebral) em 22 cães. Devido à rápida absorção do contraste, as melhores radiografias foram obtidas nos primeiros 30 minutos. O produto ofereceu apropriadas radiopacidade, tempo de permanência, difusão e miscibilidade no líqüor, facilitando os diagnósticos, assim como mínima ocorrênc...

  13. Aspectos epidemiológicos de las mordeduras caninas Epidemiological aspects of dog bites

    OpenAIRE

    Jorge Palacio; Marta León; Sylvia García-Belenguer

    2005-01-01

    Las mordeduras de animales a personas suponen un importante problema de salud pública. Dentro de éstas, las más frecuentes son las producidas por perros. Un primer paso necesario en la prevención de este tipo de accidentes es conocer los factores de riesgo implicados. El presente trabajo revisa la bibliografía más relevante en cuanto a la incidencia, los factores de riesgo y la prevención de las mordeduras de perros en personas. Así, según las características de las víctimas, se revisan deter...

  14. Aspectos epidemiológicos de las mordeduras caninas Epidemiological aspects of dog bites

    Directory of Open Access Journals (Sweden)

    Jorge Palacio

    2005-02-01

    Full Text Available Las mordeduras de animales a personas suponen un importante problema de salud pública. Dentro de éstas, las más frecuentes son las producidas por perros. Un primer paso necesario en la prevención de este tipo de accidentes es conocer los factores de riesgo implicados. El presente trabajo revisa la bibliografía más relevante en cuanto a la incidencia, los factores de riesgo y la prevención de las mordeduras de perros en personas. Así, según las características de las víctimas, se revisan determinados aspectos, como la edad, el sexo, la localización y la gravedad de las lesiones. En relación con los perros agresores, se describen las razas implicadas y el historial previo del animal. Igualmente, se describen los contextos en que se producen las mordeduras, en relación con la fecha, el número de perros, los lugares más frecuentes, la relación e interacción víctima-perro y la participación de las distintas categorías de agresividad del etograma canino. En el último apartado se recogen las recomendaciones más habituales halladas en la bibliografía para prevenir y reducir la incidencia de mordeduras sobre la población general.Animal bites in humans are an important public health problem. Most of these bites are dog bites. The first step in preventing this kind of accident is to identify the associated risk factors. The present article reviews the most important published articles on the incidence of dog bites, their risk factors, and preventive measures. Concerning victim profiles, features such as age, sex, location, and the severity of the wounds are reviewed. Regarding dogs, the most frequent breeds involved and the dog's previous history of aggression are described. In addition, the different contexts in which bites occur are reported. Thus, factors such as dates, number of dogs, places, victim-dog relationship and interaction, and the distinct involved categories of aggression of the canine ethogram are reviewed. The most frequent recommendations found in the literature to reduce and prevent dog bites in the human population are also described.

  15. Sobrepoblación canina y felina: tendencias y nuevas perspectivas

    Directory of Open Access Journals (Sweden)

    C. A. Salamanca

    2011-06-01

    Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, seconsultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink yMedline, para la búsqueda de la información. Como palabras clave se utilizaron: perrosde libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblacióny control de población. Además se consultó el banco de publicaciones de la SociedadMundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias(OIE. El objetivo de esta revisión fue presentar una posición crítica sobre laproblemática de la sobrepoblación de mascotas, su percepción cultural y la relaciónhombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posiblessoluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséisreferencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos quecumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión.A medida que aumente nuestro conocimiento acerca de la tenencia responsablede las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de laeducación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos conrespecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental queejerce el médico veterinario en la comunidad.

  16. Role of the Rosa canina L. leaf extract as an antidiarrheal drug in rodents

    Directory of Open Access Journals (Sweden)

    Rajesh J Mandade

    2011-01-01

    Conclusions: The presence of some of the phytochemicals in the leaf extract may be responsible for the observed effects, and also the basis for its use in traditional medicine as an antidiarrheal drug.

  17. Poliartritis asociada a hepatozoonosis canina: descripción de un caso

    OpenAIRE

    Iveli, Sebastián; Casas, Luciano; Machuca, Mariana; Eiras, Diego Fernando; del Amo, Alicia

    2015-01-01

    El objetivo de este trabajo fue describir un caso de poliartritis asociada a Hepatozoon canis en un canino, mestizo, macho, de 5 meses de edad. El paciente presentaba fiebre (40,1 ºC), mucosas pálidas, linfonódulos superficiales ligeramente aumentados de tamaño, dolor lumbar, aumento de tamaño de varias articulaciones y abundantes garrapatas (Rhipicephalus sanguineous). En los extendidos sanguíneos se constató la presencia de gamontes de Hepatozoon sp. en el citoplasma de los neutrófilos. El ...

  18. Sobrepoblación canina y felina: tendencias y nuevas perspectivas

    Directory of Open Access Journals (Sweden)

    C. A. Salamanca

    2011-01-01

    Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, se consultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink y Medline, para la búsqueda de la información. Como palabras clave se utilizaron: perros de libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblación y control de población. Además se consultó el banco de publicaciones de la Sociedad Mundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias (OIE. El objetivo de esta revisión fue presentar una posición crítica sobre la problemática de la sobrepoblación de mascotas, su percepción cultural y la relación hombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posibles soluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséis referencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos que cumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión. A medida que aumente nuestro conocimiento acerca de la tenencia responsable de las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de la educación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos con respecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental que ejerce el médico veterinario en la comunidad.

  19. Resistência de estafilococos de origem canina, frente à drogas anti microbianas em Londrina, PR.

    Directory of Open Access Journals (Sweden)

    Amauri Alcindo Alfieri

    1985-11-01

    Full Text Available The sensitivity of 71 staphylococci (S. aureus and S. intermedius, isolated from dogs with signs of skin disease, to J1 chemotherapeutic agents was determined. Of the strains, 55(77,46% were resistant to amicacin, 29(40,84% to penicillin G, 26(36,61% to ampicillin, 24(33,80% to tetracycline, 15(21,13% to chloramphenicol, 12(16,90% to erytromycin, 11(15,49% to kanamycin, 8(11,27% to gentamycin, 5(7,04% to sulfazothrim, 2(2,82% to cefoxithin and 1(1,41% to oxacillin.Foram examinadas 71 cepas de estafilococos (S. aureus e S. intermedius isoladas a partir de cães com pioderma, frente a 11 substâncias antimicrobianas. Das cepas, 55(77,46% apresentaram resistência à amicacina, 29(40,84% à penicilina G, 26(36,61% à ampicilina, 24(33,80% à tetraciclina, 15(21,13% ao cloranfenicol, 12(16,90% à eritromicina, 11(15,49% à canamicina, 8(11,27% à gentamicina, 5(7,04% ao sulfazotrim, 2(2,82% à cefoxitina e 1(1,41% a oxacilina.

  20. AVALIAÇÕES CITOLÓGICAS EM OTITES CANINAS POR MALASSEZIA SPP.: ESTUDO RETROSPECTIVO

    Directory of Open Access Journals (Sweden)

    Alessandra Melchert

    2011-12-01

    Full Text Available Otitis externa is a condition frequently observed in dogs at the small animal clinics. Malassezia spp. is the most frequently isolated microorganism in the ears of dogs, which is one of the major etiologic agents of ear infections. Identification of this agent may be based on fungal culture or cytology, and the first method is longer and more expensive. The aim of this study was to conduct a retrospective study of the incidence of Malassezia spp. in cases of canine otitis by cytology, in a period of five years. Ear cytology samples from 249 dogs with suspected otitis were evaluated, and were observed positive samples for Malassezia spp. in 44 cases (17.67%, among these 35 dogs (79.5% with positive cytology in both ears, and 9 dogs (20.5% were positive for Malassezia in only one ear. In conclusion, dogs with suspected otitis present high incidence of positive Malassezia spp. cytology counts. Cytology revealed to be a useful tool for diagnosis of canine ear infections involving this pathogen, representing diagnostic alternative in cases where the culture is not feasible. However, one must consider that there is no national standard cytological counting yeast cells/field set for cases of canine otitis, which may represent possible misdiagnosis.

  1. Tuberculose canina e sua importância em saúde pública

    OpenAIRE

    Megid Jane; Bracarense Ana Paula F. R. L.; Reis Antonio Carlos F. dos; Sturion Domingos José; Martin Lígia M.M.; Pinheiro Sônia R.

    1994-01-01

    Relata-se um caso de uma família com diagnóstico de tuberculose, cujo cão também apresentava a enfermidade. Discute-se a importância do rastreamento epidemiológico animal em casos de tuberculose humana.

  2. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna Kis

    Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  3. Concomitant administration of GonaCon™ and rabies vaccine in female dogs (Canis familiaris) in Mexico.

    Science.gov (United States)

    Vargas-Pino, Fernando; Gutiérrez-Cedillo, Verónica; Canales-Vargas, Erick J; Gress-Ortega, Luis R; Miller, Lowell A; Rupprecht, Charles E; Bender, Scott C; García-Reyna, Patricia; Ocampo-López, Juan; Slate, Dennis

    2013-09-13

    Mexico serves as a global model for advances in rabies prevention and control in dogs. The Mexican Ministry of Health (MMH) annual application of approximately 16 million doses of parenteral rabies vaccine has resulted in significant reductions in canine rabies during the past 20 years. One collateral parameter of rabies programs is dog population management. Enhanced public awareness is critical to reinforce responsible pet ownership. Surgical spaying and neutering remain important to prevent reproduction, but are impractical for achieving dog population management goals. GonaCon™, an anti-gonadotropin releasing hormone (GnRH) vaccine, was initially tested in captive female dogs on the Navajo Nation, 2008. The MMH led this international collaborative study on an improved formulation of GonaCon™ in captive dogs with local representatives in Hidalgo, Mexico in 2011. This study contained 20 bitches assigned to Group A (6 control), Group B (7 GonaCon™), and Group C (7 GonaCon™ and rabies vaccine). Vaccines were delivered IM. Animals were placed under observation and evaluated during the 61-day trial. Clinically, all dogs behaved normally. No limping or prostration was observed, in spite of minor muscle atrophy post-mortem in the left hind leg of dogs that received GonaCon™. Two dogs that began the study pregnant give birth to healthy pups. Dogs that received a GonaCon™ injection had macro and microscopic lesions consistent with prior findings, but the adverse injection effects were less frequent and lower in intensity. Both vaccines were immunogenic based on significant increases in rabies virus neutralizing antibodies and anti-GnRH antibodies in treatment Groups B and C. Simultaneous administration of GonaCon™ and rabies vaccine in Group C did not affect immunogenicity. Progesterone was suppressed significantly in comparison to controls. Future studies that monitor fertility through multiple breeding cycles represent a research need to determine the value of integrating this vaccine into dog rabies management. PMID:23871822

  4. Algorithm-supported visual error correction (AVEC) of heart rate measurements in dogs, Canis lupus familiaris.

    Science.gov (United States)

    Schöberl, Iris; Kortekaas, Kim; Schöberl, Franz F; Kotrschal, Kurt

    2015-12-01

    Dog heart rate (HR) is characterized by a respiratory sinus arrhythmia, and therefore makes an automatic algorithm for error correction of HR measurements hard to apply. Here, we present a new method of error correction for HR data collected with the Polar system, including (1) visual inspection of the data, (2) a standardized way to decide with the aid of an algorithm whether or not a value is an outlier (i.e., "error"), and (3) the subsequent removal of this error from the data set. We applied our new error correction method to the HR data of 24 dogs and compared the uncorrected and corrected data, as well as the algorithm-supported visual error correction (AVEC) with the Polar error correction. The results showed that fewer values were identified as errors after AVEC than after the Polar error correction (p strings with deleted values seemed to be closer to the original data than were those with inserted means. We concluded that our method of error correction is more suitable for dog HR and HR variability than is the customized Polar error correction, especially because AVEC decreases the likelihood of Type I errors, preserves the natural variability in HR, and does not lead to a time shift in the data. PMID:25540125

  5. Whole Genome Association Study to Detect Single Nucleotide Polymorphisms for Behavior in Sapsaree Dog (Canis familiaris).

    Science.gov (United States)

    Ha, J H; Alam, M; Lee, D H; Kim, J-J

    2015-07-01

    The purpose of this study was to characterize genetic architecture of behavior patterns in Sapsaree dogs. The breed population (n = 8,256) has been constructed since 1990 over 12 generations and managed at the Sapsaree Breeding Research Institute, Gyeongsan, Korea. Seven behavioral traits were investigated for 882 individuals. The traits were classified as a quantitative or a categorical group, and heritabilities (h(2)) and variance components were estimated under the Animal model using ASREML 2.0 software program. In general, the h(2) estimates of the traits ranged between 0.00 and 0.16. Strong genetic (r G ) and phenotypic (r P ) correlations were observed between nerve stability, affability and adaptability, i.e. 0.9 to 0.94 and 0.46 to 0.68, respectively. To detect significant single nucleotide polymorphism (SNP) for the behavioral traits, a total of 134 and 60 samples were genotyped using the Illumina 22K CanineSNP20 and 170K CanineHD bead chips, respectively. Two datasets comprising 60 (Sap60) and 183 (Sap183) samples were analyzed, respectively, of which the latter was based on the SNPs that were embedded on both the 22K and 170K chips. To perform genome-wide association analysis, each SNP was considered with the residuals of each phenotype that were adjusted for sex and year of birth as fixed effects. A least squares based single marker regression analysis was followed by a stepwise regression procedure for the significant SNPs (p<0.01), to determine a best set of SNPs for each trait. A total of 41 SNPs were detected with the Sap183 samples for the behavior traits. The significant SNPs need to be verified using other samples, so as to be utilized to improve behavior traits via marker-assisted selection in the Sapsaree population. PMID:26104397

  6. Do dogs (Canis lupus familiaris make counterproductive choices because they are sensitive to human ostensive cues?

    Directory of Open Access Journals (Sweden)

    Sarah Marshall-Pescini

    Full Text Available Dogs appear to be sensitive to human ostensive communicative cues in a variety of situations, however there is still a measure of controversy as to the way in which these cues influence human-dog interactions. There is evidence for instance that dogs can be led into making evaluation errors in a quantity discrimination task, for example losing their preference for a larger food quantity if a human shows a preference for a smaller one, yet there is, so far, no explanation for this phenomenon. Using a modified version of this task, in the current study we investigated whether non-social, social or communicative cues (alone or in combination cause dogs to go against their preference for the larger food quantity. Results show that dogs' evaluation errors are indeed caused by a social bias, but, somewhat contrary to previous studies, they highlight the potent effect of stimulus enhancement (handling the target in influencing the dogs' response. A mild influence on the dog's behaviour was found only when different ostensive cues (and no handling of the target were used in combination, suggesting their cumulative effect. The discussion addresses possible motives for discrepancies with previous studies suggesting that both the intentionality and the directionality of the action may be important in causing dogs' social biases.

  7. Influence of Owners' Attachment Style and Personality on Their Dogs' (Canis familiaris) Separation-Related Disorder

    OpenAIRE

    Konok Veronika; Kosztolányi András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi Ádám

    2015-01-01

    Previous research has suggested that owners’ attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners’ attachment style, personality traits and the personality of the dog influence the occurrence ...

  8. Influence of owners' attachment style and personality on their dogs' (Canis familiaris) separation-related disorder.

    Science.gov (United States)

    Konok, Veronika; Kosztolányi, András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi, Ádám

    2015-01-01

    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian) dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD), Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss. PMID:25706147

  9. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae from Panama

    Directory of Open Access Journals (Sweden)

    Roberto Miranda C

    2011-04-01

    Full Text Available Objetive. To determine the distribution of ectoparasites in dogs in Panama. Materials and methods. There were surveyed 720 canines belonging to 57 communities. Results. The results showed that 84% of the dogs were infested with at least one species of ectoparasite. Dogs from lowlands showed a higher percentage of parasitism and a greater biodiversity of parasites than dogs from highlands. There were found seven species of ticks, four species of fleas, two species of lice, and one specie of botfly. The ticks Rhipicephalus sanguineus, Amblyomma cajennense, A. ovale and the flea Ctenocephalides felis were widespread; however Ixodes boliviensis and Pulex simulans showed a much narrower geographic distribution and they were found only in dogs from highlands. The flea species Rhopalopsyllus cacicus and the tick Haemaphysalis juxtakochi were found for the first time in panamanian dogs. Conclusions. The environmental situation in Panama, can encourage that wildlife ectoparasites parasitized dogs in absence of their native hosts. This condition may increase transmission risk of some diseases where the ticks and fleas are vectors.

  10. Oxytocin Receptor Gene Polymorphisms Are Associated with Human Directed Social Behavior in Dogs (Canis familiaris)

    OpenAIRE

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Ádám; Rónai, Zsolt; Kubinyi, Enikő

    2014-01-01

    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associ...

  11. Helminths parasites of stray dogs (Canis lupus familiaris) from Cuiabá, Midwestern of Brazil

    OpenAIRE

    Dirceu Guilherme de Souza Ramos; Bruna Karina Alexandria Zocco; Mariana de Medeiros Torres; Ísis Assis Braga; Richard de Campos Pacheco; Afonso Lodovico Sinkoc

    2015-01-01

    Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest...

  12. Helminths parasites of stray dogs (Canis lupus familiaris from Cuiabá, Midwestern of Brazil

    Directory of Open Access Journals (Sweden)

    Dirceu Guilherme de Souza Ramos

    2015-04-01

    Full Text Available Helminths cause respiratory and gastrointestinal infections in animals, especially in neonates and young animals. Some species of helminth parasites of domestic animals have zoonotic potential, becoming a public health problem, especially when combined with lack of information about the population of these zoonosis and lack of control over of their hosts. This study aimed to identify and quantify the species of helminths from dogs that are not domiciled in the region of Cuiabá, in the Midwest region of Brazil. A total of 100 animals, from the Center for Zoonosis Control of Cuiabá were euthanized and necropsied for helminth searching. Overall 8,217 helminths were found in 85 animals identified in six species: Ancylostoma caninum, Ancylostoma. braziliense, Trichuris vulpis, Toxocara canis, Dirofilaria immitis and Dipylidium caninum. It was evidenced the wide distribution of helminths pathogenic to domestic dogs and especially with zoonotic potential as A. caninum, T. canis, D. caninum and D. immitis. The presence of D. immitis is an important finding, since it is a potentially zoonotic agent, however, this finding is considered sporadic.

