WorldWideScience

Sample records for caninas cannis familiaris

  1. Canny edge-based deformable image registration

    Science.gov (United States)

    Kearney, Vasant; Huang, Yihui; Mao, Weihua; Yuan, Baohong; Tang, Liping

    2017-02-01

    This work focuses on developing a 2D Canny edge-based deformable image registration (Canny DIR) algorithm to register in vivo white light images taken at various time points. This method uses a sparse interpolation deformation algorithm to sparsely register regions of the image with strong edge information. A stability criterion is enforced which removes regions of edges that do not deform in a smooth uniform manner. Using a synthetic mouse surface ground truth model, the accuracy of the Canny DIR algorithm was evaluated under axial rotation in the presence of deformation. The accuracy was also tested using fluorescent dye injections, which were then used for gamma analysis to establish a second ground truth. The results indicate that the Canny DIR algorithm performs better than rigid registration, intensity corrected Demons, and distinctive features for all evaluation matrices and ground truth scenarios. In conclusion Canny DIR performs well in the presence of the unique lighting and shading variations associated with white-light-based image registration.

  2. An Improved Canny Algorithm with Adaptive Threshold Selection

    Directory of Open Access Journals (Sweden)

    Wang Yupeng

    2015-01-01

    Full Text Available Canny is a classic algorithm of edge detection which has been widely applied in various fields of image processing for years. However, the algorithm has some defects. The most serious defect is that the traditional canny algorithm can’t set threshold adaptively. If the threshold set manually is not accurate, it will seriously affect the quality of the algorithm to detect the edge. This makes the poor adaptability of the algorithm. This paper proposes a method which combines maximum entropy method with Otsu method to determine the high and low threshold of Canny algorithm. Experiments show that the modified algorithm has stronger robustness than traditional method. For the images which have complex distributions of grey level histogram, the modified algorithm has better performance.

  3. A distributed Canny edge detector: algorithm and FPGA implementation.

    Science.gov (United States)

    Xu, Qian; Varadarajan, Srenivas; Chakrabarti, Chaitali; Karam, Lina J

    2014-07-01

    The Canny edge detector is one of the most widely used edge detection algorithms due to its superior performance. Unfortunately, not only is it computationally more intensive as compared with other edge detection algorithms, but it also has a higher latency because it is based on frame-level statistics. In this paper, we propose a mechanism to implement the Canny algorithm at the block level without any loss in edge detection performance compared with the original frame-level Canny algorithm. Directly applying the original Canny algorithm at the block-level leads to excessive edges in smooth regions and to loss of significant edges in high-detailed regions since the original Canny computes the high and low thresholds based on the frame-level statistics. To solve this problem, we present a distributed Canny edge detection algorithm that adaptively computes the edge detection thresholds based on the block type and the local distribution of the gradients in the image block. In addition, the new algorithm uses a nonuniform gradient magnitude histogram to compute block-based hysteresis thresholds. The resulting block-based algorithm has a significantly reduced latency and can be easily integrated with other block-based image codecs. It is capable of supporting fast edge detection of images and videos with high resolutions, including full-HD since the latency is now a function of the block size instead of the frame size. In addition, quantitative conformance evaluations and subjective tests show that the edge detection performance of the proposed algorithm is better than the original frame-based algorithm, especially when noise is present in the images. Finally, this algorithm is implemented using a 32 computing engine architecture and is synthesized on the Xilinx Virtex-5 FPGA. The synthesized architecture takes only 0.721 ms (including the SRAM READ/WRITE time and the computation time) to detect edges of 512 × 512 images in the USC SIPI database when clocked at 100

  4. Implementation of Magnified Edge Detection using Fuzzy-Canny Logic

    Directory of Open Access Journals (Sweden)

    Hitesh Kapoor

    2012-06-01

    Full Text Available In this paper edge detection with fuzzy using canny is explained. Two basic phases of edge detection i.e. Global contrast intensification and local fuzzy edge detection are first explained and is then merged with Canny operator for better results specially for noisy images and low contrast images. The software used for the observation of edges in digital images is by using MATLAB software (ToolBox because of its efficiency and convenience for handling images for Image Processing. Initially, first-order linear filters constitute the algorithms most widely applied to edge detection in digital images but they don’t allow good results to be obtained where the contrast varies a lot, due to non-uniform lighting, as it happens during acquisition of most part of natural images

  5. Improvement and implementation for Canny edge detection algorithm

    Science.gov (United States)

    Yang, Tao; Qiu, Yue-hong

    2015-07-01

    Edge detection is necessary for image segmentation and pattern recognition. In this paper, an improved Canny edge detection approach is proposed due to the defect of traditional algorithm. A modified bilateral filter with a compensation function based on pixel intensity similarity judgment was used to smooth image instead of Gaussian filter, which could preserve edge feature and remove noise effectively. In order to solve the problems of sensitivity to the noise in gradient calculating, the algorithm used 4 directions gradient templates. Finally, Otsu algorithm adaptively obtain the dual-threshold. All of the algorithm simulated with OpenCV 2.4.0 library in the environments of vs2010, and through the experimental analysis, the improved algorithm has been proved to detect edge details more effectively and with more adaptability.