  13. Arterial anatomosurgical segments of the mammary glands in dogs (Canis familiaris, Linnaeus, 1758)

    International Nuclear Information System (INIS)

    Thirty mammary complexes (sixty antimers) from cross bred multiparous bitches, were injected with latex and then studied by means of radiology and dissection. The different anatomo-surgical arterial segments thus obtained were identified and designated according to the anatomical zone of irrigation of each mammary gland as follows: 1. Thoracic segment, by means of the fourth and fifth perforant arteries, penetrates the first mammary gland in 85% of the cases; 2. Thoracoabdominal segment, by means of the sixth and seventh perforant arteries, penetrates the second mammary gland in 48.33 % of the cases. This segment can also be divided as follows: 2.1. Retrograde branches of the cranial superficial epigastric artery that penetrates the second mammary gland in about 51.66% of the cases, as the toracoabdominal cranial segment; 2.2. Terminal branches of the last artery penetrate the third mammary gland in 73.32% of the cases, as the toracoabdominal caudal segment. 3. Inguinoabdominal segment may also possess two sub-- segments: 3.1. Caudal superficial epigastric artery with primary branches penetrating the fourth mamma and the ventral labial branches, penetrating the fifth mamma in 96.66% of the cases, as inguinoabdomninal caudal segment. 3.2. Terminal branches of the caudal superficial epigastric artery penetrates the third mamma in 51.66% of the cases as inguinoabdominal cranial segment. The anastomosis observed in 78.33% of the cases may not have significance in mastectomy

  14. Verhaltensphysiologische Experimente zur Erkennung und Unterscheidung menschlicher Gesichter beim Haushund (Canis familiaris)

    OpenAIRE

    Gutmann, Isabel

    2011-01-01

    In der vorliegenden Arbeit wurde die Fähigkeit von Hunden zur Erkennung und Unterscheidung menschlicher Gesichter untersucht. Zu diesem Zweck wurden verschiedene Verhaltensexperimente mit fünf Hunden durchgeführt. Zunächst wurden die Hunde darauf dressiert, ein einlaminiertes DIN A4 Blatt mit einem Gesicht im Zentrum in der dafür vorgesehenen Apparatur mit der Schnauze zu berühren. Bei der Dressur wurden immer zwei Folien präsentiert, wobei nur eine Wahl, nämlich die des Dressurgesichts, durc...

  15. Clinical, anatomic, and immunopathologic characterization of Babesia gibsoni infection in the domestic dog (Canis familiaris).

    Science.gov (United States)

    Wozniak, E J; Barr, B C; Thomford, J W; Yamane, I; McDonough, S P; Moore, P F; Naydan, D; Robinson, T W; Conrad, P A

    1997-08-01

    The pathology associated with acute, chronic, and recrudescent Babesia gibsoni infections was characterized in a group of 6 naturally or experimentally infected, spleen-intact and splenectomized dogs. All experimentally infected dogs became acutely parasitemic, lethargic, anemic, thrombocytopenic, and hemoglobinuric. Anatomic lesions associated, with the disease included diffuse nonsuppurative periportal and centrilobular hepatitis, multifocal necrotizing arteritis, membranoproliferative glomerulonephritis, reactive lymphadenopathy, diffuse erythrophagocytosis, and extramedullary hematopoiesis. The density of CD3+ lymphocytes within the liver sinusoids was markedly increased. Aggregates of large mononuclear cells with immunohistochemical features of activated macrophages were demonstrated in the central veins of the liver. Kupffer cells throughout the hepatic sinusoids appeared hypertrophic and prominent. The density of sinusoidal T lymphocytes, macrophages in central veins, and the degree of Kupffer cell hypertrophy were greatest in the splenectomized dogs. Multifocal deposits of IgM antibody were immunohistochemically demonstrated within the walls of inflamed arteries and renal glomeruli. The results of this study suggest that intense immunostimulation resulting in activation and expansion of T and B lymphocyte populations, macrophage recruitment and activation, vasculitis, glomerulonephritis and anemia contribute to the pathology associated with B. gibsoni infections. PMID:9267413

  16. Performance of Pugs, German Shepherds, and Greyhounds (Canis lupus familiaris) on an odor-discrimination task.

    Science.gov (United States)

    Hall, Nathaniel J; Glenn, Kelsey; Smith, David W; Wynne, Clive D L

    2015-08-01

    Public opinion and the scientific literature alike reflect a widespread assumption that there are differences in behavior between dog breeds. Direct empirical behavioral assessments of such differences, however, are rare and have produced mixed results. One area where breed differences are often assumed is olfaction, where German Shepherds, hounds, and Labradors are commonly used for odor-detection work, whereas toy breeds and brachycephalic dogs, such as Pugs, are not. Choice of breed for scent detection work, however, may be driven more by historical choices than data. In this article we directly assessed the ability of German Shepherds, Pugs, and Greyhounds to acquire a simple olfactory discrimination, and their ability to maintain performance when the target odorant was diluted. Our results show that contrary to expectations, Pugs significantly outperformed the German Shepherds in acquiring the odor discrimination and maintaining performance when the odorant concentration was decreased. Nine of 10 Greyhounds did not complete acquisition training because they failed a motivation criterion. These results indicate that Pugs outperformed German Shepherds in the dimensions of olfaction assessed. Greyhounds showed a general failure to participate. Overall, our results highlight the importance of direct behavioral measurement of assumed behavioral breed differences. PMID:26010195

  17. Canis familiaris, un nuevo hospedero de ornithodoros (a.) puertoricensis fox, 1947 (acari: ixodida) en colombia

    OpenAIRE

    BEJARANO EDUAR E. E.; PATERNINA-GÓMEZ MARGARET; DÍAZ-OLMOS YIRYS; PATERNINA LUIS E.

    2009-01-01

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de g...

  18. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave: garrapatas, perros, Ornithodoros puertoricensis, Ixodida, Colombia.


    ABSTRACT

    Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

    Key words: Ticks, dogs, Ornithodoros puertoricensis, Ixodida, Colombia

  19. Pharmacokinetics of Ceftiofur Crystalline-Free Acid in Clinically Healthy Dogs (Canis lupus familiaris).

    Science.gov (United States)

    Hooper, Sarah E; Korte, Scott W; Giguère, Steeve; Fales, William H; Davis, Jennifer L; Dixon, Lonny W

    2016-01-01

    Economical, injectable antibiotics are beneficial when clinical manifestations of an animal model prevent the use of oral antibiotics. Ceftiofur crystalline-free acid (CCFA) is an injectable, sustained-release form of ceftiofur, a third-generation cephalosporin that is labeled for use in swine, cattle, and horses. Because CCFA is an economical, injectable antibiotic that could be of value for use in research dogs, the objective of this study was to determine the pharmacokinetic properties of CCFA in apparently healthy dogs and to determine the minimal inhibitory concentrations of ceftiofur for veterinary pathogens cultured during 2011 through 2014 from the respiratory system, integumentary system, and urinary system of dogs. The study population comprised of 5 dogs (age, 1 y; weight, 24.7 to 26.9 kg) that were deemed healthy after no abnormalities were found on physical exam, CBC analysis, and clinical chemistry panel. Each dog received CCFA at 5.0 mg/kg SC, and blood samples were collected before administration of CCFA and at 1, 4, 8, 12, 24, 36, 48, 72, 96, 120, 144, 168, 192, 216, and 240 h after injection. The maximal plasma concentration (mean ± 1 SD) of CCFA was 1.98 ± 0.40 μ g/mL, time to reach maximal concentration was 22.3 ± 8.9 h, half-life was 56.6 ± 16.9 h, and AUC0-last was 124.98 ± 18.45 μ g-h/mL. The minimal inhibitory concentrations of ceftiofur ranged from ≤ 0.25 to ≥ 8.0 μ g/mL; ceftiofur was most effective against Pasteurella spp., Proteus spp., and Escherichia coli haemolytica and least effective against Bordatella bronchiseptica, Enterococcus spp., and Pseudomonas aeruginosa. PMID:27025816

  20. RASGOS DEL TEMPERAMENTO DE LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2009-08-01

    Full Text Available

    Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato fisiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos fisiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  1. Comparative functional anatomy of the epaxial musculature of dogs (Canis familiaris) bred for sprinting vs. fighting.

    Science.gov (United States)

    Webster, Emma L; Hudson, Penny E; Channon, Sarah B

    2014-09-01

    The axial musculoskeletal system of quadrupedal mammals is not currently well understood despite its functional importance in terms of facilitating postural stability and locomotion. Here we examined the detailed architecture of the muscles of the vertebral column of two breeds of dog, the Staffordshire bull terrier (SBT) and the racing greyhound, which have been selectively bred for physical combat and high speed sprint performance, respectively. Dissections of the epaxial musculature of nine racing greyhounds and six SBTs were carried out; muscle mass, length, and fascicle lengths were measured and used to calculate muscle physiological cross-sectional area (PCSA), and to estimate maximum muscle potential for force, work and power production. The longissimus dorsi muscle was found to have a high propensity for force production in both breeds of dog; however, when considered in combination with the iliocostalis lumborum muscle it showed enhanced potential for production of power and facilitating spinal extension during galloping gaits. This was particularly the case in the greyhound, where the m. longissimus dorsi and the m. iliocostalis lumborum were estimated to have the potential to augment hindlimb muscle power by ca. 12%. Breed differences were found within various other muscles of the axial musculoskeletal system, particularly in the cranial cervical muscles and also the deep muscles of the thorax which insert on the ribs. These may also highlight key functional adaptations between the two breeds of dog, which have been selectively bred for particular purposes. Additionally, in both breeds of dog, we illustrate specialisation of muscle function by spinal region, with differences in both mass and PCSA found between muscles at varying levels of the axial musculoskeletal system, and between muscle functional groups. PMID:24917310

  2. Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

    Directory of Open Access Journals (Sweden)

    Jennifer B Nagashima

    Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.

  3. Auditory contagious yawning in domestic dogs (Canis familiaris): first evidence for social modulation.

    Science.gov (United States)

    Silva, Karine; Bessa, Joana; de Sousa, Liliana

    2012-07-01

    Dogs' capacity to 'catch' human yawns has recently attracted the attention of researchers in the field of animal cognition. Following recent studies suggesting that contagion yawning in humans, and some other primates, is empathy-related, some authors have considered the possibility that the same mechanism may underlie contagious yawning in dogs. To date, however, no positive evidence has been found, and more parsimonious hypotheses have been put forward. The present study explored the 'contagion-only' hypothesis by testing whether the mere sound of a human yawn can be sufficient to elicit yawning in dogs, in a way that is unaffected by social-emotional factors. Unexpectedly, results showed an interesting interplay between contagion and social effects. Not only were dogs found to catch human yawns, but they were also found to yawn more at familiar than unfamiliar yawns. Although not allowing for conclusive inferences about the mechanisms underlying contagious yawning in dogs, this study provides first data that renders plausible empathy-based, emotionally connected, contagious yawning in these animals. PMID:22526686

  4. Empathic-like responding by domestic dogs (Canis familiaris) to distress in humans: an exploratory study.

    Science.gov (United States)

    Custance, Deborah; Mayer, Jennifer

    2012-09-01

    Empathy covers a range of phenomena from cognitive empathy involving metarepresentation to emotional contagion stemming from automatically triggered reflexes. An experimental protocol first used with human infants was adapted to investigate empathy in domestic dogs. Dogs oriented toward their owner or a stranger more often when the person was pretending to cry than when they were talking or humming. Observers, unaware of experimental hypotheses and the condition under which dogs were responding, more often categorized dogs' approaches as submissive as opposed to alert, playful or calm during the crying condition. When the stranger pretended to cry, rather than approaching their usual source of comfort, their owner, dogs sniffed, nuzzled and licked the stranger instead. The dogs' pattern of response was behaviorally consistent with an expression of empathic concern, but is most parsimoniously interpreted as emotional contagion coupled with a previous learning history in which they have been rewarded for approaching distressed human companions. PMID:22644113

  5. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L

    International Nuclear Information System (INIS)

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs

  6. A New Tapeworm Dipilidium Singhi N.sp. (EUCESTODA : DIPYLIDIDAE) From Canis Familiaris

    OpenAIRE

    D. P. Patil

    2012-01-01

    The present communication deals with description of a new species of the genus, Dipylidium Leuckart (1863) with its type species, Dipylidium crassum Millzner (1926), Dipylidium longutum Millzner (1926) Dipylidium gracile Millzner (1926), Dipylidium wakleri Sandhi (1923), in having the number of testes, but differs from them, in many characters.

  7. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris).

    Science.gov (United States)

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő

    2014-01-01

    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system. PMID:24454713

  8. Influence of owners' attachment style and personality on their dogs' (Canis familiaris separation-related disorder.

    Directory of Open Access Journals (Sweden)

    Veronika Konok

    Full Text Available Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD, Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  9. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available dog Canis lupus familiaris Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Canis_lupus..._familiaris_L.png Canis_lupus_familiaris_NL.png Canis_lupus_familiaris_S.png Canis_lupus_familiari...s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp.../taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/tax...onomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...

  10. ESTUDIO PRELIMINAR DE LOS HALLAZGOS DE CANIS FAMILIARIS EN LA PIRÁMIDE CON RAMPA N°7, SANTUARIO DE PACHACAMAC, PERÚ/Preliminary study of Canis familiaris remains in the Pyramid with Ramp N°7, Pachacamac Sanctuary, Perú.

    OpenAIRE

    Denise Pozzi-Escot; Isabel Cornejo Rivera; Enrique Angulo Costaneira; Katiusha Bernuy Quiroga

    2012-01-01

    El Santuario arqueológico de Pachacamac tuvo una ocupación de alrededor de mil años, desde los primeros siglos de la era cristiana hasta la llegada de los conquistadores españoles al sitio. Durante el Horizonte Tardío (1470-1533 d.C.), bajo el dominio Inca fue el más importante conjunto ceremonial de la costa central peruana, al cual acudían peregrinos de diversos y lejanos lugares. Recientemente, en el acceso a la Pirámide con Rampa N°7 (PCR 07), conectado a la principal vía de ingreso al sa...

  11. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

  12. PARASITISMO POR ANCILOSTOMATÍDEOS EM CÃES (Canis familiaris) DOMICILIADOS EM CAMPOS DOS GOYTACAZES, RJ. PARASITISM BY ANCYLOSTOMIDES IN DOGS (Canis familiaris) DOMICILIATED IN CAMPOS DOS GOYTACAZES, RJ.

    OpenAIRE

    Francimar Fernandes Gomes; Antonio Peixoto Albernaz; Farlen Jose Bebber Miranda; Luize Néli Nunes Garcia

    2008-01-01

    Os ancilostomatídeos são nematóides hematófagos parasitas do intestino delgado, podendo causar retardo no crescimento, inapetência, anorexia, apatia, anemia e até a morte. No homem, algumas espécies como Ancylostoma caninum, A. braziliense e A. tubaeforme podem causar larva migrans cutânea, quando as larvas infectantes de terceiro estágio penetram ativamente a pele íntegra. O objetivo deste trabalho foi detectar o parasitismo por ancilostomatídeos em fezes de cães domiciliados e assintomático...

  13. Isolamento de bactérias aeróbias e sua sensibilidade a antimicrobianos em processos de osteomielite canina

    OpenAIRE

    Simionato A.C.; Ramos M.C.C.; Coutinho S.D.A.

    2003-01-01

    O objetivo deste trabalho foi estudar a presença de bactérias aeróbias em 20 cães com osteomielite, decorrente de exposição óssea. Na identificação das bactérias utilizou-se o sistema API-Bio Mérieux e testou-se a sensibilidade dos microrganismos in vitro, pelo método de difusão em ágar, frente a 14 diferentes antibacterianos. O osso mais acometido pela infecção foi a tíbia (35%). Isolaram-se 68,3% de bactérias Gram positivas e 31,7% de Gram negativas. Staphylococcus spp, Streptococcus spp e ...

  14. Biomarcadores metabólicos y de inflamación en la obesidad canina y felina en enfermedades asociadas

    OpenAIRE

    Tvarijonaviciute, Asta

    2012-01-01

    En esta Tesis los principales 5 avances que se aportan sobre obesidad en perros y gatos son: 1) Los ensayos comercialmente disponibles para la adiponectina y la IGF-1 funcionan para estas especies. 2) La adiponectina y IGF-1 no están influenciadas por los ciclos de alimentación/ayuno o por corticoides. La adiponectina no se afecta por orquidectomia, mientras que la IGF-1 baja. La inflamación disminuye la adiponectina y la IGF-1. 3) La adiponectina baja en la obesidad, aunque no se aprecia un ...

  15. Evaluación del espesor parietal relativo en la especie canina Evaluation of relative wall thickness in dogs

    Directory of Open Access Journals (Sweden)

    C. Lightowler

    2005-12-01

    Full Text Available Tanto los fenómenos patológicos como el ejercicio y entrenamiento promueven en el corazón fenómenos de adaptación, que varían según el mecanismo que los promueve. Uno de los mecanismos que se encuentra siempre en la adaptación cardiaca es la hipertrofia del miocardio. El grado de hipertrofia puede evaluarse midiendo la masa miocárdica ventricular izquierda. Sin embargo este parámetro evalúa la cantidad de hipertrofia, pero no la manera en que ésta se distribuye. Dicha distribución puede calcularse por medio del índice ecocardiográfico conocido como espesor parietal relativo (EPR. En este trabajo, los autores presentan la técnica ecocardiográfica para la evaluación del EPR en el perro y su valor normal promedio. Los resultados obtenidos fueron los siguientes: Media: 0,482; Desviación estándar: 0,098; Coeficiente de variación: 18,37%; Valor mínimo: 0,355; Primer cuartil: 0,407; Mediana: 0,459; Tercer cuartil: 0,528; Valor máximo: 0,728. Asimismo, se verificó la inexistencia de regresión lineal entre el EPR y el peso corporal.As much as the pathological phenomena the exercise and training promote in the heart adaptation phenomena, which vary according to the mechanism that promotes them. One of the mechanisms that is always present in cardiac adaptation is hypertrophy of myocardium. The degree of hypertrophy can be evaluated measuring the left ventricular myocardial mass. Nevertheless this parameter measures the amount of hypertrophy, but not how it is distributed; this can be evaluated by means of relative wall thickness (RWT index. In the present study the authors describe the echocardiography technique for the evaluation of the RWT in the dog and present its normal mean value. The results obtained were the following: Mean: 0,482; Standard deviation: 0,098; Coefficient of variation: 18,37%; Minimum value: 0,355; First quartile: 0,407; Median: 0,459; Third quartile: 0,528; Maximum value: 0,728. Also was verified the nonexistence of linear regression between the RWT and the body weight.

  16. Microbiological and histopathological aspects of canine pyometra Aspectos microbiológicos e histopatológicos da piometria canina

    OpenAIRE

    Jennifer Anne Coggan; Priscilla Anne Melville; Clair Motos de Oliveira; Marcelo Faustino; Andréa Micke Moreno; Nilson Roberti Benites

    2008-01-01

    As pyometra is recognized as one of the main causes of disease and death in the bitch the purposes of this study were to evaluate microbiological and histopathological aspects of canine pyometra and to research the virulence factors of the E. coli isolates identifying possible risks to human health. The microbiological isolation from the intrauterine contents of 100 dogs with pyometra was carried out and the virulence factors in the E. coli strains were identified using PCR method. This study...

  17. Juvenile cellulitis in a puppy – case reports
    Celulite juvenil canina – relato de casos

    OpenAIRE

    Carlos Eduardo Fonseca-Alves; Aline Gonçalves Correa; Hérika Xavier da Costa; Fabiana Elias; Helvécio Leal Santos Junior; Sabrina dos Santos Costa; Sabryna Gouveia Calazans

    2012-01-01

    Juvenile cellulitis or juvenile sterile granulomatous lymphadenitis is a rare disorder that affects puppies between three weeks to six months years old. Clinical signs include alopecia, edema, papules, pustules and crusts especially on eyelids. Definitive diagnosis requires cytological and histological evaluation and early and aggressive therapy is recommended, once scars after recovery can be severe .The choice treatment is the high dose of corticosteroids use such as prednisone. Three anima...