  6. Age McCanni büroo = Offices of Age McCann

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Rotermanni 8 asuva Age McCanni büroo sisekujundusest. Sisekujunduse autorid: sisearhitekt Kerli Valk (Kukuhaus OÜ) ja arhitekt Tomomi Hayashi (HG Arhitektuur OÜ), nende tähtsamate tööde loetelu

  7. CISTICERCOSE (Cysticercus cellulosae CANINA GENERALIZADA

    Directory of Open Access Journals (Sweden)

    Eulógio Carlos Queiroz de Carvalho

    2006-10-01

    Full Text Available O complexo teníase-cisticercose tem enorme repercussão na saúde pública, não só no Brasil, mas também em várias regiões do mundo consideradas em desenvolvimento, corroborando, para tal, o baixo nível socioeconômico e cultural da população. O exame pos mortem de um cão errante (Canis familiaris sem história clínica, adulto, cedido para estudo às Faculdades Integradas do Planalto Central(FIPLAC, revelou lesões císticas disseminadas por todas as musculaturas estriadas cardíaca e esquelética. As lesões, que impressionavam pelo grande número, eram do estroma, continham líquido sob tensão e, transparentes, deixavam ver uma formação interna e opaca. Num exame microscópico “a fresco”, e por inclusão em parafina e colo-ração pela hematoxilina e eosina, essa formação possibilitou a caracterização de uma estrutura parasitária com quatro ventosas e uma coroa dupla de ganchos, estrutura própria do escólice do Cysticercus cellulosae, forma larvar da Taeniasolium. Embora um comprometimento de sistema nervoso tenha sido observado por outros autores, não se observaram tais lesões neste trabalho. PALAVRAS-CHAVE: Cysticercus cellulosae, cisticercose, canino, saúde publica.

  8. A Facial Expression Classification System Integrating Canny, Principal Component Analysis and Artificial Neural Network

    CERN Document Server

    Thai, Le Hoang; Hai, Tran Son

    2011-01-01

    Facial Expression Classification is an interesting research problem in recent years. There are a lot of methods to solve this problem. In this research, we propose a novel approach using Canny, Principal Component Analysis (PCA) and Artificial Neural Network. Firstly, in preprocessing phase, we use Canny for local region detection of facial images. Then each of local region's features will be presented based on Principal Component Analysis (PCA). Finally, using Artificial Neural Network (ANN)applies for Facial Expression Classification. We apply our proposal method (Canny_PCA_ANN) for recognition of six basic facial expressions on JAFFE database consisting 213 images posed by 10 Japanese female models. The experimental result shows the feasibility of our proposal method.

  9. ANTIMICROBIAL ACTIVITY OF ROSA CANINA FLOWERS AGAINST SELECTED MICROORGANISMS

    Directory of Open Access Journals (Sweden)

    Katarína Rovná

    2015-02-01

    Full Text Available Rosa canina flowers were screened against various plant pathogenic microbial strains to study the antimicrobial properties of the plant. Ethanolic and methanolic extracts of flowers were screened applying agar well diffusion method against two Gram-negative bacteria including Escherichia coli CCM 3988 and Pseudomonas aeruginosa CCM 1960 and three microscopic filamentous fungi strains Aspergillus niger, Fusarium culmorum and Alternaria alternata, respectively. The best antimicrobial effect of ethanolic extract of Rosa canina flowers was found against Pseudomonas aeruginosa and the best antimicrobial effect of methanolic extract of Rosa canina flowers was found against Escherichia coli.

  10. SEGMENTATION OF CT SCAN LUMBAR SPINE IMAGE USING MEDIAN FILTER AND CANNY EDGE DETECTION ALGORITHM

    Directory of Open Access Journals (Sweden)

    E.Punarselvam

    2013-09-01

    Full Text Available The lumbar vertebrae are the largest segments of the movable part of the vertebral column, they are elected L1 to L5, starting at the top. The spinal column, more commonly called the backbone, is made up primarily of vertebrae discs, and the spinal cord. Acting as a communication conduit for the brain, signals are transmitted and received through the spinal cord. It is otherwise known as vertebralcolumn consists of 24 separate bony vertebrae together with 5 fused vertebrae, it is the unique interaction between the solid and fluid components that provides the disc strength and flexibility required to bear loading of the lumbar spine. In this work the Segmentation of Spine Image using Median Filter and Canny Edge Detection Algorithm between lumbar spine CT scan spine disc image. The result shows thatthe canny edge detection algorithm produced better result when compared other edge detection algorithm. Finding the correct boundary in a noisy image of spine disc is still a difficult one. To find outabsolute edges from noisy images, the comparative result can be verified and validated with the standard medical values. The result shows that the canny edge detection algorithm performs well and produced a solution very nearer to the optimal solution. This method is vigorous for all kinds of noisy images.