  18. Astrocytic reaction in the canine granulomatous meningoencephalomyelitis Reação astrocítica na meningoencefalomielite granulomatosa canina

    OpenAIRE

    L.S. Jardim; J.P. Andrade-Neto; A.C. Alessi

    2001-01-01

    A meningoencefalomielite granulomatosa (MEG) ocorre em cães de todas as raças, em qualquer idade e já foi descrita em vários países. Sua etiologia não é definida, mas sugere-se que uma reação de hipersensibilidade retardada esteja envolvida. Nas lesões há ocorrência de profuso infiltrado de células B e T, além de macrófagos. No presente estudo verificou-se, com técnicas de imunoistoquímica, a distribuição e a morfologia de astrócitos imunorreativos à proteína glial fibrilar ácida no encéfalo ...

  19. DIFERENCIAS INDIVIDUALES EN LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: REVISIÓN DE LAS EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    Adriana Jakovcevic

    2009-01-01

    Full Text Available El estudio de las diferencias individuales en el comportamiento de los perros domésticos tiene un gran valor aplicado dado que permite una mejor selección de los mismos para cumplir las variadas funciones que tienen en la sociedad humanacomo perros guía, policía, compañía, rescatistas de personas, etc. En el trabajo que se informa se presenta una revisión de estudios sobre diferencias individuales en perros, basada únicamente en las baterías conductuales que evalúan un conjunto de rasgos del temperamento. Con este objetivo se realiza una breve descripción de cada batería de pruebas utilizadas en la literatura, analizando las definiciones operacionales de las variables eva luadas y los diferentes tipos de estímulos utilizados. Los rasgos mayormente evaluados son: temerosidad, agresividad, disposición al entrenamiento y sociabilidad. La te merosidad, en general es evaluada a través de la respuesta del animal ante la aparición de un estímulo súbito que puede ser intenso o no, como por ejemplo la reacción frente a un ruido fuerte, la apertura de un paraguas, o la aparición repentina de una figura humana. La agresividad se mide a través de la reacción frentea la amenaza o provocación por parte de un humano, la sustracción de un objeto o la confrontación con un perro dominante. La disposición al entrenamiento es estudiada a través de la respuesta del animal frente a diferentes estímulos como el juego con un trapo o una cuerda, el ejercicio de devolución de un objeto o la obediencia frente a distintos comandos. Por último, la sociabilidad se evalúa con la aparición o el acercamiento de un humano desconocido o con la exposición a un perro no familiar. Se discuten además las limitaciones metodológicas de las baterías así como también los importantes usos aplicados de las mismas.

  20. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  1. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers.

    Science.gov (United States)

    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore

    2015-12-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal-domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  2. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers

    OpenAIRE

    Galov, Ana; Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco; Randi, Ettore

    2015-01-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed o...

  3. Two new species of Sarcocystis, Sarcocystis caninum and Sarcocystis svanai (Apicomplexa: Sarcocystidae) from the domestic dog (Canis familiaris)

    Science.gov (United States)

    Sarcocystis species have a 2-host life cycle with carnivores as definitive hosts and herbivores as intermediate hosts. Occasionally dogs are definitive as well as intermediate hosts for Sarcocystis species. There are several reports of Sarcocystis sarcocysts in muscles of dogs but these species have...

  4. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris.

    Science.gov (United States)

    de Oliveira Filho, Jaires Gomes; Sarria, André Lucio Franceschini; Ferreira, Lorena Lopes; Caulfield, John C; Powers, Stephen J; Pickett, John A; de León, Adalberto A Pérez; Birkett, Michael A; Borges, Lígia Miranda Ferreira

    2016-06-01

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed, the beagle, is mediated by volatile organic compounds (VOCs) 2-hexanone and benzaldehyde present in beagle odour. Ectoparasite location of animal hosts is affected by variation in these odour components and their ratios. The aim of this study was to quantify the release rate, and the ratio, of 2-hexanone and benzaldehyde from beagles. The odour of three beagles was collected, for four days, over one week (day 0, day 1, day 4 and day 7). The compounds were identified using coupled high-resolution gas chromatography-mass spectrometry (GC-MS), and authentic standards of compounds were used to generate external calibration curves for quantification. Both compounds were found in all dogs on all days. The amount of benzaldehyde was always higher than that of 2-hexanone and so their ratio varied from unity, on average (over time) being 3.128±0.365, 1.902±0.390, 1.670±0.671ngmL(-1) for beagle 1, 2 and 3, respectively. There was no significant (p<0.05, F-test) effect of time. The overall mean was 2.233±0.387ngmL(-1). These results further previous findings by documenting the presence of 2-hexanone and benzaldehyde in beagle odour samples covering a 7-day period. This knowledge enables development of repellents to protect dogs from R. sanguineus s. l. infestation. PMID:27085013

  5. Quantification of brown dog tick repellent, 2-hexanone and benzaldehyde, release from tick-resistant Beagle dogs, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  6. First evidence of hybridization between golden jackal (Canis aureus) and domestic dog (Canis familiaris) as revealed by genetic markers

    Science.gov (United States)

    Fabbri, Elena; Caniglia, Romolo; Arbanasić, Haidi; Lapalombella, Silvana; Florijančić, Tihomir; Bošković, Ivica; Galaverni, Marco

    2015-01-01

    Interspecific hybridization is relatively frequent in nature and numerous cases of hybridization between wild canids and domestic dogs have been recorded. However, hybrids between golden jackals (Canis aureus) and other canids have not been described before. In this study, we combined the use of biparental (15 autosomal microsatellites and three major histocompatibility complex (MHC) loci) and uniparental (mtDNA control region and a Y-linked Zfy intron) genetic markers to assess the admixed origin of three wild-living canids showing anomalous phenotypic traits. Results indicated that these canids were hybrids between golden jackals and domestic dogs. One of them was a backcross to jackal and another one was a backcross to dog, confirming that golden jackal–domestic dog hybrids are fertile. The uniparental markers showed that the direction of hybridization, namely females of the wild species hybridizing with male domestic dogs, was common to most cases of canid hybridization. A melanistic 3bp-deletion at the K locus (β-defensin CDB103 gene), that was absent in reference golden jackal samples, but was found in a backcross to jackal with anomalous black coat, suggested its introgression from dogs via hybridization. Moreover, we demonstrated that MHC sequences, although rarely used as markers of hybridization, can be also suitable for the identification of hybrids, as long as haplotypes are exclusive for the parental species. PMID:27019731

  7. [Formation of genetic polymorphism in connection with phylogenesis and microevolution of the domestic dog Canis familiaris L].

    Science.gov (United States)

    Kniazev, S P; Tikhonov, V N; Tanabe, Y; Morozov, P S

    1998-11-01

    The analysis of genetic relationships between numerous breeds and populations of domestic dogs of Asian and European origin was performed by studying their polymorphism for 14 loci of biochemical markers. Phylogenetic positions of different breed groups, related to one another and to ancestral forms from the center of domestication, were elucidated. Directions of gene flow in the formation of breed as well as dynamics and vectors of the forming genetic structure in microevolution of this extremely polytypic species, were established. PMID:10096028

  8. Servizi educativi per l’infanzia e contesti familiari. Verso l’alleanza, attraversando la problematicità.

    Directory of Open Access Journals (Sweden)

    Mariagrazia Contini

    2007-07-01

    Full Text Available Il contributo, frutto del lavoro di ricerca del Dipartimento di Scienze dell’educazione, esamina gli aspetti di problematicità emergenti dalle rappresentazioni delle educatrici dei servizi per l'infanzia in relazione ai loro rapporti con le famiglie. I pensieri e le emozioni dei genitori, le loro richieste, i loro giudizi e pregiudizi costituiscono, per le educatrici, nuovi elementi di complessità (e talora di difficoltà nella costruzione dell'alleanza tra servizi e contesto familiare.

  9. Servizi educativi per l’infanzia e contesti familiari. Verso l’alleanza, attraversando la problematicità.

    OpenAIRE

    Mariagrazia Contini

    2007-01-01

    Il contributo, frutto del lavoro di ricerca del Dipartimento di Scienze dell’educazione, esamina gli aspetti di problematicità emergenti dalle rappresentazioni delle educatrici dei servizi per l'infanzia in relazione ai loro rapporti con le famiglie. I pensieri e le emozioni dei genitori, le loro richieste, i loro giudizi e pregiudizi costituiscono, per le educatrici, nuovi elementi di complessità (e talora di difficoltà) nella costruzione dell'alleanza tra servizi e contesto familiare.

  10. Assessing inbreeding and loss of genetic variation in canids, domestic dog (Canis familiaris) and wolf (Canis lupus), using pedigree data

    OpenAIRE

    Jansson, Mija

    2014-01-01

    Genetic variation is necessary to maintain the ability of wild and domestic populations to genetically adapt to changed selective pressures. When relationships among individuals are known, conservation genetic management can be based on statistical pedigree analysis. Such approaches have traditionally focused on wild animal conservation breeding in captivity. In this thesis, I apply pedigree-based techniques to domestic and wild animal populations, focusing on two canids – the domestic dog an...

  11. The response of guide dogs and pet dogs (Canis familiaris) to cues of human referential communication (pointing and gaze).

    Science.gov (United States)

    Ittyerah, Miriam; Gaunet, Florence

    2009-03-01

    The study raises the question of whether guide dogs and pet dogs are expected to differ in response to cues of referential communication given by their owners; especially since guide dogs grow up among sighted humans, and while living with their blind owners, they still have interactions with several sighted people. Guide dogs and pet dogs were required to respond to point, point and gaze, gaze and control cues of referential communication given by their owners. Results indicate that the two groups of dogs do not differ from each other, revealing that the visual status of the owner is not a factor in the use of cues of referential communication. Both groups of dogs have higher frequencies of performance and faster latencies for the point and the point and gaze cues as compared to gaze cue only. However, responses to control cues are below chance performance for the guide dogs, whereas the pet dogs perform at chance. The below chance performance of the guide dogs may be explained by a tendency among them to go and stand by the owner. The study indicates that both groups of dogs respond similarly in normal daily dyadic interaction with their owners and the lower comprehension of the human gaze may be a less salient cue among dogs in comparison to the pointing gesture. PMID:18769948

  12. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics.

    Science.gov (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M

    2012-07-15

    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds. PMID:22723482

  13. Distribución y abundancia de Capromys pilorides en manglares de la Península de Guanahacabibes (Cuba

    Directory of Open Access Journals (Sweden)

    Hernández- Martínez, Fernando R

    2008-07-01

    Full Text Available La presente investigación se llevó a cabo con la finalidad de determinar la abundancia y distribución de las poblaciones del endémico Capromys pilorides en la formación de manglar de la Reserva de la Biosfera Península de Guanahacabibes. Se seleccionaron 3 localidades: Carabelita, Palma Sola y Bolondrón, en las cuales se establecieron y muestrearon 10 parcelas de 5.000 m2 durante tres momentos diferentes del periodo lluvioso y poco lluvioso. Los valores de abundancia (jutías/ha variaron entre 3,53 y 10,4en dependencia del grado de naturalidad y el efecto de ntropización, así como de la influencia del perro jíbaro (Cannis familiaris sobre las poblaciones de jutía conga. Se encontró diferencia significativa en el patrón de distribución de la abundancia entre el período poco lluvioso y lluvioso, así como entre localidades en ambos períodos. En el patrón de distribución de la abundancia relativa de Capromys/especie de árbol estuvo asociado aConocarpus erectus y el Callophylum brasiliense.

  14. AVALIAÇÃO BIOQUÍMICA E HEMOGASOMÉTRICA DE BOLSAS DE SANGUE (CPDA-1) CANINAS MANTIDAS SOB REFRIGERAÇÃO

    OpenAIRE

    Cecília Braga Laposy; Rosa Maria Barilli Nogueira

    2011-01-01

    The aim of this study was to evaluate the biochemical and the blood gas following the refrigerated storage of blood bags. Blood samples (420mL) of eight healthy dogs were collected and the bags were kept under refrigeration (-2 to 80C). An aliquot of blood was withdrawn immediately after collection (D0) and on days 7, 14, 21 and 30 for measurement of plasma glucose, sodium, potassium, total plasma protein and measurement of pO2, pCO2, bicarbonate and blood pH by blood gas. There was a signifi...

  15. Characteristics of rose hip (Rosa canina L.) cold-pressed oil and its oxidative stability studied by the differential scanning calorimetry method.

    Science.gov (United States)

    Grajzer, Magdalena; Prescha, Anna; Korzonek, Katarzyna; Wojakowska, Anna; Dziadas, Mariusz; Kulma, Anna; Grajeta, Halina

    2015-12-01

    Two new commercially available high linolenic oils, pressed at low temperature from rose hip seeds, were characterised for their composition, quality and DPPH radical scavenging activity. The oxidative stability of oils was assessed using differential scanning calorimetry (DSC). Phytosterols, tocopherols and carotenoids contents were up to 6485.4; 1124.7; and 107.7 mg/kg, respectively. Phenolic compounds determined for the first time in rose hip oil totalled up to 783.55 μg/kg, with a predominant presence of p-coumaric acid methyl ester. Antiradical activity of the oils reached up to 3.00 mM/kg TEAC. The acid, peroxide and p-anisidine values as well as iron and copper contents indicated good quality of the oils. Relatively high protection against oxidative stress in the oils seemed to be a result of their high antioxidant capacity and the level of unsaturation of fatty acids. PMID:26041218

  16. Inquérito sorológico e molecular da brucelose canina no município de Natal, Estado do Rio Grande do Norte

    Directory of Open Access Journals (Sweden)

    Annielle Regina da Fonseca Fernandes

    2013-09-01

    Full Text Available O objetivo do presente trabalho foi determinar a ocorrência de anticorpos anti-Brucella rugosa e anti-Brucella lisa em cães do município de Natal, Estado do Rio Grande do Norte, Brasil, bem como identificar fatores de risco associados à positividade e realizar a detecção molecular em animais soropositivos. Foram utilizados soros sanguíneos de 416 cães atendidos em clínicas veterinárias durante o período de março a novembro de 2011. Para o diagnóstico sorológico da infecção por Brucella rugosa, foi empregada a prova de imunodifusão em gel de ágar (IDGA, utilizando antígeno de lipopolissacarídeos e proteínas de Brucella ovis, amostra Reo 198 e, para o diagnóstico da infecção por Brucella lisa, foi utilizado o teste do antígeno acidificado tamponado (AAT. De animais soropositivos, foram coletadas amostras de sangue com citrato de sódio para o diagnóstico pela reação em cadeia pela polimerase (PCR. A frequência de anticorpos anti-Brucella rugosa foi de 28,9% (120/416. Todos os animais foram negativos para anticorpos anti-Brucella lisa. Dentre 80 animais soropositivos, o DNA de Brucella spp. foi amplificado em três animais (3,8%. Não foram identificados fatores de risco associados à soropositividade. Conclui-se que a infecção por Brucella rugosa está presente no município de Natal, bem como se sugere o monitoramento sorológico de animais atendidos em clínicas visando à identificação de fontes de infecção.

  17. Métodos de diagnóstico para detecção de prostatopatias caninas Canine prostatic disease: diagnosis methods

    OpenAIRE

    Ceres Mussel; Francislete Rodrigues Melo; Hélio Blume; Fernanda Mulinari

    2010-01-01

    As doenças prostáticas são comuns em cães, desenvolvendo-se após a maturidade sexual. Entre as afecções que acometem a próstata desses animais, a mais frequente é a hiperplasia prostática benigna (HPB). As neoplasias prostáticas, apesar de menos frequentes, são altamente malignas e um diagnóstico tardio está associado a um prognóstico ruim. Os principais métodos de diagnóstico das enfermidades prostáticas em cães incluem um exame clínico detalhado, ultrassonografia, punção aspirativa e biópsi...

  18. Incontinência urinária após gonadectomia em fêmeas caninas Urinary incontinence after gonadectomy in female dogs

    Directory of Open Access Journals (Sweden)

    Fabiana Azevedo Voorwald

    2010-03-01

    Full Text Available A incontinência urinária adquirida é uma condição debilitante e, muitas vezes, incurável que acomete fêmeas castradas e raramente fêmeas inteiras ou machos. A manifestação clínica pode ocorrer em qualquer momento após a gonadectomia e resulta em graves problemas no manejo do paciente. Os mecanismos que desencadeiam a incontinência após ovariectomia envolvem decréscimo na pressão de fechamento uretral, alterações hormonais, aumento na deposição de colágeno na musculatura lisa da bexiga, diminuição na contratilidade do músculo detrusor e redução na resposta aos estímulos elétricos e ao carbachol. O diagnóstico é realizado pelo histórico do animal, pelo exame físico, pelos exames laboratoriais, pelo perfil de pressão uretral, pela ultrassonografia e pelas radiografias abdominais. O tratamento clínico envolve utilização de fármacos -adrenérgicos, estrógenos, análogos de GnRH e agentes antidepressivos. As técnicas cirúrgicas recomendadas correspondem à uretropexia, cistouretropexia, aplicação de colágeno na uretra e colpossuspensão. Melhor compreensão da etiologia, da fisiopatologia, dos métodos de diagnóstico e tratamentos é fundamental em razão do pouco conhecimento e da identificação dessa condição no Brasil.Acquired urinary incontinence is a debilitating, incurable condition, prevalent in spayed bitches and rarely seen in entire bitches or males. In bitches, acquired urinary incontinence can occur anytime from one week after neutering and is associated with severe management problems. Incontinence in neutered bitches can be associated with a decrease in maximal urethral closure pressure, hormonal changes and increase in the percentage of collagen in the bladder wall. It's also associated to a reduced contractility of the detrusor muscle, decrease in the magnitude of response of the bladder wall to both carbachol and eletrical field stimulation, and there are risk factors involved. The diagnosis is established based on historical findings, physical examination, laboratorial exams, urethral pressure profilometry, ultrasonography and abdominal radiographs. The medical management involves the appliance of -adrenergics agonists, oestrogens, GnRH analogues and antidepressive agents. Surgical recommendation management corresponds to urethropexy, cistourethropexy, endoscopic periurethral injection and colposuspension. The better understanding A better comprehension of etiology, physiopathology, diagnosis methods and treatment could provide significant benefits considering the lack of knowledge and diagnoses of this clinical condition in Brazil.

  19. Aspectos epidemiológicos sobre mordeduras caninas durante el año 2011 en la ciudad de Temuco, Chile.

    OpenAIRE

    Waldo Armstrong,; Gloria Ulloa

    2016-01-01

    Los accidentes causados por mordeduras de perros y gatos son un problema de salud pública y concretamente las mordeduras de perro constituyen el riesgo más grave que estos animales suponen para la salud de las personas. A los costes económicos derivados del tratamiento de las lesiones físicas debemos añadir las secuelas psicológicas que muchas veces aparecen tras las agresiones. La prevención es el único camino para resolver este problema y puede efectuarse mejor cuando se conocen los divers...

  20. The effectiveness of a standardized rose hip powder, containing seeds and Shells of Rosa canina, on cell longevity, skin wrinkles, moisture, and elasticity 

    DEFF Research Database (Denmark)

    Phetcharat, L; Wongsuphasawat, K; Winther, Kaj

    2015-01-01

    Objective: To evaluate the effects of a rose hip powder (Hyben Vital®) made from seeds and shells on cell senescence, skin wrinkling, and aging. Methods: A total of 34 healthy subjects, aged 35–65 years, with wrinkles on the face (crow’s-feet) were subjected to a randomized and double-blinded cli...

  1. The effectiveness of a standardized rose hip powder, containing seeds and shells of Rosa canina, on cell longevity, skin wrinkles, moisture, and elasticity

    Science.gov (United States)

    Phetcharat, L; Wongsuphasawat, K; Winther, K

    2015-01-01

    Objective To evaluate the effects of a rose hip powder (Hyben Vital®) made from seeds and shells on cell senescence, skin wrinkling, and aging. Methods A total of 34 healthy subjects, aged 35–65 years, with wrinkles on the face (crow’s-feet) were subjected to a randomized and double-blinded clinical study of the effects of the rose hip powder, as compared to astaxanthin, a well-known remedy against wrinkles. During the 8-week study, half of the participants ingested the standardized rose hip product, while the other half ingested astaxanthin. Objective measurements of facial wrinkles, skin moisture, and elasticity were made by using Visioscan, Corneometer, and Cutometer at the beginning of the study, after 4 weeks, and after 8 weeks. Evaluation of participant satisfaction of both supplements was assessed using questionnaires. In addition, the effect of the rose hip preparation on cell longevity was measured in terms of leakage of hemoglobin through red cell membranes (hemolytic index) in blood samples kept in a blood bank for 5 weeks. Significance of all values was attained with P≤0.05. Results In the double-blinded study, the rose hip group showed statistically significant improvements in crow’s-feet wrinkles (Pastaxanthin, with P-values 0.05, 0.001, and 0.05. Likewise, both groups expressed equal satisfaction with the results obtained in their self-assessment. The rose hip powder further resulted in increased cell longevity of erythrocyte cells during storage for 5 weeks in a blood bank. Conclusion Results suggest that intake of the standardized rose hip powder (Hyben Vital®) improves aging-induced skin conditions. The apparent stabilizing effects of the rose hip product on cell membranes of stored erythrocyte cells observed in this study may contribute to improve the cell longevity and obstructing skin aging. PMID:26604725

  2. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    Directory of Open Access Journals (Sweden)

    Zuñiga-A Ismael

    1999-01-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfológica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P < 0,05; la cantidad de alfa globulinas fue mayor en el grupo infectado (P < 0,05. CONCLUSIONES: Los resultados permiten confirmar el ciclo perro-cerdo y una infección subclínica en los huéspedes definitivos, lo que dificulta su diagnóstico y control en una especie intimamente relacionada con el hombre.

  3. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    Directory of Open Access Journals (Sweden)

    Ismael Zuñiga-A

    1999-06-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfológica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P < 0,05; la cantidad de alfa globulinas fue mayor en el grupo infectado (P < 0,05. CONCLUSIONES: Los resultados permiten confirmar el ciclo perro-cerdo y una infección subclínica en los huéspedes definitivos, lo que dificulta su diagnóstico y control en una especie intimamente relacionada con el hombre.

  4. Enfermedad inflamatoria crónica intestinal canina: hallazgos endoscópicos, bioquímicos y anatomopatológicos del tracto gastrointestinal anterior

    Directory of Open Access Journals (Sweden)

    R Crespo

    2015-01-01

    Full Text Available Se ha realizado un estudio retrospectivo a 26 perros, machos y hembras, que acudieron al Servicio de Medicina Interna (Unidad de Endoscopia del Hospital Clínico Veterinario de la Facultad de Veterinaria de la Universidad de Murcia (España, a los que se les diagnosticó enfermedad inflamatoria crónica intestinal del tracto gastrointestinal anterior. Los casos se eligieron en función del diagnóstico clínico, endoscópico y anatomopatológico realizado, con el objetivo de evaluar potenciales correlaciones entre estos parámetros. La disminución de proteínas totales y la albúmina no fue estadísticamente significativa en relación con el grado de inflamación de la mucosa gastrointestinal, no obstante, los animales que presentaban un infiltrado de tipo linfoplasmocitario tenían tendencia a la pérdida de albúmina. Se encontró una correlación estadísticamente significativa (P < 0,05 entre el tipo de infiltrado y la presencia de congestión en la mucosa de estómago y duodeno. Una mayor congestión a estos niveles se corresponde con el infiltrado linfoplasmocitario. También se obtuvo un resultado que, a pesar de no ser estadísticamente significativo, sí se aproxima a la significación estadística (P < 0,1 entre el grado de congestión y la intensidad del infiltrado, ya que un grado de congestión mayor de la mucosa se corresponde con una mayor intensidad de infiltrado linfoplasmocitario, tanto a nivel gástrico como duodenal. Además se vio que la friabilidad está asociada a inflamación en duodeno, y los animales que no tenían un correcto cierre del cardias presentaban esofagitis por reflujo.

  5. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    OpenAIRE

    Zuñiga-A Ismael; Jaramillo-A Carlos J; Martínez-M José J; Cárdenas-L Jorge

    1999-01-01

    OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un ani...

  6. Analisi ecologica dei flebotomi vettori della leishmaniosi canina in Italia nord-orientale attraverso l'utilizzo di Sistemi Informativi Geografici (GIS) e Modelli di Distribuzione di Specie

    OpenAIRE

    Signorini, Manuela

    2014-01-01

    Since the 1990s, new foci of Canine Leishmaniosis have being detected in northern Italy, previously regarded as non-endemic. The disease has increased gradually in the regions of the Alps and entomological surveys demonstrated the established presence of two vectors of the disease, P. perniciosus and P. neglectus, in several localities of the area. The changing pattern of the disease is mainly due to movement of infected dogs from endemic areas, to the increase in human and animal travels and...

  7. Características epidemiológicas da leishmaniose tegumentar americana em uma região endêmica do Estado da Bahia: II leishmaniose canina

    Directory of Open Access Journals (Sweden)

    Air C. Barretto

    1984-06-01

    Full Text Available Um inquérito em cães realizado na região de Três Braços, Bahia, mostrou que 3,0% de 98 animais tinham amastigotas em lesões de pele. Parasitos não foram encontrados em pele normal da orelha. De uma amostra selecionada de 13 cães, portadores de lesão cutânea ativa, nove (69,2% deles estavam comprovadamente infectados. Sete amostras de lesão produziram infecção em hamsters. O estudo biológico (crescimento em meio de cultura, evolução da lesão em hamster e desenvolvimento no tubo digestivo de Lutzomyia longipalpis identificou o parasito como pertencente ao complexo L. braziliensis. A caracterização bioquímica (mobilidade eletroforética de enzimas em placas de acetato de celulose e o estudo imunotaxonômico (anticorpos monoclonais definiram as amostras como L. braziliensis braziliensis. O papel do cão como um possível reservatório de L. b. braziliensis na região de Três Braços é discutido.

  8. Incontinência urinária após gonadectomia em fêmeas caninas Urinary incontinence after gonadectomy in female dogs

    OpenAIRE

    Fabiana Azevedo Voorwald; Caio de Faria Tiosso; Gilson Hélio Toniollo

    2010-01-01

    A incontinência urinária adquirida é uma condição debilitante e, muitas vezes, incurável que acomete fêmeas castradas e raramente fêmeas inteiras ou machos. A manifestação clínica pode ocorrer em qualquer momento após a gonadectomia e resulta em graves problemas no manejo do paciente. Os mecanismos que desencadeiam a incontinência após ovariectomia envolvem decréscimo na pressão de fechamento uretral, alterações hormonais, aumento na deposição de colágeno na musculatura lisa da bexiga, diminu...

  9. Leishmaniose visceral canina: avaliação da metodologia sorológica utilizada em inquéritos epidemiológicos

    Directory of Open Access Journals (Sweden)

    Carlos A. da Costa

    1991-03-01

    Full Text Available Foi realizado um estudo comparativo da reação de imunofluorescência indireta em eluatos de sangue de cães infectados experimentalmente com diferentes tripanosomatídeos. Utilizaram-se como antigenopromastigotas de L. mexicana, L. braziliensis e L. chagasi. Os resultados mostraram que a sensibilidade do método foi de 87,5% para o diagnóstico do calazar canino, independentemente do antigeno empregado; e que ocorre reação cruzada com Leishmaniose tegumentar em 75% dos casos e com doença de Chagas em 83,3%. Levantamento epidemiológico em área de leishmaniose confirma que a reação de imunofluorescência em eluatos de sangue canino fornece reações cruzadas em cães infectados com Leishmania braziliensis e L. chagasi. Não se verificou reação cruzada pela RFC. Sugere-se a utilização da reação de imunofluorescência nas campanhas de saúde pública, mas é de se chamar a atenção para o fato de que as taxas de positividade não devem ser utilizadas como indicadores da prevalência do calazar canino.A comparative study was made of eluates of the blood of dogs experimentally infected with different trypanosomatids. Using antigens prepared from promastigotes of Leishmania mexicana, L. braziliensis and L. chagasi, assessments were made by the indirect immunofluorescence test. The results showed a sensitivity of 87,5% in the diagnosis of canine visceral leishmaniasis, independent of antigen used. Cross-reactions occurred in 75% of cases of cutaneous leishmaniasis and 83,3% of dogs with chagas' disease. An epidemiological survey in an area of leishmaniasis confirmed that immunofluorescence tests on eluates of dogs' blood give cross-reactions between L. braziliensis and L. chagasi. The results suggest that such testing could be useful in public health campaigns but attention is drawn to thefact that the level ofpositive reactions cannot be used as an indicator of the prevalence of canine kala-azar.

  10. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;

    2014-01-01

    exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw...

  11. The trasmission gap: quali influenze familiari e contestuali nel passaggio tra rappresentazioni dell'adulto e comportamenti di attaccamento del bambino

    OpenAIRE

    DE PALO,

    2010-01-01

    The transition to parenthood is a phase of the family development, in which the individual’s organization, couple’s and intergenerazitional’s relationships need to be renegotiated on representational and interactive level. On this way, it is necessary to adopt a contextual perspective to investigate the family development: partner’s satisfactions of the couple, the construction of relationship in the adult age and the acquisition of parent role. The study has two main aims: a) the degree of m...

  12. La legge 154/2001 in tema di "Misure contro la violenza nelle relazioni familiari": cosa è cambiato nel nostro Paese dopo la sua entrata in vigore?

    Directory of Open Access Journals (Sweden)

    Susanna Vezzadini

    2007-09-01

    Full Text Available Domestic violence is a crime. All international and national studies on this subject have contributed to uncovering part of it, shedding light on a very serious and dramatic reality. For that reason, in April 2001, the Italian Parliament passed the law n. 154 concerning “Measures against domestic violence”, therefore affirming in by this act its will to respond to the problem. The law, which is considered an example of a “normative act against the blackmail of fear”, consists of a series of guide lines to prevent the offender from repeating the crime. In view of this, it is essential to find out today what has actually changed in Italy six years after its coming into force. La violence intrafamiliale est un délit. Les études réalisées à l'échelle internationale, tout comme les études nationales, ont ouvert une brèche sur cette réalité dont la gravité est déconcertante. Cependant le Parlement italien a approuvé en avril 2001, la loi relative aux "Mesures contre la violence dans la famille", affirmant ainsi sa volonté de répondre concrètement au problème de la violence domestique en Italie. Cette loi, présentée par les législateurs comme un example "d'acte normatif contre le chantage de la peur", contient une série de provisions destinées à empêcher à l'offenseur de réitérer son crime, introduisant des instruments procéduraux contre les abus intrafamiliaux. Face à de telles innovations, il est d'autant plus utile de continuer à se demander ce qui a changé en Italie, six ans après l'entrée en viguer de la loi.

  13. Purification and characterization of the major whey proteins from the milks of the bottlenose dolphin (Tursiops truncatus), the Florida manatee (Trichechus manatus latirostris), and the beagle (Canis familiaris).

    Science.gov (United States)

    Pervaiz, S; Brew, K

    1986-05-01

    The major whey proteins of the milks of the dolphin, manatee, and beagle were purified by gel filtration and ion exchange chromatography and characterized and identified by molecular weight determination, amino acid analysis, N-terminal sequencing, and activity measurements. The major whey protein components from all three species were found to be monomeric beta-lactoglobulins. These proteins were all active in binding retinol. Dolphin milk contained two beta-lactoglobulins (designated 1 and 2) which showed a slight difference in molecular weight and considerably divergent N-terminal sequences, whereas the other milks only contained a single form of beta-lactoglobulin. alpha-Lactalbumins were purified from dolphin and dog milks and were active in promoting lactose synthesis by bovine galactosyltransferase. The dolphin protein had an N-terminal sequence more similar to ruminant alpha-lactalbumins than to those known from other species. Although alpha-lactalbumin activity has been detected in manatee milk at low levels, the corresponding protein was not isolated. In addition, dog milk was found to contain high levels of lysozyme (greater than 1.0 mg/ml), which were identified by activity and sequencing. The functional and evolutionary implications of these results are discussed. PMID:3707136

  14. Distribución de los ectoparásitos de Canis lupus familiaris L. (Carnivora: Canidae) de Panamá

    OpenAIRE

    Bermúdez, Sergio; Miranda, Roberto

    2011-01-01

    Objetivo. Determinar la distribución de ectoparásitos de perros en Panamá. Materiales y métodos. Se examinaron 720 individuos en 57 comunidades. Resultados. Los resultados demostraron que el 84% de los perros presentaron al menos una especie de ectoparásito. Los perros de tierras bajas mostraron un mayor porcentaje de parasitismo y mayor biodiversidad de parásitos que los animales de tierras altas. Se encontraron siete especies de garrapatas, cuatro de pulgas, dos de piojo...

  15. A Review of Domestic Dogs' (Canis Familiaris) Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs

    OpenAIRE

    Udell, Monique A.R; Wynne, C. D. L.

    2008-01-01

    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are more human-like than any other species, including nonhuman primates. Behavior analysts should add their expertise to the study of dog behavior, both to...

  16. Di padre in figlia, le eredi del vino a Nordest. La riproduzione sociale delle aziende familiari vinicole in un'€™ottica di genere

    OpenAIRE

    Gusmeroli, Paolo

    2013-01-01

    Family businesses are the prevailing economic organizations in Veneto region, where the research took place. They are especially representative of made in Italy recognized productions as wine. The intergenerational handover is the focus of many studies committed to avoid the "decline of social capital" (Putnam, 1995) of the area, whereas entrepreneurial families (and their ethos, practical knowledge, capital) are considered one of its cornerstones. My study aims to observe this process from a...

  17. Effects of long-term dietary exposure to organohalogen contaminants on vitamin and hormonestatus in the Greenland Sledge dog (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, Maja

    conducted on Greenland sledge dogs. This aimed at exploring how a diet rich in OHCs affects vitamin and hormone status in Arctic top predator mammals. The dogs were supplemented with fat containing high (exposed group: minke whale blubber) or low (control group: porcine fat) amounts of OHCs, polyunsaturated...

  18. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Riget, Frank F.; Jensen, Jens-Erik Beck;

    2008-01-01

    There is a great need for understanding the impact from dietary OHCs (organohalogen compounds) on bone mineral composition - and thereby osteoporosis - in especially arctic wildlife such as polar bears (Ursus maritimus) as well as humans. For that purpose, we measured BMD (bone mineral density) by...... polluted marine species. (C) 2008 Elsevier Ltd. All rights reserved....

  19. Un percorso civile: storia e memoria dell’Associazione fra i familiari delle vittime della strage alla stazione di Bologna, 2 agosto 1980

    Directory of Open Access Journals (Sweden)

    Paolo Bolognesi

    2007-09-01

    Full Text Available On 2nd August 1980, at 10.25 a.m., a bomb exploded at the Central Station of Bologna. It was placed there by a commando of terrorists and it caused the death of 85 people and the wounding of others 200. Many of them are still suffering from the injuries caused by that tragic event and still today they need to follow a treatment.In order to promote the research of truth, in 1981, on 1st June, the “Association among the victims and their families of the attack at the Central Station of Bologna”, was founded and since then the Association goes on fighting to obtain justice. Le 2 août 1980, à dix heures vingt-cinq, une bombe, posée par des terroristes, explosa à la gare centrale de Bologne faisant 85 morts et 200 blessés. A cause de ce massacre, nombreuses furent les personnes handicapées à vie, blessées et traumatisées qui, encore aujourd'hui, doivent être soignées.Pour promouvoir la quête de vérité, le premier juin 1981, l'Association des parents des victimes a été constituée et depuis lors, on n'a cessé de lutter pour obtenir justice.

  20. Occurrence of gastrointestinal parasites in dogs (Canis familiaris with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/ Ocorrência de parasitos gastrintestinais em cães (Canis familiaris com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Pedro Luiz de Camargo

    2007-10-01

    Full Text Available One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1 and from 50 dogs without diarrhea (Group 2 were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3% of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%, Ancylostoma sp. (7.3%, Cystoisospora (7.3%, Entamoeba sp. (6.7%, Toxocara sp.(4%, Pentatrichomanas hominis (3.3%, and Trichurisvulpis (1.3%. From the 50 animals without diarrhea, six (12% were positive by coproparasitologic evaluation: two (4% for Ancylostoma sp., three (6% with Giardia sp., and one (2% for both Ancylostoma sp. and Cystoisospora sp. There was a significant relationship between infection and diarrhea (P=0,005, age and infection (PForam examinadas 150 amostras de fezes colhidas de cães com diarréia aguda (Grupo 1, e outras 50 de animais sem diarréia (Grupo 2, atendidos entre outubro de 2004 e outubro 2005, no Hospital Veterinário Escola da Universidade Estadual de Londrina. Dos 150 animais do G1, 44 (29,3% estavam infectados por helmintos e/ou protozoários, sendo que destes, 32 (72,7% apresentavam infecção simples e 12 (27,3% infecções múltiplas. Os gêneros identificados nestes animais foram: Giardia sp. (9,3%, Cystoisospora sp. (7,3%, Ancylostoma sp. (7,3%, Entamoeba sp. (6,7%, Toxocara sp. (4%, Pentatrichomonas hominis (3,3% e Trichuris vulpis (1,3%. Dos 50 animais sem diarréia, seis (12% eram positivos, dois (4% para Ancylostoma sp., três (6% para Giardia sp. e um (2% para Ancylostoma sp. e Cystoisospora simultaneamente. Houve relação estatisticamente significativa (P=0,005 entre o parasitismo e a ocorrência de diarréia, assim como entre a faixa etária e a proporção de infecções (P<0,001, porém, machos e fêmeas foram igualmente acometidos (P=0,08. O número de cães com raça definida foi significativamente maior do que de cães sem definição racial (P=0,01. Os resultados demonstram a importância de realizaçãoperiódica de exames parasitológicos em cães com e sem diarréia para tratamento específico e adoção medidas de controle e profilaxia.