  11. Epidemiología de la rabia canina en colombia

    OpenAIRE

    2011-01-01

    Objetivo Se realizó un estudio epidemiológico ecológico para describir la tendencia de la rabia canina desde 1976-2006 y explorar posibles factores relacionados con su presentación en Colombia, Metodología Las variables fueron recolectadas mediante un cuestionario aplicado a los responsables del programa en cada departamento y  mediante fuentes de información oficiales nacionales. Se calculó la incidencia de la rabia canina entre 2001-2006. Se emplearon razones de tasas de incidencia y prueba...

  12. Brazilian canine hepatozoonosis Hepatozoonose canina brasileira

    Directory of Open Access Journals (Sweden)

    Lucia Helena O'Dwyer

    2011-09-01

    Full Text Available The genus Hepatozoon includes hundreds of species that infect birds, reptiles, amphibians and mammals, in all continents with tropical and subtropical climates. Two species have been described in domestic dogs: H. canis, reported in Europe, Asia, Africa, South America and the United States; and H. americanum, which so far has only been diagnosed in the United States. In Brazil, the only species found infecting dogs is H. canis. The objective of this review was to detail some aspects of canine hepatozoonosis, caused by H. canis, and the main points of its biology, transmission, pathogenicity, symptoms, epidemiology and diagnostic methods, with emphasis on research developed in Brazil.O gênero Hepatozoon compreende centenas de espécies que infectam aves, répteis, anfíbios e mamíferos, em todos os continentes de clima tropical e subtropical. No cão doméstico duas espécies são descritas, H. canis e H. americanum; a primeira presente na Europa, Ásia, África, América do Sul e nos Estados Unidos da América do Norte (EUA, e a segunda, diagnosticada até o momento somente nos EUA. No Brasil, a espécie que infecta o cão foi caracterizada como H. canis. Esta revisão objetiva detalhar alguns aspectos da hepatozoose canina, causada pelo H. canis e principais pontos de biologia, transmissão, patogenia e sintomas, epidemiologia e métodos de diagnóstico, enfatizando as pesquisas desenvolvidas no Brasil.

  13. Efficient edge-guided full-waveform inversion by Canny edge detection and bilateral filtering algorithms

    Science.gov (United States)

    Xiang, Shiming; Zhang, Haijiang

    2016-11-01

    It is known full-waveform inversion (FWI) is generally ill-conditioned and various strategies including pre-conditioning and regularizing the inversion system have been proposed to obtain a reliable estimation of the velocity model. Here, we propose a new edge-guided strategy for FWI in frequency domain to efficiently and reliably estimate velocity models with structures of the size similar to the seismic wavelength. The edges of the velocity model at the current iteration are first detected by the Canny edge detection algorithm that is widely used in image processing. Then, the detected edges are used for guiding the calculation of FWI gradient as well as enforcing edge-preserving total variation (TV) regularization for next iteration of FWI. Bilateral filtering is further applied to remove noise but keep edges of the FWI gradient. The proposed edge-guided FWI in the frequency domain with edge-guided TV regularization and bilateral filtering is designed to preserve model edges that are recovered from previous iterations as well as from lower frequency waveforms when FWI is conducted from lower to higher frequencies. The new FWI method is validated using the complex Marmousi model that contains several steeply dipping fault zones and hundreds of horizons. Compared to FWI without edge guidance, our proposed edge-guided FWI recovers velocity model anomalies and edges much better. Unlike previous image-guided FWI or edge-guided TV regularization strategies, our method does not require migrating seismic data, thus is more efficient for real applications.