  1. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in Canis familiaris

    Directory of Open Access Journals (Sweden)

    Expedito Jr Matos Santana

    2009-10-01

    Full Text Available O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC e a altura (H de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR e do índice de pulsatilidade (IP do ramo principal da artéria renal. No estudo foram utilizados 22 cães adultos sem raça definida, sendo 11 machos e 11 fêmeas. Os animais foram previamente aferidos quanto a DAC e a H. Os exames ultra-sonográficos foram realizados com um aparelho HDI 4000 PHILIPS munido de um transdutor microconvexo multifreqüêncial (5-8 MHz, dispositivos Doppler Colorido e Doppler de Fluxo. Os animais foram posicionados em decúbito lateral direito ou esquerdo, de acordo com o rim a ser avaliado. Os diâmetros longitudinal (DL e dorsoventral (DDV dos rins foram mensurados na secção longitudinal e, o diâmetro transversal (DT foi aferido no plano transversal. O volume (V foi calculado automaticamente pelo software do ultra-som. Com o uso do Triplex Doppler, o IR e o IP das artérias renais direita e esquerda foram obtidos. Todos os dados foram apresentados em média ± EPM. Análises de regressão linear foram realizadas tendo o DL, DDV, DT e V como variáveis dependentes e a DAC e H como variáveis independentes. Os IR e IP dos rins direito e esquerdo foram comparados pelo teste t de Student. A DAC variou de 54-78cm para machos e 37-71cm para fêmeas e a altura variou entre 34-64 cm para os machos e 24-57cm para as fêmeas. As médias obtidas para DL, DDV, DT e V dos rins esquerdo e direito foram: 5,24±0,27cm, 3,07±0,15cm, 3,07±0,9cm, 28,01±3,4mL e 4,50±0,19cm, 2,88±0,14cm, 2,71±0,15cm, 21,27±2,6mL, respectivamente. As análises de regressão linear entre as medidas lineares e volume renal com a DAC e a H foram significativas para os interceptos e coeficientes de regressão (PThe aim of this paper was to establish the relation between the kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in adult healthy dogs, to obtain normality parameters for assessment of renal size and volume, as well as establish reference values to evaluate kidney blood perfusion by the resistivity index (RI and pulsatility index (PI of main renal artery. The study was applied at 22 adult dogs, 11 males and 11 females. Previously, the DAC and H of all animals were measured. For ultrasonographic examination, the ultra-sound system HDI 4000 PHILIPS equipped with a multi-frequency microconvex transducer, Color Doppler and Spectral Doppler devices was used. The animals were placed into right or left lateral decubitus position, in agreement with the kidney to be assessed. The longitudinal (LD and dorsoventral diameters (DVD of kidney were measured in longitudinal plane, and the transverse diameter (TD was determined in transversal section. The renal volume (V was automatically calculated by the ultrasound software. With Triplex Doppler, the RI and PI of right and left main renal arteries were obtained. All data were represented in mean ± SEM. Linear regression analyses were performed with renal LD, DVD, TD and V as dependent variable, and ACD and H as independent variable. RI and PI were compared between right and left renal arteries with Student's t-test. The LD, DVD, TD (cm and V (ml mean measurements for the left and right kidneys were: 5.24±0.27, 3.07±0.15, 3.07±0.9, 28.01±3.4 and 4.50±0.19, 2.88±0.14, 2.71±0.15, 21.27±2.6. All regression analyses were significant for the intercept and regression coefficient (P<0.01. There were statistical differences on RI and PI means between right and left renal arteries (P=0.001. The RI and PI means of left and right renal artery obtained were: 0.62±0.08 and 1.34±0.18; 0.70±0.06 and 1.62±0.13. The data obtained in the present paper can be used as parameters for evaluation of the renal size, volume and perfusion in adult dogs.

  2. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD) and height (H) in Canis familiaris

    OpenAIRE

    Expedito Jr Matos Santana; Poliana S. Beserra; Adriel B. Brito; Stefânia A. Miranda; Elizabeth Nikolak; Sheyla F.S. Domingues

    2009-01-01

    O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC) e a altura (H) de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR) e do índice de pulsatilidade (IP) do ramo principal da artéria renal. No estudo foram utilizados 22 ...

  3. Occurrence of gastrointestinal parasites in dogs (Canis familiaris) with acute diarrhea from metropolitan region of Londrina, Parana State, Brazil/
    Ocorrência de parasitos gastrintestinais em cães (Canis familiaris) com diarréia aguda oriundos da região metropolitana de Londrina, Estado do Paraná, Brasil

    OpenAIRE

    Pedro Luiz Camargo; Odilon Vidotto; Milton Hissashi Yamamura; Fábio Augusto Galli dos Santos

    2007-01-01

    One hundred and fifty fecal samples from dogs with acute diarrhea (Group 1) and from 50 dogs without diarrhea (Group 2) were collected and analyzed at the Veterinary Teaching Hospital of the State University of Londrina, between October, 2004 and October 2005. From the positive samples (29.3%) of Group 1, 72.7% were infected by only one agent, while 27.3% had mixed infection. The following genera wereobserved by coproparasitologic evaluation: Giardia sp. (9.3%), Ancylostoma sp. (7.3%), Cystoi...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...

  5. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  6. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  7. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  9. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  10. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  13. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  14. Estudo morfofuncional das glândulas mamárias de Mão Pelada, Procyon cancrivorus Morphofunctional study of Crab-eating Raccoon (Procyon cancrivorus mammary gland

    Directory of Open Access Journals (Sweden)

    Tatiana Bellatine

    2010-08-01

    Full Text Available Para a descrição macro e microscópica das glândulas mamárias foram utilizadas três fêmeas de Mão Pelada (Procyon cancrivorus. As amostras das glândulas foram processadas conforme técnicas rotineiras para histologia. As fêmeas estudadas apresentaram 3 pares de glândulas mamárias, sendo um par de glândula mamária abdominal cranial, um par de abdominal caudal e um par de inguinal. As papilas mamárias apresentaram formato pendular, como os canídeos domésticos. Microscopicamente, a glândula mamária apresentou da porção externa para a interna: epiderme (epitélio estratificado pavimentoso queratinizado, derme (tecido conjuntivo frouxo e tecido conjuntivo denso não modelado, fibras musculares lisas e ductos papilíferos que abrem em vários ósteos papilares em formato de "chuveiro". A porção secretora glandular era caracteristicamente túbulo alveolar, com células cuboidais dispostas em camada simples. Os resultados indicam que o conjunto glandular estudado é semelhante ao da cadela (Cannis familiaris tanto em seu aspecto macroscópico quanto em seu aspecto microscópico, este fato sugere que podemos utilizar o Mão Pelada e o Cão como modelos similares de estudo, para identificação de patologias relacionadas a este sistema.Three Procyon cancrivorus females were studied with emphasis for gross and microscopical description of the mammary glands. Samples of the glands were processed with routine techniques for histology. The females studied presented three pairs of mammary glands: one pair of cranial abdominal mammary glands, a second pair of caudal abdominal and a third one, as inguinal mammary glands. Mammary papillae presented a pendulum shape, as in the domestic dogs. Microscopically, the mammary gland consisted from the external to the internal portion (1 of stratified squamous epithelium of the epidermis, (2 dense irregular connective tissue of the derma, and (3 smooth muscle fibers and papillary ducts that flowed

  15. Isolamento de bactérias aeróbias e sua sensibilidade a antimicrobianos em processos de osteomielite canina Aerobic bacterial isolates and susceptibility to antimicrobial agents in canine osteomyelitis

    OpenAIRE

    A.C. Simionato; M.C.C. Ramos; S.D.A. Coutinho

    2003-01-01

    O objetivo deste trabalho foi estudar a presença de bactérias aeróbias em 20 cães com osteomielite, decorrente de exposição óssea. Na identificação das bactérias utilizou-se o sistema API-Bio Mérieux e testou-se a sensibilidade dos microrganismos in vitro, pelo método de difusão em ágar, frente a 14 diferentes antibacterianos. O osso mais acometido pela infecção foi a tíbia (35%). Isolaram-se 68,3% de bactérias Gram positivas e 31,7% de Gram negativas. Staphylococcus spp, Streptococcus spp e ...

  16. Casos alóctones de leishmaniose visceral canina no Paraná, Brasil: implicações epidemiológicas Allochthonous cases of canine visceral leishmaniasis in Paraná, Brazil: epidemiological implications

    Directory of Open Access Journals (Sweden)

    Vanete Thomaz-Soccol

    2009-09-01

    Full Text Available O presente trabalho teve como objetivo pesquisar a ocorrência de leishmaniose visceral em cães com sinais clínicos compatíveis, procedentes de clínicas veterinárias das diferentes regiões do Estado do Paraná e em caso positivo verificar a autoctonia dos mesmos. Dos animais com suspeita clínica e epidemiológica de LV, foi coletada amostra de sangue para realização de hemograma, provas bioquímicas, sorologia, cultura do parasito, PCR e RAPD. Os cães portadores de quadro clínico, como febre, hiperqueratose, onicogrifose e emagrecimento exagerado, tiveram gânglio poplíteo e/ou medula óssea puncionados e o conteúdo inoculado em meio de cultivo NNN. A extração de DNA do parasito em sangue e cultura foi realizada pelo método fenol/clorofórmio. A amplificação de DNA do protozoário foi feita por PCR e RAPD. Dos 24 animais analisados, o parasito foi isolado em 19 cães. As técnicas moleculares permitiram identificar 14 isolados como L. (Leihmania infantum e cinco como L. (Viannia braziliensis. A análise epidemiológica dos casos permitiu determinar o local de transmissão e definir que todos os cães com LV diagnosticados eram casos alóctones, ou seja eram importados de regiões endêmicas. Sugere-se que a migração dos cães de regiões endêmicas para regiões indenes poderá permitir a instalação de novos focos, desde que o agente encontre ecótopo adequado e vetor específico (Lutzomyia longipalpis.The south region is the only area in Brazil that does not present autochthonous cases of visceral leishmaniasis (VL, however, in the state of Parana, dogs and humans have been found showing a VL compatible clinical profile. In view of this problem, the present work aimed at isolating and identifying the parasite and determining the cases autochthony. All animals clinically suspect of VL were clinically evaluated, and had samples of their blood collected for hemoculture (NNN culture medium, serology, PCR and RAPD-PCR, hemogram, and biochemical assays. The dogs presenting VL clinical profile had their lymph nodes and/or bone marrow punctured and their content inoculated in NNN culture medium. The protozoan isolated was identified by PCR and PCR-RAPD. Strains of Leishmania were isolated in 19 out of the 24 studied animals. Fourteen isolates were identified as L. (Leishmania infantum, and five were L. (Viannia braziliensis. In the epidemiological analysis, it was possible to determine that all dogs with L. (L. infantum being allochthonous cases. Leishmaniasis is a zoonose that has the domestic dog as reservoir, the migration ofsuch animals can disseminate the parasite to other regions, provided the agent finds an adequate ecotope and a specific vector (Lutzomyia longipalpis.

  17. Equinococosis canina en un sector del Departamento de Río Cuarto,Provincia de Córdoba, Argentina Canine echinococcosis in an area of Río Cuarto Department(Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    J. GONZALEZ PERALTA

    1998-01-01

    Full Text Available La hidatidosis es una zoonosis parasitaria de distribución universal,producida por un céstode del género Equinococus granulosus,que tiene como huésped definitivo de mayor importancia epidemiológicaal canino. El hombre y los animales de producción son huéspedesintermediarios. En Argentina las zonas que muestran altas tasas de transmisiónde hidatidosis al hombre son: La Patagonia, la Pampa Húmeda y elLitoral. En el resto del país los casos de hidatidosis humana senotifican sólo esporádicamente, como sucede en la provinciade Córdoba, que no posee un programa destinado al estudio epidemiológicoy de control, aunque su zona serrana es considerada endémica porla casuística encontrada. El presente trabajo de investigación se efectuó en ElChacay y Las Albahacas, dos localidades ubicadas en el sector sur de lasSierras de Comechingones, departamento Río Cuarto, provincia deCórdoba, con los siguientes objetivos: a determinar la proporciónde caninos con Equinococus granulosus, b valorar el nivelde conocimiento de los habitantes en relación a la enfermedad hidatídica.Se obtuvieron muestras de materia fecal de 120 caninos, por el suministrode Bromhidrato de Arecolina al 1.5%, realizándose el diagnósticopor visualización directa. Se efectuaron encuestas a travésde entrevistas personales a los propietarios de los caninos y a los pobladoresen general. La proporción de equinococosis en caninos fue del 5% en El Chacayy de 17.5% en Las Albahacas. Todos los caninos positivos proveníande establecimientos donde se halló la mayor cantidad de factoresde riesgo. Las 169 entrevistas realizadas determinaron aproximadamenteun 70% de desconocimiento de los pobladores acerca de la enfermedad hidatídica. Los resultados obtenidos justificarían, por su impacto en lasalud pública, la implementación de un programa de estudiosepidemiológicos completos que sirvan de soporte a un futuro programade prevención y control de la hidatidosis a nivel provincialHydatidosis is a parasitic zoonosis of universal distribution whichis produced by a cestode, the Echinococcus granulosus. This parasiteuses dogs as the epidemiological relevant definitive host, being humansand production animals the intermediate hosts. In Argentina, the regions that present very high rates of hydatidosistransmission to man are: Patagonia, the Pampas and the Littoral. In therest of the country, hydatidosis in humans is reported only sporadically,such as in Córdoba province whose hill area is considered an endemicone, and where there is no program to obtain an epidemiological and controlstudies of this zoonosis. Two localities, El Chacay and Las Albahacas, in the south area of theComechingones Hills, Río Cuarto Department, Córdoba Provincewere the working area for this study whose objectives were: a to determinethe proportion of dogs infected with Echinococcus granulosus, bto evaluate the population’s knowledge about the hydatidic disease. 120 dogs administrated with arecoline bromhydrate (1.5 % were sampledto obtain their fecal material. They were diagnosed by direct identificationof the parasite. The hydatidic problematic was analysed through personal interviewswith the dog owners and with the (general population. The (dog proportion of echinococcosis was 5% in El Chacay and 17.5%in Las Albahacas, all belonging to establishments where many hazard factorswere found. The 169 interviews showed that 70% of the cases lacked knowledge aboutthe hydatidic disease. Because of the public health impact of these considerations it is justifiedto carry on a control program of the disease

  18. Diagnóstico sorológico de erliquiose canina com antígeno brasileiro de Ehrlichia canis Serological diagnosis of canine monocytic ehrlichiosis with Brazilian antigen of Ehrlichia canis

    Directory of Open Access Journals (Sweden)

    Daniel Moura Aguiar

    2007-06-01

    Full Text Available O presente trabalho relata o isolamento de Ehrlichia canis em cultivo de células DH82 e posterior padronização da Reação de Imunofluorescência Indireta (RIFI. Leucócitos de uma cadela experimentalmente infectada com o isolado Jaboticabal de E. canis foram inoculados em cultivo de células DH82. A inoculação foi monitorada após a segunda semana, a cada 5-6 dias, através de exames citológicos e pela amplificação de um fragmento do gene dsb de Ehrlichia pela Reação em Cadeia pela Polimerase (PCR para confirmação da infecção. A cultura apresentou-se positiva aos 27 dias pós-inoculação pela PCR e aos 28 dias pela citologia. No 33o dia pós-inoculação, observou-se 20% de células infectadas e, aos 53 dias, 60% de infecção. Atualmente, o isolado encontra-se estabelecido em células DH82, com várias passagens atingindo 90-100% de células infectadas entre 7-10 dias após a inoculação. Após o seqüenciamento do produto de PCR, o isolado apresentou-se 100% similar à seqüência correspondente de E. canis depositada no GenBank. As células infectadas foram utilizadas como antígeno para a padronização da RIFI para detecção da infecção em cães.The present study describes a successful isolation of Ehrlichia canis and its establishment in DH82 cells, followed by the development of an Indirect Fluorescent Antibodies Test (IFAT. Leukocytes collected from an experimentally infected dog with the Jaboticabal strain of E. canis were used to inoculate a DH82 cell monolayer. Two weeks later, the inoculated culture was checked for infectivity, every 5-6 days by both cytological staining and PCR, targeting a fragment of the dsb gene. The cell culture showed to be infected by Ehrlichia on day 27 by PCR and on day 28 by cytological staining. By the day 33, the infection rate reached 20% and on day 53, 60%. Currently, the isolate is established in DH82 cells, with several passages reaching 90-100% of infected cells, within 7 to 10 days post inoculation. After sequencing, the amplicon was identical to other E. canis corresponding sequences available in the GenBank. DH82 infected cells were used to standardize an IFAT for the diagnosis of canine ehrlichiosis.

  19. Equinococosis canina en un sector del Departamento de Río Cuarto,Provincia de Córdoba, Argentina Canine echinococcosis in an area of Río Cuarto Department(Córdoba, Argentina)

    OpenAIRE

    J. GONZALEZ PERALTA; Gonzalez, G.; A. SBAFFO; A. BESSONE; M. CHASSAGNADE; L UGNIA; A. Weyers; N. ESPOSITO; G. BERNARDES; A. Alcoba; C. GUENDULAIN; Flores, P

    1998-01-01

    La hidatidosis es una zoonosis parasitaria de distribución universal,producida por un céstode del género Equinococus granulosus,que tiene como huésped definitivo de mayor importancia epidemiológicaal canino. El hombre y los animales de producción son huéspedesintermediarios. En Argentina las zonas que muestran altas tasas de transmisiónde hidatidosis al hombre son: La Patagonia, la Pampa Húmeda y elLitoral. En el resto del país los casos de hidatidosis humana senotifican sólo esporádicamente,...

  20. Análisis cinemático mediante videografía de alta velocidad en la displasia de cadera canina - Kinematic analysis using high speed videography in canine hip dysplasia

    OpenAIRE

    Vilar, JM; Morales M; Morales, I.; F. Miró; Martinez, A; Rodríguez, O.

    2012-01-01

    ResumenEl objetivo de este trabajo consiste en proporcionar aquellos parámetros lineares, angulares y temporales en un perro de raza bulldog con displasia de cadera mediante el analisis cinematico con videografía de alta velocidad.SummaryThe purpose of this paper is to provide linear,angular and temporal parameters of a bulldog with hip dysplasia. The analysis was performed using high speed videography.

  1. Desnervação capsular percutânea ou aberta no tratamento da dor na displasia coxofemoral canina Percutaneous versus open hip denervation in the treatment of canine pain hip dysplasia

    OpenAIRE

    Gisele Francine da Silva; Amanda Viana Carvalho; Bianca Mota Penteado; Bruno Testoni Lins; André Luis Selmi

    2012-01-01

    A desnervação capsular (DC) se baseia na desperiostização da borda acetabular e tem sido utilizada como uma das técnicas de alívio da dor articular em cães displásicos. Compararam-se as técnicas de DC percutânea e aberta, aplicadas em 25 cães, que apresentaram diagnóstico clínico e radiográfico de displasia coxofemoral, totalizando 31 cirurgias. Os efeitos das técnicas foram comparados, em período de 180 dias, por meio de avaliação subjetiva de claudicação e dor, perimetria da coxa, graus máx...