  14. Rosa canina as an adjunctive treatment of asthma: A hypothesis

    Directory of Open Access Journals (Sweden)

    Samin Hamidi

    2015-01-01

    Full Text Available Asthma is one of the most common chronic disorders and about 7% of the US population suffers from asthma. Initial response to allergy is associated with mediators like histamine, prostaglandin (PG D2 and leukotriene (LT C4. In asthmatic patients, 5-lipo-oxygenase (5-LO pathway produces more LTC4 than the healthy people. Also, pro-inflammatory factors like interleukin (IL-1, IL-6 and Tumor Necrosis Factor (TNF-α play a remarkable role in bronchoconstriction. The common asthma medications are associated with a number of unwanted side effects, especially throughout long term treatment. Herbal medication is an alternative treatment for asthma and the plants are rich sources of antioxidants that intensively reduce the activity of free radicals. Among several herbs, Rosa canina (RC is a potent anti-inflammatory remedy which contains a number of well-known antioxidants including vitamin C, quercetin, hesperidin, rutin and some other therapeutic compounds. The aim of this study was to review the scientific evidences supporting the probable influence of Rosa canina on asthma. Keywords: Asthma; Rosa canina; Anti-inflammatory

  15. Rabia canina en san Juan de Lurigancho y en Jicamarca

    OpenAIRE

    2004-01-01

    Hasta la tercera semana de noviembre se han confirmado cuatro casos de rabia canina en la DISA Lima Norte, el último caso se presentó el 20 de noviembre en la granja porcina «Pradera del Paraíso» en el distrito de San Juan de Lurigancho (SJL), perteneciente a la referida Dirección de Salud. Dicho caso sucedió en momentos que un trabajador de la granja trató de separar la pelea entre los perros guardianes de la granja y un perro de origen desconocido, siendo finalmente mordido en una de...

  16. 基于改进Canny特征点的SIFT算法%Improved SIFT algorithm based on Canny feature points

    Institute of Scientific and Technical Information of China (English)

    杨秋菊; 肖雪梅

    2011-01-01

    After the analysis of traditional SIFT algorithm, a new SIFT algorithm based on improving the Canny feature points is proposed. The algorithm firstly detects out candidate keypoints by SIFT algorithm, then finds out the edge points of image using Canny algorithm. It would remove some candidate keypoints by the analysis whether the coordinates are equal between candidate keypoints and edge points. The experimental results show that the improved SIFT algorithm can effectively remove the edge response points, further improve the ability of anti-noise for SIFT features, and display a more stability than the traditional SIFT algorithm.%在分析了传统SIFT算法的基础上,提出了一种基于改进Canny特征点的SIFT算法.该方法先用SIFT算法检测出候选关键点,再利用Canny边缘检测算法检测出图像的边缘点,通过比较生成的候选关键点和边缘点的坐标是否相等,从而判断是否去除候选关键点.实验结果表明,与传统SIFT算法比较,该方法可以有效地去除DOG算子生成的边缘响应点,进一步提高SIFT特征点的抗噪声能力,增强SIFT算法的稳定性.

  17. CBMIR: SHAPE-BASED IMAGE RETRIEVAL USING CANNY EDGE DETECTION AND K-MEANS CLUSTERING ALGORITHMS FOR MEDICAL IMAGES

    Directory of Open Access Journals (Sweden)

    B.Ramamurthy,

    2011-03-01

    Full Text Available The accumulation of large collections of digital images has created the need for efficient and intelligent schemes for classifying and retrieval of images. In this work, “CBMIR: Shape-Based Image Retrieval Using Canny Edge Detection and K-Means Clustering Algorithms for Medical Images”, has been developed to retrieve the medical images from huge volume of medical databases. This requires the preprocessing, feature extraction, classification, retrieval and indexing steps in order to develop an efficient medical image retrieval system. In this work, for preprocessing step, the image segmentation method has been carried out, for feature extraction, basic shape feature has been extracted using canny edge detection algorithm, and for classification, K-means classification algorithm has been used. For retrieval of images, Euclidian distance method values are calculated between query image and database images. The goal of this work is to provide a medical image retrieval system for further use of medical diagnosis purpose in the field of medical domain.

  18. Estudio retrospectivo de caracterización de la hepatozoonosis canina en Buenos Aires

    OpenAIRE

    Scodellaro, Carla Floriana

    2015-01-01

    La hepatozoonosis canina es una enfermedad parasitaria causada por protozoarios del género Hepatozoon (Apicomplexa, Eucoccida) y trasmitida por garrapatas. En Argentina, esta enfermedad fue descripta por primera vez en 1999 y recién en 2007 fue identificado Hepatozoon canis como el agente etiológico. El objetivo de este trabajo fue caracterizar la hepatozoonosis en perros del sur del Gran Buenos Aires. Para ello, se analizaron los hemogramas de 100123 muestras de sangre canina remitidas entre...

  19. Hepatoprotective effect of Rosa canina fruit extract against carbon tetrachloride induced hepatotoxicity in rat

    Directory of Open Access Journals (Sweden)

    Heibatollah Sadeghi

    2016-03-01

    Full Text Available Objective: The present study was conducted to investigate the hepatoprotective activity of hydro-ethanolic fruit extract of Rosa canina (R. canina against carbon tetrachloride (CCl4-induced hepatotoxicity in rats. Methods: Male Wistar albino rats were randomly divided into six groups of 8 animals of each, including control, toxic (CCl4, R. canina 250, 500, and 750 mg/kg + CCl4 and R. canina 750 mg/kg alone. R. canina (p.o., daily and CCl4 (1 ml/kg twice a week, 50% v/v in olive oil, i.p. were administered to animals for six weeks. Serum analysis was performed to assay the levels of aspartate aminotransferase (AST, alanine amino transaminase (ALT, alkaline phosphatase (ALP, albumin (ALB, total protein (TP and malondialdehyde (MDA. Biochemical observations were also supplemented with histopathological examination (haematoxylin and eosin staining of liver section.Results: Hepatotoxicity was evidenced by considerable increase in serum levels of AST, ALT, ALP, and lipid peroxidation (MDA and decrease in levels of ALB and TP. Injection of CCL4 also induced congestion in central vein, and lymphocyte infiltration. Treatment with hydro-alcoholic fruit extract of R. canina at doses of 500 and 750 mg/kg significantly reduced CCl4-elevated levels of ALT, AST, ALP and MDA (p

  20. CHARACTERIZATION OF ENDOPHYTIC MICROFLORA OF ROSA CANINA FRUITS

    Directory of Open Access Journals (Sweden)

    Katarína Rovná

    2015-02-01

    Full Text Available There aren’t a lot of studies about the bacterial communities associated with the Rosa canina and the aim of this study was to characterize endophytic bacteria from fruit of Rosa canina. The fruits of R. canina, which is growing wild in Slovakia, were collected in May 2013 from four locations: Nitra-Zobor, Vrbové-Baraní dvor, Rišňovce, Modra pažiť, Slovakia. Microbiological analyses were conducted by use of standard microbiological methods by spreading of fruits homogenates onto agar plate. Total viable count and mesophilic anaerobic sporulating bacteria were determined on Plate Count Agar after incubation for 2 days at 37 °C. Pseudomonas aeruginosa enumeration was carried out after incubation of Pseudomonas Isolation agar at 48 h at 35 °C. For members of the family Enterobacteriaceae (45 °C Violet Red Bile Glucose agar were used and incubation was carried out for 24 h at 37 °C. For determinations of fungal colonies Malt agar and Czapek-Dox agar were inoculated using the spread-plate technique and incubated at 25 °C for 5 days. The yeasts were grown in Glucose Yeast Peptone agar (aerobiosis at 25 °C during 72 hours. The total viable count of fruits ranged from 4.07 log cfu.g-1 in Rišňovce to 4.84 log cfu.g-1 in Vrbové Baraní dvor. Number of mesophilic anaerobic sporulating bacteria ranged from 4.09 in Vrbové Baraní dvor to 4.82 log cfu.g-1 in Modrá pažiť. Number of Pseudomonas aeruginosa count ranged from 2.00 in Nitra Zobor and Vrbové Baraní dvor to 3.94 log cfu.g-1 in Modrá pažiť. In our study the number of Enterobacteriaceae genera ranged from 3.38 in Nitra Zobor to 4.25 log cfu.g-1 in Vrbové Baraní dvor. Number of yeasts ranged from 3.36 in Vrbové Baraní dvor to 3.85 log cfu.g-1 in Modrá pažiť. Number of microscopic filamentous fungi ranged from 2.60 in Modrá Pažiť to 3.52 log cfu.g-1 in Nitra Zobor. Our findings indicate that Rose plant is naturally associated with a variety of endophytic microorganisms

  1. Babesiose canina no Distrito de Bragança

    OpenAIRE

    Rodrigues, Filipa Cristina Teixeira de Sousa

    2015-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária, Ciências Veterinárias A babesiose canina (ou piroplasmose) é causada por protozoários transmitidos por carraças e afeta cães em muitas partes do mundo. As duas principais espécies reconhecidas como agentes da doença são Babesia canis e Babesia gibsoni, que correspondem respetivamente a formas intraeritrocitárias (ou piroplasmas) grandes (3-5 μm) e pequenas (0,5-2,5 μm). As espécies B. canis e Babesia vogeli, anteriormente considera...