  2. Desnervação capsular percutânea ou aberta no tratamento da dor na displasia coxofemoral canina Percutaneous versus open hip denervation in the treatment of canine pain hip dysplasia

    Directory of Open Access Journals (Sweden)

    Gisele Francine da Silva

    2012-04-01

    Full Text Available A desnervação capsular (DC se baseia na desperiostização da borda acetabular e tem sido utilizada como uma das técnicas de alívio da dor articular em cães displásicos. Compararam-se as técnicas de DC percutânea e aberta, aplicadas em 25 cães, que apresentaram diagnóstico clínico e radiográfico de displasia coxofemoral, totalizando 31 cirurgias. Os efeitos das técnicas foram comparados, em período de 180 dias, por meio de avaliação subjetiva de claudicação e dor, perimetria da coxa, graus máximos de flexão e extensão da articulação coxofemoral e amplitude de movimento articular. Os graus de claudicação e dor apresentaram decréscimo significativo ao longo do período avaliado em ambos os grupos, sem apresentarem diferenças quando comparados entre si. Com relação à perimetria da coxa, flexão, extensão e amplitude de movimento articular, foi observado o aumento dos valores numéricos destas variáveis ao longo do estudo. Baseado nos achados, concluiu-se que a abordagem percutânea ou aberta na DC produz similitude nas variáveis avaliadas, e ambas trazem bons resultados.Joint capsule denervation is based on removal of sensitive fibers from the acetabular edge and has been used as one of the techniques to joint pain relief in the canine dysplastic hip. This study compared the techniques of percutaneous and open hip denervation in 25 dogs that showed clinical and radiographic signs of hip dysplasia, totaling 31 surgeries. The effects of the techniques were evaluated and compared in a period of 180 days following surgery, including subjective evaluation of lameness and pain, thigh girth, maximum degree of hip flexion and extension and range of motion (ROM. Degree of lameness and pain significantly decreased during the study period for both groups, and no difference could be observed between groups. Thigh girth, degree of flexion, extension and ROM presented an increase in the numerical values throughout the study. Based on these findings, it is concluded that the percutaneous or open approach for capsular denervation produced similar results.

  3. Análisis cinemático mediante videografía de alta velocidad en la displasia de cadera canina - Kinematic analysis using high speed videography in canine hip dysplasia

    Directory of Open Access Journals (Sweden)

    Vilar, JM

    2010-01-01

    Full Text Available ResumenEl objetivo de este trabajo consiste en proporcionar aquellos parámetros lineares, angulares y temporales en un perro de raza bulldog con displasia de cadera mediante el analisis cinematico con videografía de alta velocidad.SummaryThe purpose of this paper is to provide linear,angular and temporal parameters of a bulldog with hip dysplasia. The analysis was performed using high speed videography

  4. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México Experimental investigation of canine echinococcosis from swine hydatic cyst in Mexico

    Directory of Open Access Journals (Sweden)

    Ismael Zuñiga-A

    1999-06-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfol��gica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P OBJETIVO: Avaliar a infeção e obter o estado adulto do cestóides, provocando-se a reprodução da equinococose em cães a partir do cisto hidático de origem suína. MÉTODOS: Formaram-se dois grupos, um de 5 e outro de 3 cães. Cada animal do grupo experimental recebeu, por via oral, 2 g de membrana germinativa de cisto hidático fértil. O segundo grupo serviu como testemunha. Ambos os grupos foram avaliados de maneira clínica, sorológica e parasitológica. No grupo experimental foi sacrificado um animal no 35º dia da infeção e os outros cada 5 dias até o 55º dia. No segundo grupo, foram sacrificados no 55º dia. Foram encontrados ovos do cestóides em fezes a partir do 51º dia pós-infeção. A avaliação morfológica foi feita por meio de observação microscópica da raspagem de mucosa intestinal. RESULTADOS: Dos 50 cestóides analisados, 10 corresponderam a cada um dos cães infectados, 49 (98% mostraram 3 proglotides e 1 (2% continha só 4; 18 (36% dos cestóides apresentavam um proglotide grávido. Na availação clínica, o número de leucócitos e a quantidade de proteínas plasmáticas foram significantemente maiores no grupo testemunha (P OBJECTIVE: To evaluate the infection and obtain the adult state of the cestode, echinococcosis was reproduced in dogs using the hydatic cyst of swine. METHODS: Two groups were formed, one of five and the other of three dogs, each animal in the experimental group was given two grams of germinative membrane of fertile hydatic cyst by oral route. The second was the control group. Both groups were evaluated clinically, serologically and parasitologically. One animal was killed on the 35th day after infection and each five successive days until the 55th day. In the second group all the animals were killed on the 55th day. Eggs of the cestode were observed in feces from the 51st post-infection day. The morphological evaluation was made through microscopic observation of the mucous intestine scraping. RESULTS: Fifty cestodes were analyzed, ten from each of the infected dogs, 49 (98% presented three proglottids and 1 (2% had four; 18 (36% of the cestodes presented a gravid proglottid. The length of the strobila varied from 1.6 to 2.6 mm. The average of the long and short hooks was 31 and 34, respectively. The length of the long hooks varied from 0.081 to 0.09 mm, the short hooks from 0.034 to 0.041 mm. The quantity of plasmatic proteins and the number of leukocytes were significantly greater in the control group (P < 0.05; the quantity of alpha-globulins was larger in the infected group (P < 0.05. CONCLUSIONS: The results confirmed the dog-pig cycle, a subclinical infection in the definitive hosts, that makes the diagnosis and control in species closely related to the human being difficult.

  5. La leishmaniosis en la provincia de Lleida y Andorra. Estudio de los factores que influyen en la densidad de los vectores y en la prevalencia de la leishmaniosis canina

    OpenAIRE

    Ballart Ferrer, J. Cristina

    2013-01-01

    [spa] ANTECEDENTES: El cambio global conduce a la emergencia o reemergencia de las enfermedades transmitidas por vectores en algunas partes del mundo, incluyendo la leishmaniosis, una de las más olvidadas. La leishmaniosis es una enfermedad parasitaria transmitida principalmente a través de la picada de un flebotomo vector. En nuestro entorno, la leishmaniosis está causada por Leishmania infantum y los vectores probados de la misma son Phlebotomus ariasi y P. perniciosus. Los perros doméstico...

  6. Puesta a punto e interpretación de la aspiración con aguja fina en el diagnóstico de hiperplasia prostática y prostatitis crónica canina

    OpenAIRE

    González, Griselda; Maffrand, C.; Guendulain, Corina F.; Otegui, F.; Gobello, Cristina

    2008-01-01

    La hiperplasia prostática benigna (HPB) y sus complicaciones infecciosas son las enfermedades prostáticas más prevalentes en perros de edad avanzada. Aunque la biopsia ofrece el diagnóstico definitivo, la aspiración con aguja fina (AAF) con guía ecográfica es una herramienta rápida y segura para el diagnóstico citológico presuntivo de las alteraciones prostáticas. El objetivo del presente trabajo fue poner a punto la técnica de AAF prostática ecodirigida y la interpretación del material obten...

  7. Matrix metalloproteinases 2 and 9 expression in canine normal prostate and with proliferative disorders Expressão de metaloproteinases de matriz 2 e 9 na próstata canina normal e com lesões proliferativas

    OpenAIRE

    Mariana Batista Rodrigues Faleiro; Giuliana Brasil Croce; Denise Caroline Toledo; Marcela Marcondes Pinto Rodrigues; Aline Carvalho Batista; Adilson Donizeti Damasceno; Luiz Augusto Batista Brito; Renée Laufer Amorim; Veridiana Maria Brianezi Dignani de Moura

    2013-01-01

    In this study the expression of metalloproteinases 2 (MMP-2) and 9 (MMP-9) in canine normal prostates and with proliferative disorders was evaluated to verify the role of these enzymes in extracellular matrix remodeling (ECM) and in the tissue invasion process. A total of 355 prostatic samples were obtained, from which 36 (10.1%) were normal prostates, 46 (13.0%) with benign prostatic hyperplasia (BPH), 128 (36.1%) with proliferative inflammatory atrophy (PIA), 74 (20.8%) with prostatic intra...

  8. Estudio epidemiológico de las luxaciones sacroilíacas caninas y de su tratamiento - Epidemiological study about dog´s ilio-sacral luxations and their treatment

    Directory of Open Access Journals (Sweden)

    Casasola, A.

    2010-07-01

    Full Text Available ResumenSe ha realizado un estudio retrospectivo en 23 perros recibidos en laConsulta de Cirugía de la Facultad de Veterinaria de la Universidad deExtremadura a los que se les diagnosticó subluxación o luxación sacroilíaca unilateral o bilateral. El 1,06% de los perros con lesiones traumatológicas y/o ortopédicas tienen luxación sacroilíaca. El 39,13% de los casos de luxaciones sacroilíacas pesan menos de 10 kg. y el 73,9% son menores de 2 años. El 82,6% se deben a atropellos por vehículos de motor. El 20,7% (23/111 de las fracturas de pelvis en perros se acompañan de luxaciones sacroilíacas. A ninguno de los 16 casos remitidos por otro veterinario se le había diagnosticado la luxación sacroilíaca. Diagnóstico que no debe ser pasado por alto, porque, en nuestro estudio, el 28,6% de los casos se asociabacon déficits neurológicos. Un 86,25% de las luxaciones sacroilíacasestaban asociadas a otras lesiones, como fracturas de ilion, isquion,pubis, fémur, luxación lumbosacra o arrancamiento sacrococcígeo.La técnica quirúrgica se ha realizado con un abordaje dorsal y consistía, fundamentalmente, en la estabilización de la articulación con tornillos,agujas de Kirschner o combinaciones de ambos. En un 60% de los casos (6/10 se produjeron complicaciones intraoperatorias. En 4/6 por problemas en la colocación de implantes, bien inserciones repetidas o malposiciones. Las complicaciones postoperatorias acaecieron en el 30% (3/10, un caso por infección y dos por movilización de los implantes. En el 25% de los casos que llevaban agujas de Kirschner se produjeron migraciones de las mismas.SummaryA retrospective study in 23 dogs received in the Surgery Department ofthe Veterinary Faculty of Extremadura´s University whose diagnoseswere unilateral or bilateral ilio-sacral sub-luxation or luxation has been done. One point zero six percent of the dogs with traumatological and/or orthopedical injuries have ilio-sacral luxation. The weight was less than 10 kg in the 39,13% of the ilio-sacral luxation cases and the 73,9% of the cases were younger than 2 years old. The 82,6% of the ilio-sacral luxations were causes by motor vehicle. Twenty and three out one hundred and eleven (20,7% of pelvic fractures in dogs were accompanied with ilio-sacral luxations. None of the 16 cases that were referred by others vets were diagnosed of ilio-sacral luxation. This diagnosis has been done carefully because, in our study, the 28,6% of the cases had neurological deficits associated. The 86,25% of iliosacral luxations were accompanied by other injuries as ilial, isquial, pubical andfemoral fractures, lumbosacral luxation or pull the tail up.The surgical technique was done with a dorsal approach and consisted,fundamentally, in the stabilization of the joint with screws, Kirschner´s pins or a combination of both of them.

  9. A weight loss protocol and owners participation in the treatment of canine obesity Um protocolo de perda de peso e a participação dos proprietários no tratamento da obesidade canina

    OpenAIRE

    Aulus Cavalieri Carciofi; Karina Nogueira Venturelli Gonçalves; Ricardo Souza Vasconcellos; Rodrigo Sousa Bazolli; Márcio Antonio Brunetto; Flávio Prada

    2005-01-01

    The success of a weight loss program for pets depends on the owners collaboration. Their compliance is fundamental in establishing the correct food management. The objective of this study was to compare the effectiveness of a weight loss program in two groups of dogs, one maintained under experimental conditions and the other with their owners. The same hypocaloric food was used to feed all animals, the amount being restricted to 60% of the estimated maintenance energy requirement for a 15% r...

  10. Etiology of canine otitis media and antimicrobial susceptibility of coagulase-positive Staphylococci in Fortaleza city, Brazil Etiologia da otite média canina e susceptibilidade a antimicrobianos de Staphylococcus coagulase-positiva em Fortaleza, Brasil

    Directory of Open Access Journals (Sweden)

    Lis Christina de Oliveira

    2006-06-01

    Full Text Available This study evaluated the middle ear microbiota and antimicrobial susceptibility patterns from strains isolated from dogs with otitis media. A total of 62 dogs obtained from Zoonoses Control Center of Fortaleza City Ceará State / Brazil were studied over a 10-month period (August/2003 to June/2004. Of the total, 46.8% (n=30 of the animals were positive for otitis media and the infection was monomicrobial in 76.6% of them. The most frequent isolated agents were coagulase-positive Staphylococci (CPS-55% and Pseudomonas sp (10%. For S. intermedius (n=13 and S. aureus subsp aureus (n=9, respectively, the greater resistance rates were observed using penicillin G (30.76% and 44.44%, ampicillin (7.69% and 44.44%, erythromycin (23.07% and 44.44%, clindamycin (23.07% and 44.44% and thrimethropim/sulfamethoxazol (15.38% and 33.33%.O presente trabalho avaliou a microbiota do ouvido médio e os perfis de susceptibilidade a antimicrobianos de cepas isoladas de cães com otite média. Um total de 62 cães obtidos no Centro de Controle de Zoonoses de Fortaleza Ceará / Brasil foram estudados no período de 10 meses (agosto/2003 a junho/2004. Do total de animais, 46.8% (n=30 foram positivos para otite media e a infecção envolvida era monomicrobiana em 76,6% dos casos. Os agentes isolados com maior frequência foram Staphylococcus coagulase-positiva (CPS-55% e Pseudomonas sp (10%. Considerando-se S. intermedius (n=13 e S. aureus subsp aureus (n=9, respectivamente, as mais elevadas taxas resistência foram observadas frente a: penicilina G (30,76% e 44,44%, ampicilina (7,69% e 44,44%, eritromicina (23,07% e 44,44%, clindamicina (23,07% e 44,44% e trimetropim/sulfametoxazol (15,38% e 33,33%.

  11. Eficácia das lactonas macrocíclicas sistêmicas (ivermectina e moxidectina na terapia da demodicidose canina generalizada Efficacy of systemics macrocyclic lactones (ivermectin and moxidectin for the treatment of generalized canine demodicosis

    Directory of Open Access Journals (Sweden)

    E.H. Delayte

    2006-02-01

    Full Text Available Avaliou-se a eficácia de lactonas macrocíclicas (ivermectina e moxidectina sobre a eventual ocorrência de efeitos colaterais e acompanharam-se, após a alta parasitológica, por 12 meses, os cães tratados, visando detectar a recidiva do quadro dermatopático. Dos 63 animais, 59% eram fêmeas, 76% apresentavam precisa definição racial e 67% tinham pelame curto. A ivermectina (0,6mg/kg/dia foi administrada por via oral a 31 cães, e a moxidectina (0,5mg/kg/cada 72 horas, pela mesma via, a 32 animais. Os tempos médios para a obtenção da primeira negativação do exame parasitológico do raspado cutâneo e para a consecução da alta foram, respectivamente, de 90 e 130 dias para a ivermectina e de 108 e 147 dias para a moxidectina. A ivermectina acarretou menos (16,1% efeitos colaterais em relação à moxidectina (37,5% (P=0,03. As recidivas foram, respectivamente, 10,3% e 13% para ivermectina e moxidectina. Não houve diferença entre os dois protocolos de terapia quanto aos percentuais de recidiva (P=0,67 e eficácia (P=0,61. Ambas as lactonas macrocíclicas mostraram-se eficazes: ivermectina 89,7% e moxidectina 87%.The efficacy of ivermectin and moxidectin for treatment of generalized canine demodicosis, was evaluated to detect the eventual occurrence of side effects caused by the use of these drugs, and to follow the treated dogs for 12 months after obtaining parasitologic cure. Of 63 dogs, 59% were females, 76% were defined as purebred and 67% had short hair. Ivermectin (0.6mg/kg/daily was orally administered to 31 dogs and moxidectin (0.5mg/kg/every 72 hours to 32 dogs. The average number of days to obtain the first negative skin scraping results and the parasitologic cure were, respectively, 90 and 130 days for ivermectin, and 108 and 147 days for moxidectin. Ivermectin caused fewer side effects (16.1% than moxidectin (37.5% (P0.67 and efficacy (P>0.61. Both drugs were effective and safe to treat generalized canine demodicosis: ivermectin 89.7% and moxidectin 87.0%.

  12. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México Experimental investigation of canine echinococcosis from swine hydatic cyst in Mexico

    OpenAIRE

    Ismael Zuñiga-A; Carlos J Jaramillo-A; José J Martínez-M; Jorge Cárdenas-L

    1999-01-01

    OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un ani...

  13. Diagnóstico da raiva canina: I. comparação entre amostras de saliva e de encéfalo Diagnosis of canine rabies: I. comparison of saliva and encephalon samples

    Directory of Open Access Journals (Sweden)

    Valdson de Angelis Côrtes

    1979-12-01

    Full Text Available Foram examinadas mediante as técnicas de inoculação em camundongos e de imunofluorescência, 30 amostras de saliva e 30 amostras de encéfalo, colhidas de 30 cães raivosos. Todas as amostras, tanto de saliva como de encéfalo, apresentaram resultados positivos frente às duas técnicas usadas, demonstrando uma perfeita correlação entre os métodos e os espécimens utilizados. Foi ressaltada a importância da saliva para o estabelecimento de um diagnóstico mais precoce da raiva.Thirty saliva samples and 30 encephalon samples, collected from an equal number of rabid dogs, were examined by both the mouse inoculation and immunoflluorescent techniques. The results for each sample were positive with both techniques, showing perfect correlation in the methods and specimens used. The importance of saliva for early diagnosis was stressed.

  14. A monitorização por electrocardiografia ambulatória (Holter) na cardiologia canina : estudo clínico de nove canídeos com lesão degenerativa crónica da valva mitral

    OpenAIRE

    Almeida, Joana Grade Mendes Costa

    2009-01-01

    Nos anos 40 do século passado, Norman Holter descobriu a electrocardiografia ambulatória. Em alguns anos o monitor Holter chegou à Medicina Veterinária, sendo actualmente um meio de diagnóstico prático, não doloroso, não invasivo e bem tolerado, que permite a monitorização do funcionamento cardíaco por 24 horas e portanto a identificação e quantificação das arritmias presentes num traçado com tal duração. Até à data e no que diz respeito aos cães não se conhece o número exacto ...

  15. Experimentelle Untersuchungen zu kognitiven und sozialen Mechanismen der Kooperation an je einer Gruppe Europäischer Wölfe (Canis l. lupus L.) und Deutscher Schäferhunde (C. lupus familiaris) unter Gehegebedingungen – Eine Fallstudie

    OpenAIRE

    Plagmann, Silke

    2010-01-01

    Kooperation spielt bei vielen Arten eine wichtige Rolle, doch über die Mechanismen ist noch vieles unbekannt. Diese Arbeit untersuchte kognitive und soziale Mechanismen des kooperativen Problemlöseverhaltens beim Wolf und beim Haushund im experimentellen Ansatz. Obwohl die Wölfe in der Testsituation nicht kooperierten, wiesen bestimmte Verhaltensmerkmale auf grundlegende Voraussetzungen zur Kooperation hin. Haushunde kooperieren bei der Futterbeschaffung, sie passen ihr Verhalten an das eines...

  16. Prvky chování vlka (Canis lupus) ve vztahu k prvkům chování německého ovčáka (Canis lupus f. familiaris).

    OpenAIRE

    ZUNKOVÁ, Karolína

    2012-01-01

    The aim of my study was to compare similarities and differences in behavior among the general wolf (Canis lupus) and German Shepherd dog. My thesis is recherche. Behavior data and a comparison I gained from the literature and created questionnaires designed for breeders of German shepherds dogs. The available sources indicated that the differences between the general behavior of the wolf and German shepherd dog are given by the German Shepherd Dog domestication , environment and human impact ...

  17. Steroid hormones in blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen polutted minke whale (Balanenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Letcher, J.;

    2014-01-01

    contaminant exposure were concomitant with elevation in concentrations of steroid hormones in blood plasma of exposed sledge dogs. Based on these unexpected results, data suggest that more investigations should be focused on steroid endocrine disruption and potential health effects in Arctic top predators...

  18. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758 from the Metropolitan Region of Recife – state of Pernambuco – Brazil

    Directory of Open Access Journals (Sweden)

    Auxiliadora de Moraes Ostermann

    2011-06-01

    Full Text Available This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of the animals and processed using Willis’s technique and spontaneous sedimentation. The results obtained in the necropsy indicated a positivity of 96.8% (93∕96, being 83.3%, 34.4%, 30.2%, 28.1%, 14.6%, 6.3% and 2.1% for Ancylostoma caninum, Dypilidium caninum, Toxocara canis, Trichuris vulpis, Ancylostoma braziliense, Toxascaris leonina and Spirocerca lupi, respectively. Results from the Willis technique, sedimentation and necropsy were only significantly different (p<0.05 in the detection of infection by Ancylostoma spp. The Willis technique and sedimentation did notpresent any differences for the other gastrointestinal helminthes.

  19. Comparison of coproparasitological exams and necropsy for diagnosis of gastro-intestinal helminth infection in mongrel dogs (Canis familiaris, Linnaeus, 1758) from the Metropolitan Region of Recife – state of Pernambuco – Brazil

    OpenAIRE

    Auxiliadora de Moraes Ostermann; Marilene Maria de Lima; Márcia Paula Oliveira Farias; Alessandra Santos d’Alencar; Mariana Karolina Freitas Galindo; Carla Tejo da Silva; Leucio Câmara Alves; Maria Aparecida da Gloria Faustino

    2011-01-01

    This work was carried out to compare the coproparasitological and necropsy exams for diagnosis of gastrointestinal helminth infection, evaluating the parasitism frequency in stray dogs captured by the Centro de Vigilância Ambiental of the city of Recife, Pernambuco. A total of 96 dogs of both sexes, with variying ages and races, were used. The animals were sacrificed and necropsied for the collection of adult helminthes. In parallel, fecal samples were collected directly from the rectum of th...

  20. Freqüencia da infecção por Giardia lamblia (Kunstler, 1882 em cães (Canis familiaris avaliada pelo Método de Faust e cols. (1939 e pela Coloração da Auramina, no município de Canoas, RS, Brasil Frequence of infection by Giardia lamblia (Kunstler, 1882 in dogs (Canis familiaris available trough the Faust and Collaborators Method (1939 and Auramine Staining in Canoas, RS, Brazil

    Directory of Open Access Journals (Sweden)

    Cristiane Beck

    2005-02-01

    Full Text Available Giardia lamblia é um protozoário que acomete mais comumente animais jovens e que convivem em grupos. Apesar da alta prevalência, nem todos os animais apresentam a forma clínica da doença. Mesmo assim, a giardíase tem importância epidemiológica por possuir um elevado potencial zoonótico. O presente estudo teve como objetivo determinar a freqüência de Giardia lamblia em cães no município de Canoas, RS, Brasil, através do Método de Faust e cols. (1939 e da Técnica de Coloração da Auramina. Os grupos experimentais foram divididos de acordo com a procedência e o sexo. Das 332 amostras analisadas pelo Método de Faust e cols, a freqüência obtida foi de 34,04%, podendo variar de 28,95 a 39,13%, dentro de um intervalo de confiança de 95%. Destas amostras positivas, 40,96% foram de canil e 27,11% de cães de rua. O Teste Exato de Fisher aplicado a esses dados revelou existir uma diferença significativa (p=0,0107 entre as variáveis resultado e procedência. A variável sexo, neste método, não apresentou diferença significativa em relação ao resultado (P=0,8162 totalizando 33,11% de machos e 34,08% de fêmeas infectadas com o parasita. Das 147 amostras realizadas pela Técnica de Coloração da Auramina, 23 foram positivas, totalizando 15,65%. A análise estatística pelo Teste McNemar revelou existir diferença significativa entre as duas técnicas (P=0,0004. O valor Kappa foi igual a 0,07, considerado como um grau de concordância fraco. Os resultados encontrados neste estudo nos permitem afirmar que o Método de Faust e cols. foi o mais adequado para o diagnóstico da infecção por Giardia lamblia, sendo este parasita altamente prevalente na região estudada.Giardia lamblia is a protozoan that commonly infects young animals which live in groups. Despite its high prevalence many animals don’t exhibit clinical signs. Giardiasis is epidemiologically important concerning the zoonotic potential of the disease. The objective of this study was to determine the frequence of Giardia lamblia in the canine population of Canoas, RS, Brazil, applying the Faust and Collaborators Method (1939 and the Auramine Staining Technique. The dogs were classified according to the origin and gender. Feces samples of 332 dogs were analyzed by the Faust and Collaborators Method. The frequency of the infection obtained was 34.04%, ranging from 28.95% to 39.13% (confident interval at a 95% level. For kennel bred animals 40,96% of the samples were positive and for stray dogs 27.11%. Applying Fisher’s Exact Test to these figures there was a significant difference (P=0.0107 when comparing the origin of the animals and the results of the tests. However when comparing genders there was no significant difference (P=0.8162, the former with 33.11% of positive males and 34.08% positive females. When submitted to the Auramine Staining Technique(147 samples, 15.67% (23 of the samples resulted positive. The statistical analysis using the McNemar Test exposed a significant difference between both techniques (P=0.0004. The Kappa value of 0.07 obtained was considered of low rate. The results allow one to affirm that the Faust and Collaborators Method was the most suitable diagnostic test for Giardia lamblia infection, considering the high prevalence of this parasite in the studied region.

  1. Freqüencia da infecção por Giardia lamblia (Kunstler, 1882) em cães (Canis familiaris) avaliada pelo Método de Faust e cols. (1939) e pela Coloração da Auramina, no município de Canoas, RS, Brasil Frequence of infection by Giardia lamblia (Kunstler, 1882) in dogs (Canis familiaris) available trough the Faust and Collaborators Method (1939) and Auramine Staining in Canoas, RS, Brazil

    OpenAIRE

    Cristiane Beck; Flávio Antônio Pacheco de Araújo; Adriana Tarnowski Olicheski; Adriana Schneider Breyer

    2005-01-01

    Giardia lamblia é um protozoário que acomete mais comumente animais jovens e que convivem em grupos. Apesar da alta prevalência, nem todos os animais apresentam a forma clínica da doença. Mesmo assim, a giardíase tem importância epidemiológica por possuir um elevado potencial zoonótico. O presente estudo teve como objetivo determinar a freqüência de Giardia lamblia em cães no município de Canoas, RS, Brasil, através do Método de Faust e cols. (1939) e da Técnica de Coloração da Auramina. Os g...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0725 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0725 ref|NP_001005764.1| purinergic receptor P2Y, G-protein coupled, 1 [Canis lupus... familiaris] gb|AAU87363.1| purinergic receptor P2Y1 variant 1 [Canis lupus familiaris] gb|AAU8...7364.1| purinergic receptor P2Y1 variant 2 [Canis lupus familiaris] NP_001005764.1 3e-71 97% ...

  3. Environ: E00833 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 01579] Rosa canina [TAX:74635] Rosaceae Rose hip accessory fruit Major component: Ascorbate [CPD:C00072] [DR...:D00018] Medicinal herbs [BR:br08322] Dicot plants: rosids Rosaceae (rose family) E00833 Rose hip ...

  4. NCBI nr-aa BLAST: CBRC-VPAC-01-1534 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1534 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-126 75% ...

  5. NCBI nr-aa BLAST: CBRC-TSYR-01-0801 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0801 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 79% ...

  6. NCBI nr-aa BLAST: CBRC-TTRU-01-0906 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0906 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-122 76% ...

  7. NCBI nr-aa BLAST: CBRC-LAFR-01-3219 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3219 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0057 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 3e-50 57% ...

  10. NCBI nr-aa BLAST: CBRC-MMUR-01-0982 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0982 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-159 86% ...

  11. NCBI nr-aa BLAST: CBRC-MMUR-01-0468 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0468 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-51 49% ...

  12. NCBI nr-aa BLAST: CBRC-MMUS-07-0511 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0511 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 77% ...

  13. NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0131 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 3e-69 47% ...

  14. NCBI nr-aa BLAST: CBRC-PCAP-01-0158 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0158 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-69 61% ...

  15. NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...

  16. NCBI nr-aa BLAST: CBRC-OGAR-01-1197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-162 85% ...

  17. NCBI nr-aa BLAST: CBRC-MEUG-01-1061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1061 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-61 44% ...

  18. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  19. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-03-0298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-03-0298 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-154 76% ...

  2. NCBI nr-aa BLAST: CBRC-GGOR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0009 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 77% ...

  3. NCBI nr-aa BLAST: CBRC-OLAT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0032 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-61 41% ...

  4. NCBI nr-aa BLAST: CBRC-MMUR-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0910 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 90% ...

  5. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-51 44% ...

  6. NCBI nr-aa BLAST: CBRC-DRER-11-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-11-0014 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-93 52% ...

  7. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  8. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  9. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  11. NCBI nr-aa BLAST: CBRC-MMUS-03-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0082 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 87% ...

  12. NCBI nr-aa BLAST: CBRC-PCAP-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0028 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-149 89% ...

  13. NCBI nr-aa BLAST: CBRC-OPRI-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0017 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-37 39% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-08-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0127 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 5e-77 45% ...

  15. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 2e-30 37% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  18. NCBI nr-aa BLAST: CBRC-RNOR-23-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-23-0122 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-1433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1433 ref|NP_001041572.1| G protein-coupled receptor 44 [Canis lupus fa...miliaris] emb|CAJ77887.1| G-protein coupled receptor [Canis lupus familiaris] NP_001041572.1 1e-133 66% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1930 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-69 59% ...

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-72 48% ...

  3. NCBI nr-aa BLAST: CBRC-CPOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1448 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-141 93% ...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0668 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-78 59% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-1021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1021 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-62 43% ...

  6. NCBI nr-aa BLAST: CBRC-LAFR-01-2049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2049 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-113 78% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  9. NCBI nr-aa BLAST: CBRC-PCAP-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0105 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-97 62% ...

  10. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-101 64% ...

  11. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  12. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  13. NCBI nr-aa BLAST: CBRC-MLUC-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0118 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-64 52% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-1017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1017 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-80 48% ...

  16. NCBI nr-aa BLAST: CBRC-RMAC-14-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0161 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 9e-90 72% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  18. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  19. NCBI nr-aa BLAST: CBRC-TSYR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1175 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 73% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-0863 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0863 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-124 73% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-3354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3354 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 9e-94 49% ...

  2. NCBI nr-aa BLAST: CBRC-LAFR-01-3130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3130 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 91% ...

  3. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  4. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  5. NCBI nr-aa BLAST: CBRC-OPRI-01-0599 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0599 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 65% ...

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-3056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3056 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-38 86% ...

  7. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-71 48% ...

  8. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  10. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  11. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  12. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0899 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0899 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  14. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  15. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-102 62% ...

  17. NCBI nr-aa BLAST: CBRC-PVAM-01-1222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1222 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 92% ...

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  19. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1975 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 0.0 78% ...

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0140 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 4e-68 57% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1732 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-178 83% ...

  4. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  5. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  6. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  7. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  8. NCBI nr-aa BLAST: CBRC-PHAM-01-1272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1272 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-119 88% ...

  9. NCBI nr-aa BLAST: CBRC-OGAR-01-0872 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0872 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-171 89% ...

  10. NCBI nr-aa BLAST: CBRC-BTAU-01-2271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2271 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-144 78% ...

  11. NCBI nr-aa BLAST: CBRC-PABE-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0060 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  12. NCBI nr-aa BLAST: CBRC-HSAP-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0078 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  13. NCBI nr-aa BLAST: CBRC-MMUR-01-1296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1296 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  14. NCBI nr-aa BLAST: CBRC-RMAC-04-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0054 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  16. NCBI nr-aa BLAST: CBRC-TSYR-01-1188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1188 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-145 89% ...

  17. NCBI nr-aa BLAST: CBRC-CFAM-12-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0019 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 0.0 99% ...

  18. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  19. NCBI nr-aa BLAST: CBRC-DRER-16-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-16-0068 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-119 65% ...

  20. NCBI nr-aa BLAST: CBRC-TBEL-01-2041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2041 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-123 91% ...

  1. NCBI nr-aa BLAST: CBRC-CJAC-01-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0081 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-172 90% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  3. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  5. NCBI nr-aa BLAST: CBRC-LAFR-01-3535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3535 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-109 74% ...

  6. NCBI nr-aa BLAST: CBRC-PTRO-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0072 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0701 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0701 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-157 74% ...

  8. NCBI nr-aa BLAST: CBRC-FCAT-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1055 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 4e-61 46% ...

  9. NCBI nr-aa BLAST: CBRC-PVAM-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1133 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 2e-61 92% ...

  10. NCBI nr-aa BLAST: CBRC-LAFR-01-3197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-149 81% ...

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-3181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3181 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-153 94% ...

  12. NCBI nr-aa BLAST: CBRC-MMUR-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0421 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 7e-75 50% ...

  13. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-64 44% ...

  14. NCBI nr-aa BLAST: CBRC-TSYR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0145 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 4e-82 61% ...

  15. NCBI nr-aa BLAST: CBRC-PCAP-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1445 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-164 87% ...

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1165 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-76 41% ...

  17. NCBI nr-aa BLAST: CBRC-VPAC-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1411 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-31 37% ...

  18. NCBI nr-aa BLAST: CBRC-PHAM-01-0220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0220 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-153 89% ...

  19. NCBI nr-aa BLAST: CBRC-MDOM-08-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0128 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 8e-62 45% ...

  20. NCBI nr-aa BLAST: CBRC-MLUC-01-1134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1134 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-137 77% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-1851 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1851 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-147 73% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-1082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1082 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 88% ...

  3. NCBI nr-aa BLAST: CBRC-STRI-01-2923 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2923 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-157 86% ...

  4. NCBI nr-aa BLAST: CBRC-OGAR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1050 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 0.0 93% ...

  5. NCBI nr-aa BLAST: CBRC-OPRI-01-0681 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0681 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-134 91% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1167 ref|XP_848356.1| PREDICTED: similar to adiponectin receptor 1 iso...form 2 [Canis familiaris] ref|XP_537118.2| PREDICTED: similar to adiponectin receptor 1 isoform 1 [Canis familiaris] XP_848356.1 1e-138 67% ...

  7. Bases moleculares de la activacion plaquetaria en el perro

    OpenAIRE

    Fragio Arnold, Cristina

    1991-01-01

    Se ha estudiado la participacion del metabolismo de polifosfoinositidos y de los segundos mensajeros derivados de este ultimo en la secrecion de serotonina inducida por agonistas fisiologicos y afisiologicos en plaquetas caninas. Asimismo, se ha abordado el estudio de las vias de liberacion de acido araquidonico, asi como la implicacion de este acido graso y de sus metabolitos en la secrecion plaquetaria. Tambie se ha investigado la existencia de proteinas-G-reguladoras en plaquetas caninas y...

  8. Dicty_cDB: SSI887 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SRG*i Frame B: ---khffktk*piiv*rienknnqkaiittiiiiiiiiiiiivfiimivvimlklmklll lqiilivviknnl*liiviiiiiiiikiimifllmii*ililvilisiqksii... 1.7 1 CE030224 |CE030224.1 tigr-gss-dog-17000347316856 Dog Library Canis familiaris genomic, genomic survey... |CE097594.1 tigr-gss-dog-17000371080821 Dog Library Canis familiaris genomic, ge...nomic survey sequence. 44 1.7 1 CE710146 |CE710146.1 tigr-gss-dog-17000369457188 Dog Library Canis familiaris...SS (Link to library) SSI887 (Link to dictyBase) - - - Contig-U16307-1 SSI887Z (Link to Original si

  9. Unigene BLAST: CBRC-CFAM-14-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-14-0057 gnl|UG|Cfa#S22748992 PREDICTED: Canis familiaris similar to Neurofilament... triplet M protein (160 kDa neurofilament protein) (Neurofilament medium polypeptide) (NF-M) (Neurofilament

  10. Unigene BLAST: CBRC-CFAM-18-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-18-0003 gnl|UG|Cfa#S22748992 PREDICTED: Canis familiaris similar to Neurofilament... triplet M protein (160 kDa neurofilament protein) (Neurofilament medium polypeptide) (NF-M) (Neurofilament

  11. Unigene BLAST: CBRC-CFAM-04-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-04-0010 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  12. Unigene BLAST: CBRC-CFAM-03-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-03-0024 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  13. Unigene BLAST: CBRC-CFAM-28-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-28-0009 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  14. Unigene BLAST: CBRC-CFAM-04-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-04-0009 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  15. Unigene BLAST: CBRC-CFAM-08-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-08-0022 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  16. Unigene BLAST: CBRC-CFAM-04-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-04-0015 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  17. Unigene BLAST: CBRC-CFAM-04-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-04-0014 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  18. Unigene BLAST: CBRC-CFAM-01-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0005 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  19. Unigene BLAST: CBRC-CFAM-16-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-16-0044 gnl|UG|Cfa#S22759321 PREDICTED: Canis familiaris similar to D(1B) dopamine ... rec ... eptor (D(5) dopamine ... receptor) (D1beta dopamine ... receptor) (LOC488824), ...

  20. CROSS TRANSMISSION OF 'GIARDIA'

    Science.gov (United States)

    Giardia cysts isolated from fecal samples obtained from humans (Homo sapiens), beaver (Castor canadensis), dogs (Canis familiaris), cats (Felis domesticus), bighorn X mouflon sheep (Ovis canadensis X O. musimon), guinea pig (Cavis porcellus), muskrat (Ondatra ziethica) and mule d...