  2. Rose hip (Rosa canina L: A functional food perspective

    Directory of Open Access Journals (Sweden)

    Cui Fan

    2014-12-01

    Full Text Available Rose hip (Rosa canina L. is the pseudo-fruit of the rose plant, which is widely known as a valuable source of polyphenols and vitamin C. Both in vivo and in vitro studies have demonstrated that this fruit exhibits anti-inflammatory, antioxidant, and antiobesogenic activities. The health benefits of Rose hip (RH have been attributed to its wide range of bioactive compounds including the anti-inflammatory galactolipid: (2S-1,2-di-O-[(9Z,12Z,15Z-octadeca-9,12,15-trienoyl]-3-O-β-D galactopyranosyl glycerol (GOPO, vitamin C, phenolics, lycopene, lutein, zeaxanthin, and other carotenoids. As cyclooxygenase inhibitors, RH compounds may reduce the risk of cancer, heart disease, and various inflammatory conditions. The aim of this review is to present an overview of the functional, medical, and physiological properties of RH.

  3. Gestación extrauterina canina: relato de un caso

    OpenAIRE

    C. A. Oviedo; V. M. Molina

    2013-01-01

    Se reporta un caso de gestación extrauterina en una hembra canina de raza Pinscher dedos años de edad, la cual fue remitida al Centro de Medicina Veterinaria y Zootecnia dela Universidad CES (Medellín, Colombia) por presentar un cuadro de descarga vaginalde color oscuro; a la evaluación se confirmó gestación de 42 días. En la imagen radiográficase constató presencia de abundante material gaseoso y en la ecografía, ausenciade fetocardia y disminución de líquido amniótico. Se realizó ovariohist...

  4. AVALIAÇÃO DE INICIADORES E PROTOCOLO PARA O DIAGNÓSTICO DA PANCITOPENIA TROPICAL CANINA POR PCR

    Directory of Open Access Journals (Sweden)

    Daniel C. L. Linhares

    2006-10-01

    Full Text Available Este trabalho foi desenvolvido com o objetivo de padronizar um protocolo para a reação em cadeia da polimerase (PCR e selecionar oligonucleotídeos iniciadores para a detecção específica de Ehrlichia canis, em uma única etapa de reação. Inicialmente foram obtidas seqüências depositadas no Genbank, referentes ao gene que codifica o 16S rRNA das espécies E. canis (número de acesso = AF162860, E. ewingii (U96436, E. platys (AF1567844, E. chaffeensis, (U86665, E. phagocytophila genogrupo (U02521, E. bovis (AF294789 e E. risticii (M21290, as quais foram submetidas ao alinhamento genético para a construção dos iniciadores. Do alinhamento foi selecionado, a partir de uma região semiconservada, um iniciador específico para E. canis, designado EBR1 (5’-cctctggctataggaaattg- 3’ e, de uma região conservada, um iniciador genérico EBR5 (5’-ggagtgcttaacgcgttag- 3’. Paralelamente foram obtidas amostras de sangue de dez cães que apresentavam infecção aguda por E. canis, confirmado pela presença de mórulas intracitoplasmáticas, características da riquétsia, em células mononucleares sangüíneas. O DNA genômico extraído dessas amostras foi utilizado para a avaliação da reação de PCR, empregando-se um protocolo adaptado de outros autores e o par de oligos EBR1/EBR5, selecionado neste trabalho. A reação de PCR apresentou resultados positivos para os 10 isolados de E. canis, amplificando o fragmento esperado de 765 pares de bases do gene 16S rRNA. Resultados negativos verificados nas reações de PCR para amostras de DNA genômico de Babesia canis, Hepatozoon canis, Haemobartonella sp., Trypanosoma evansi e do hospedeiro (Canis familiaris livre de infecção indicaram a segurança do método quanto à especificidade para a discriminação de E. canis. PALAVRAS-CHAVE: Cães, Ehrlichia canis, erliquiose canina, hemoparasitose, reação em cadeia da polimerase

  5. Canine atopic dermatitis / Dermatite atópica canina

    Directory of Open Access Journals (Sweden)

    Thalita da Costa Teles

    2008-08-01

    Full Text Available Canine Atopic Dermatitis is a skin disease of genetic origin. The affected dog becomes sensible to antigens presents in the environment, developing a severe alergic, pruriginous reaction, which intervenes in the quality of life of the patient. Because of the genetic character, that is an illness that in most of the times has no cure, just control. The treatment in general is lifetime. Thus, some used drugs, for example the corticosteroides, might cause collateral effects when used for a long time, and might decrease the lifetime of the animals. By this way, the owner of the dog with atopia, must know about the complications of the disease, and occasional return of the clinical signs during the period of treatment. Therefore, this article has an objective of a review about Canine Atopic Dermatitis that is an increasing problem in the small animal practice.A Dermatite Atópica Canina é uma dermatopatia de origem genética. Os cães acometidos tornam-se sensíveis aos antígenos presentes no meio ambiente, desenvolvendo grave reação alérgica, pruriginosa, que interferem na qualidade de vida do paciente. Devido ao seu caráter genético, esta é uma doença que na maioria das vezes não tem cura, apenas controle. O tratamento em geral é vitalício. Assim sendo, algumas drogas utilizadas, a exemplo dos corticosteróides, podem causar efeitos colaterais que em longo prazo, são capazes de diminuir o período de vida do animal. Desta maneira, o proprietário do cão portador de atopia, precisa ser esclarecido em relação às complicações e provável recidiva dos sinais clínicos, durante o período de tratamento. Portanto, presente artigo tem como objetivo uma revisão sobre Dermatite Atópica Canina, que está se tornando um problema crescente na clínica de pequenos animais.

  6. Implemention and optimization of Canny operator on DSP%Canny算子在DSP上的实现及优化

    Institute of Scientific and Technical Information of China (English)

    徐克强; 梁光明; 刘任任; 王职军; 谢俊

    2014-01-01

    In order to realise the quick image segmentation in the DSP platform,the Canny detector theory is analyzed in detail. The arithmetic transplant was implemented in combition with TI DSP TMS320C6678 processor properties. Aiming at data interaction with the images in external memory,the past mode that the images were accessed according to gray values one by one was improved. The vectorized packed data was designed for dealing with Gaussian filtering to improve the parallel operation, and the accessing method of wide memory in the process of gradient compution and the threshold value calculation was adopted to improve the read-write efficiency of external memory. The result indicates that the optimization method designed in this paper can improve the velocity of Canny operator under the condition of not changing the segmentation result,and can provide a reference for the engineers to carry out arithmetic transplant and optimization on the DSP platform.%为了在DSP平台实现细胞图像快速分割,详细分析Canny算子原理,结合TI DSP TMS320C6678处理器特性,实现了算法移植。针对与外部存储器图像数据交互,改变以往对图像逐灰度值进行访问的方式,设计了矢量化数据打包方法处理高斯滤波来提高并行运算。且在梯度计算、阈值计算过程中,采用宽存储器访问方法提高读写外部存储器效率。结果表明设计的优化方法在不改变分割效果前提下改善了算子速度,可为工程人员在DSP平台进行算法移植与优化提供借鉴。

  7. Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.)

    DEFF Research Database (Denmark)

    Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise

    2011-01-01

    A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis...... and mainly to involve infiltration of the synovial membrane by macrophages. Therefore, the immunomodulatory effect of standardized rose hip powder of Rosa canina L. was investigated and active principles isolated using the Mono Mac 6 cell line as a model for human macrophages. Treatment of Mono Mac 6 cells...

  8. Obesidad canina: repercusiones clínicas del entorno obesogénico

    OpenAIRE

    Suárez Ramírez, Lourdes

    2015-01-01

    Programa de Doctorado en Clínica e Investigación Terapéutica [ES]En relación a otros factores que sin lugar a dudas contribuye de manera significativa a la sobrecarga ponderal canina, son los conocimientos que tienen los propietarios a cerca de la nutrición canina así como los hábitos dietéticos y saludables, donde quedó demostrado que los propietarios de perros no obesos, tienen más interés acerca de la nutrición y salud de su...

  9. High penetrance of a pan-canina type rDNA family in intersection Rosa hybrids suggests strong selection of bivalent chromosomes in the section Caninae.

    Science.gov (United States)

    Crhak Khaitova, Lucie; Werlemark, Gun; Kovarikova, Alena; Nybom, Hilde; Kovarik, Ales

    2014-01-01

    All dogroses (Rosa sect. Caninae) are characterized by the peculiar canina meiosis in which genetic material is unevenly distributed between female and male gametes. The pan-canina rDNA family (termed beta) appears to be conserved in all dogroses analyzed so far. Here, we have studied rDNAs in experimental hybrids obtained from open pollination of F1 plants derived from 2 independent intersectional crosses between the pentaploid dogrose species (2n = 5x = 35) Rosa rubiginosa as female parent (producing 4x egg cells due to the unique asymmetrical canina meiosis) and the tetraploid (2n = 4x = 28) garden rose R. hybrida 'André Brichet' as male parent (producing 2x pollen after normal meiosis). We analyzed the structure of rDNA units by molecular methods [CAPS and extensive sequencing of internal transcribed spacers (ITS)] and determined the number of loci on chromosomes by FISH. FISH showed that R. rubiginosa and 'André Brichet' harbored 5 and 4 highly heteromorphic rDNA loci, respectively. In the second generation of hybrid lines, we observed a reduced number of loci (4 and 5 instead of the expected 6). In R. rubiginosa and 'André Brichet', 2-3 major ITS types were found which is consistent with a weak homogenization pressure maintaining high diversity of ITS types in this genus. In contrast to expectation (the null hypothesis of Mendelian inheritance of ITS families), we observed reduced ITS diversity in some individuals of the second generation which might derive from self-fertilization or from a backcross to R. rubiginosa. In these individuals, the pan-canina beta family appeared to be markedly enriched, while the paternal families were lost or diminished in copies. Although the mechanism of biased meiotic transmission of certain rDNA types is currently unknown, we speculate that the bivalent-forming chromosomes carrying the beta rDNA family exhibit extraordinary pairing efficiency and/or are subjected to strong selection in Caninae polyploids.