  1. An analysis of osteological material from the late Funnel Beaker culture settlement in Brozany, northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2013-01-01

    Roč. 65, č. 3 (2013), s. 504-534. ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : archaeozoology * Eneolithic * puppies (Canis familiaris) * human newborns * fox * bird * fish * Apodemus * Unio * bone artefacts Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. 50 CFR 14.4 - What terms do I have to understand?

    Science.gov (United States)

    2010-10-01

    ... zoological park, accredited institution of higher education, accredited member of the American Zoo and... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus...

  3. Gene : CBRC-PVAM-01-1534 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1534 UN A Opsins OPSR_CAPHI 1e-129 94% ref|XP_538203.2| PREDICTED: similar to Green ... -sensitive opsin (Green ... cone photoreceptor pigment) [Canis familiaris] 1e- ...

  4. Gene : CBRC-PTRO-12-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available TMESGFFLAMAFDRYVAICNPLRHSAILTRAVIGRVGLAIVLRGIALLSPHSFLLRWLPYCRTHIISHTYCEFMALIRIACAETKFRRAYSLIVAFLTGVVDFILI... 1e-101 56% ref|XP_852683.1| PREDICTED: similar to olfactory receptor Olr84 [Canis familiaris] 1e-160 87% MSAYNNTDARPSTFILI...IYSYVLILHTVFQFPSKDARLKSLGTCGSHVCVILVSYTPAFFSFLTHRFGHHVAPHFHIFVANIYLLVPPMVNPITYGVRTKRIWDRFLKVFSFSKPLSKSFLLVRNI ... ...GIPGLEAAHIWISIPFCVVYLLALLGNGSLLFIIKTEPSLHEPMYLFLCMLAVVDLVVCSTAVPKLLSLFWFHDGEIRFETCLTRVFLIHSCS

  5. Gene : CBRC-STRI-01-0292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 7e-42 76% ref|XP_540593.2| PREDICTED: similar to olfactory receptor Olr363 [Canis familiaris] 9e-46 82% MNNT...EVRKFILLGLISAPQLQLPLFIMFTLIYLITLVRNLGMITLILLDSRLHTPMYFFLSHLSLVDFCSSSVVTPKVMAGLLMEDKVISYNACAAQMFFFALFATVEKYLLTTAESHYQVGMSHRNPCQRTPC ...

  6. Gene : CBRC-TBEL-01-2632 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 5e-68 53% ref|XP_542004.2| PREDICTED: similar to Olfactory receptor 7A5 (Olfactory receptor TPCR92) [Canis familiaris] 4e-64 49% MEDI...GGEEIVALLSPTWGIFRTNAAEIQLLIYGLFLSVYLITVLRNLLSILLTISDSHLHTPMYFFLSILSFIDICFTSMRIPKMLV...NIQTQSKLLLIHLSPFAIMNSQLCRQLILVSDIISVPHSLLQSVILLWLSFCTHSEIPYFFCDLDLVVHLACSDTFLNDMV...IYFATMWSGGSLAGILYSYSKIISSMCAIPSAQEYEVFSTYVSNLSVVSLFYLMYTVVTSMLNPFIYNLMNKDIEGSERDSGREIMTESIILR ...

  7. Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

    Index Scriptorium Estoniae

    Häniläne,, pseud.

    2008-01-01

    Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

  8. Unigene BLAST: CBRC-CFAM-35-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0001 gnl|UG|Cfa#S22760368 PREDICTED: Canis familiaris similar to MAP /microtubule af ... finity-regulating kinase 4 (MAP /microtubule affinity-regulating kinase-like 1) (LO ...

  9. Unigene BLAST: CBRC-CFAM-23-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0012 gnl|UG|Cfa#S22760368 PREDICTED: Canis familiaris similar to MAP /microtubule af ... finity-regulating kinase 4 (MAP /microtubule affinity-regulating kinase-like 1) (LO ...

  10. Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S22760368 PREDICTED: Canis familiaris similar to MAP /microtubule af ... finity-regulating kinase 4 (MAP /microtubule affinity-regulating kinase-like 1) (LO ...

  11. Toxoplasma gondii and Neospora caninum serological status of different canine populations from Uberlândia, Minas Gerais Reatividade sorológica para Toxoplasma gondii e Neospora caninum em diferentes populações caninas na cidade de Uberlândia, MG

    OpenAIRE

    T.W.P. Mineo; D.A.O. Silva; K. Näslund; BJÖRKMAN, C.; UGGLA, A.; Mineo, J. R.

    2004-01-01

    Este trabalho teve como objetivo analisar a ocorrência de anticorpos contra Toxoplasma gondii e Neospora caninum em cães da cidade de Uberlândia, MG. As taxas de reatividade sorológica dos animais frente a esses parasitos foram comparadas em relação à sua origem e condições de vida. Um total de 369 amostras de soro canino foi obtido de três grupos de cães: (A) 213 pacientes do Hospital Veterinário da Universidade Federal de Uberlândia, (B) 62 pacientes de clínicas veterinárias particulares da...

  12. Природні насадження і запаси шипшини собачої (Rosa canina L.) в Закарпатті

    OpenAIRE

    Боднар, Л. М.; Bodnar, L.

    2012-01-01

    The research results of dog rose fruit supply in Volovetsky District of Zakatpatska Region have been first presented. The method of model specimens has been used for determination of productivity. The researches have been conducted with the purpose of rational using of medicinal raw material which is widely used in official medicine.

  13. Morphometric analysis of the thymus of puppies infected with the Snyder Hill Strain of canine distemper virus Análise morfométrica do timo de cães filhotes infectados com a amostra Snyder Hill do vírus de cinomose canina

    Directory of Open Access Journals (Sweden)

    C.M. Alves

    2006-08-01

    Full Text Available The thymic morphometry analysis was used for determining apoptosis and atrophy of the thymus of eight puppies inoculated with canine distemper virus (CDV. Three healthy dogs were used as negative controls. Sections, 5µm thick, were stained by HE and Shorr, and the latter were evaluated by morphometry. CDV nucleoprotein was detected by immunohistochemistry. Morphometric results confirmed lymphoid hypotrophy in CDV inoculated dog thymuses, more stroma, less parenchyma and higher apoptotic index/field than negative control (not inoculated puppies. Apoptosis plays a role in the mechanism of thymus atrophy that develops in canine distemper.Determinaram-se a apoptose e a atrofia no timo de oito cães novos, inoculados experimentalmente com o vírus de cinomose. Três cães saudáveis foram usados como controle negativo. Secções coradas pelo Shorr foram avaliadas por morfometria. A nucleoproteína viral foi detectada por imunoistoquímica. Os resultados morfométricos confirmaram a hipotrofia e mostraram que o timo dos cães inoculados tinha mais estroma, menos parênquima e maior índice apoptótico/campo que o dos animais-controle. Pode-se concluir que a apoptose desempenha importante papel no mecanismo de hipotrofia tímica que se desenvolve na cinomose.

  14. Virus isolation and molecular characterization of canine distemper virus by RT-PCR from a mature dog with multifocal encephalomyelit Isolamento e caracterização molecular do vírus da cinomose canina por RT-PCR a partir de um cão adulto com encefalomielite multifocal

    OpenAIRE

    Alexandre Mendes Amude; Glei dos Anjos Carvalho; Amauri Alcindo Alfieri; Alice Fernandes Alfieri

    2007-01-01

    A case of multifocal distemper encephalomyelitis in a mature dog is described. In the presented case the ante mortem clinical diagnosis of canine distemper virus (CDV) infection could not be ideally performed due to the absence of typical signs of distemper, such as myoclonus and systemic signs accompanying the nervous signs. The definitive diagnosis of distemper encephalomyelitis was only carried out at post mortem through virus isolation in cell culture from fresh central nervous system (CN...

  15. Canine distemper virus infection in a lesser grison (Galictis cuja): first report and virus phylogeny Infecção pelo vírus da cinomose canina em um furão (Galictis cuja): primeiro relato e filogenia viral

    OpenAIRE

    Jane Megid; Teixeira, Carlos R; Adriana Cortez; Heinemann, Marcos B; Antunes, João M.A.P.; Felipe Fornazari; Fabricio B. Rassy; Richtzenhain, Leonardo J

    2013-01-01

    Infectious diseases in wild animals have been increasing as a result of their habitat alterations and closer contact with domestic animals. Canine distemper virus (CDV) has been reported in several species of wild carnivores, presenting a threat to wildlife conservation. We described the first case of canine distemper virus infection in lesser grison (Galictis cuja). A free-ranging individual, with no visible clinical sigs, presented sudden death after one day in captivity. Molecular diagnosi...

  16. Cambios en la presión sanguínea causados por falla renal aguda o crónica, en una población de mascotas caninas de Bogotá D.C. Colombia - Sanguine Pressure Changes Caused By Acute Or Chronic Renal Failure, In Canine Pets Population In Bogotá D.C. Colombia

    Directory of Open Access Journals (Sweden)

    Sánchez Klinge Marta Elena.

    2006-08-01

    Full Text Available .- La insuficiencia renal es señalada como la causa más importante de la hipertensión arterial, ( Ettinger & Feldman 1997. Debido a la hipertensión en insuficiencia renal, se debe medir la misma en todos los perros sospechosos. La determinación de la presión arterial, común en humanos, no lo es en veterinaria, debido a la disposición anatómica de los miembros y a la baja intensidad de los sonidos producidos por la onda de pulso. En la primera fase se emplearon 20 perros, a los cuales se les tomo la presión arterial en tres sitios: arteria humeral, arteria tibiocraneal y arteria coccígea, colococando una manga de presión y escuchando los sonidos del paso de la sangre con un estetoscopio de muy buena resolución y otro de no tan buena resolución, comprobándose que sólo se escuchan con el estetoscopio de buena resolución. Después, se inyecto 0.5 ml de adrenalina para causar un hipertensión pasajera y comprobar los sonidos del paso de la sangre (korokoff, los cuales se escucharon mucho más fuerte y el valor numérico aumento considerablemente; el mejor resultado se obtuvo en la arteria humeral, ya que los sonidos se escuchan más claros. En la segunda fase se tomaron 33 pacientes de diferentes clínicas de Bogota; 15 presentaban Falla Renal Aguda y 18 presentaban Falla Renal Crónica. A dichos pacientes se les confirmar la falla renal, con un examen del BUN y de creatinina, encontrándose azotemia, luego se les tomaba la presión arterial en la arteria humeral encontrandose mayor hipertensión en la Falla renal crónica. The renal inadequacy or renal failure, is pointed out as the cause but important of the arterial hypertension (Ettinger & Feldman 1997. Due to the hypertension in the renal inadequacy, the same one should be measured in all the suspicious dogs. The determination of the arterial pressure, common in human, it is not it in the veterinary one , due to the anatomical disposition of the members and to the drop intensity of the sounds taken place by the pulse wave. In the first phase 20 dogs were used to those which they are taken the arterial tension in three places: artery humeral, artery tibiocraneal and artery coccígea, placing a sleeve of pressure and listening the sounds of the step of it bleeds her with a stethoscope of very good resolution, and another of not so good resolution, being proven that alone they are listened with the stethoscope of good resolution. Then, I inject you 0.5 ml of adrenaline to cause a fleeting hypertension and to check the sounds of the step of the blood (korokoff, which were listened a lot but strong and the value numeric increase considerably; the best result was obtained in the artery humeral, since the sounds were listened but clearer. In the second phase 33 patients of different clinics of Bogotá took; 15 presented sharp renal failure and 18 presented chronicle renal failure. To this patients they were confirmed the renal failure with an exam of the BUN and of creatinina, being azotemia, then they were taken the arterial pressure in the artery humeral being bigger hypertension in the chronicle renal failure.

  17. Cambios en la presión sanguínea causados por falla renal aguda o crónica, en una población de mascotas caninas de Bogotá D.C. Colombia - Sanguine Pressure Changes Caused By Acute Or Chronic Renal Failure, In Canine Pets Population In Bogotá D.C. Colombia

    Directory of Open Access Journals (Sweden)

    Sánchez Klinge Marta Elena

    Full Text Available La insuficiencia renal es señalada como la causa más importante de la hipertensión arterial, ( Ettinger & Feldman 1997. Debido a la hipertensión en insuficiencia renal, se debe medir la misma en todos los perros sospechosos. La determinación de la presión arterial, común en humanos, no lo es en veterinaria, debido a la disposición anatómica de los miembros y a la baja intensidad de los sonidos producidos por la onda de pulso. En la primera fase se emplearon 20 perros, a los cuales se les tomo la presión arterial en tres sitios: arteria humeral, arteria tibiocraneal y arteria coccígea, colococando una manga de presión y escuchando los sonidos del paso de la sangre con un estetoscopio de muy buena resolución y otro de no tan buena resolución, comprobándose que sólo se escuchan con el estetoscopio de buena resolución. Después, se inyecto 0.5 ml de adrenalina para causar un hipertensión pasajera y comprobar los sonidos del paso de la sangre (korokoff, los cuales se escucharon mucho más fuerte y el valor numérico aumento considerablemente; el mejor resultado se obtuvo en la arteria humeral, ya que los sonidos se escuchan más claros. En la segunda fase se tomaron 33 pacientes de diferentes clínicas de Bogota; 15 presentaban Falla Renal Aguda y 18 presentaban Falla Renal Crónica. A dichos pacientes se les confirmar la falla renal, con un examen del BUN y de creatinina, encontrándose azotemia, luego se les tomaba la presión arterial en la arteria humeral encontrandose mayor hipertensión en la Falla renal crónica. The renal inadequacy or renal failure, is pointed out as the cause but important of the arterial hypertension (Ettinger & Feldman 1997. Due to the hypertension in the renal inadequacy, the same one should be measured in all the suspicious dogs. The determination of the arterial pressure, common in human, it is not it in the veterinary one , due to the anatomical disposition of the members and to the drop intensity of the sounds taken place by the pulse wave. In the first phase 20 dogs were used to those which they are taken the arterial tension in three places: artery humeral, artery tibiocraneal and artery coccígea, placing a sleeve of pressure and listening the sounds of the step of it bleeds her with a stethoscope of very good resolution, and another of not so good resolution, being proven that alone they are listened with the stethoscope of good resolution. Then, I inject you 0.5 ml of adrenaline to cause a fleeting hypertension and to check the sounds of the step of the blood (korokoff, which were listened a lot but strong and the value numeric increase considerably; the best result was obtained in the artery humeral, since the sounds were listened but clearer. In the second phase 33 patients of different clinics of Bogotá took; 15 presented sharp renal failure and 18 presented chronicle renal failure. To this patients they were confirmed the renal failure with an exam of the BUN and of creatinina, being azotemia, then they were taken the arterial pressure in the artery humeral being bigger hypertension in the chronicle renal failure.

  18. A new methodology for the improvement of diagnostic immunohistochemistry in canine veterinary pathology: automated system using human monoclonal and polyclonal antibodies Uma nova metodologia para melhora do diagnóstico imunoistoquímico em patologia veterinária canina: sistema automático usando anticorpos humanos monoclonais e policlonais

    Directory of Open Access Journals (Sweden)

    G.D. Cassali

    2001-06-01

    Full Text Available The authors describe their experience with an automated immunohistochemical system applied to canine tissue samples. Twenty human cellular markers specific monoclonal and polyclonal antibodies and two different antigen retrieval methods were used in normal and neoplastic breast tissue, as well as skin samples obtained from female dogs of pure and mixed breeds. The antibodies tested were the most frequently used in human and veterinary medicine studies, employed with diagnostic purposes in breast pathology, as well as in cancer research. Most of them may be used to study other normal and abnormal tissues and included cytokeratins, progesterone receptor, c-erbB2, p53, MIB-1, PCNA, EMA, vimentin, desmin, alpha-actin, S-100, pan-cadherin, and E-cadherin. The results demonstrated that using an automated staining system it is possible to use different human markers in veterinary pathology. The advantages of automated immunohistochemistry are improved quality, reproducibility, speed, and standardisation.Os autores descrevem sua experiência com um sistema automático de imunoistoquímica aplicada à amostras de tecido canino. Foram utilizados 20 anticorpos humanos monoclonais e policlonais e dois diferentes métodos de recuperação antigênica em tecido mamário normal e neoplásico, bem como em amostras de pele obtidas de cadelas. Os anticorpos testados estão entre os mais usados em estudos de medicina humana e veterinária, com finalidade de diagnóstico em patologia mamária, bem como na pesquisa do câncer. Muitos deles podem ser usados para estudar outros tecidos normais e com alterações e incluem citoqueratinas, receptor de progesterona, c-erbB2, p53, MIB-1, PCNA, EMA, vimentina, desmina, alfa-actina, S-100, pan-caderina e E-caderina. Os resultados demonstraram que usando um sistema automático de imunoistoquímica é possível usar diferentes marcadores humanos em patologia veterinária. As vantagens da imunoistoquímica automatizada são melhora da qualidade, reprodutibilidade, rapidez e padronização.

  19. Níveis de anticorpos contra o vírus da cinomose canina e o parvovírus canino em cães não vacinados e vacinados Antibodies levels against canine distemper virus and canine parvovirus in vaccinated and unvaccinated dogs

    Directory of Open Access Journals (Sweden)

    R. Hass

    2008-02-01

    Full Text Available Antibody titres to canine distemper virus (CDV and canine parvovirus (CPV were measured in 132 dogs: 80 had been vaccinated at least once, 22 had not been vaccinated, and 30 had unknown vaccination history. Serum antibody titers were measured by means of serum neutralization (CDV or hemagglutination inhibition (CPV. Serum CDV titers >20 and serum CPV titers >80 were considered protective. Protective antibodies to CDV were present in 40.1% of the population: 39.8% of the vaccinated dogs, 31.8% unvaccinated, and in 46.6% of the dogs with unknown vaccination history. Protective antibodies to CPV were present in 90.9% of the dogs: 93.7% of the vaccinated dogs, 90.9% of the unvaccinated, and 83.3% of the dogs with unknown vaccination history.

  20. Ocorrência de apoptose em leucócitos no esfregaço de sangue periférico e em sincícios na infecção in vivo pelo vírus da cinomose canina

    Directory of Open Access Journals (Sweden)

    Moro L.

    2003-01-01

    Full Text Available The aim of this paper is to report the occurrence of apoptosis in peripheral blood leukocytes and in syncytia induced by experimental infection of dogs with canine distemper virus. Blood was collected from nine puppies that were inoculated with the Snyder Hill strain of CDV, and stained with May Grunwaldt-Giemsa. Dogs were necropsied and retropharyngeal lymph nodes were collected and processed for paraffin embedding. Five micrometers thick sections were stained with hematoxylin-eosin and methyl green pyronin. Other sections were submitted to TUNEL reaction for in situ detection of apoptosis, and immunohistochemistry to detect CDV antigen. Immunohistochemistry confirmed the presence of viral antigen. Syncytia were present in all retropharyngeal lymph nodes. Several syncytia contained apoptotic nuclei as detected by hematoxylin-eosin and methyl green pyronin stains. Apoptotic nuclei were labeled inside syncytia by the TUNEL reaction. Blood smear analyses indicated higher proportion of apoptotic leukocytes in the peripheral blood of infected dogs.