  10. GESTACIÓN EXTRAUTERINA CANINA: RELATO DE UN CASO

    Directory of Open Access Journals (Sweden)

    C. A. Oviedo

    2013-01-01

    Full Text Available Se reporta un caso de gestación extrauterina en una hembra canina de raza Pinscher de dos años de edad, la cual fue remitida al Centro de Medicina Veterinaria y Zootecnia de la Universidad CES (Medellín, Colombia por presentar un cuadro de descarga vaginal de color oscuro; a la evaluación se confirmó gestación de 42 días. En la imagen radiográfica se constató presencia de abundante material gaseoso y en la ecografía, ausencia de fetocardia y disminución de líquido amniótico. Se realizó ovariohisterectomía que permitió evidenciar un cuadro de gestación extrauterina con fetos en cavidad abdominal. El artículo reporta un cuadro gineco-obstétrico poco frecuente y descrito por primera vez en Colombia.

  11. α-Glucosidase Inhibitors from Fruits of Rosa canina L.

    Directory of Open Access Journals (Sweden)

    Behvar Asghari

    2015-04-01

    Full Text Available As part of ongoing project on screening plants used in Iranian folk medicine to treatment of diabetes, α-glucosidase inhibition activities of Rosa canina extracts have been tested. The acetone extract of the plant exhibited significant inhibition with IC 50 value of 0.3 µg/ml. The enzyme based assay guided fractionation of the acetone extract led to the isolation of daucosterol (1 and D-glucono-1,4-lactone (2, as highly active α-glucosidase inhibitors. Their structures were determined by 1H- and 13C-NMR spectroscopic evidences. The IC 50 values of daucosterol and D-glucono-1,4-lactone on yeast α-glucosidase were 13.3 and 6.5 µM, respectively, while IC 50 of acarbose was 16.1 µM, as a positive control. The Lineweaver-Burk plots analysis elucidated that both of the compounds inhibited the enzyme competitively. The study suggests that isolated compounds can be good candidates as α-glucosidase inhibitors and provide strong rationale for more in vivo studies.

  12. 一种改进的Canny算法及其仿真验证%An improved Canny algorithm and its simulation verification

    Institute of Scientific and Technical Information of China (English)

    付博研; 卢振洋; 白立来; 陈雨; 刘嘉

    2014-01-01

    In order to improve an image edge detection effect of Canny algorithm and be applied to FPGA platform,a im-proved Canny algorithm is proposed in this paper. The algorithm was realized with C language on computer. The fixed-point pro-cessing for the improved Canny algorithm was performed. It is described with Verilog HDL. The simulation experiment was con-ducted by a co-simulating method which associates Matlab with Modelsim to assess the performance of the algorithm on FPGA. The result shows that the edges detected by the improved algorithm are more clear and thin. The co-simulating method is based on Modelsim,and Verilog HDL. It’s a new method for verifying image processing algorithm on FPGA.%为了提升Canny边缘检测的效果,并使之适用于FPGA平台,提出一种改进的Canny算法,并用C语言实现了该算法;将改进的Canny算法定点化处理并使用Verilog HDL语言进行描述,采用一种Matlab与Modelsim联合的仿真方法,进行了FPGA仿真实验,以对改进算法在FPGA上的性能进行评估。实验结果表明改进的算法检得边缘清晰且更细,所采用仿真方法是基于Modelsim平台使用Verilog HDL语言进行的,是一种验证FPGA上图像算法性能的新方法。

  13. Hepatite infecciosa canina: 62 casos Infectious canine hepatitis: 62 cases

    Directory of Open Access Journals (Sweden)

    Maria A. Inkelmann

    2007-08-01

    Full Text Available Os protocolos de necropsias realizadas em 5.361 cães durante um período de 43 anos (1964-2006 foram revisados em busca de casos de hepatite infecciosa canina (HIC e sessenta e dois (1,2% casos foram encontrados. A maioria dos 62 cães afetados tinha dois anos de idade ou menos (91,9%. Os sinais clínicos foram anotados nos protocolos de necropsia de 45 cães afetados por HIC e incluíam anorexia (55,6%, apatia (35,6%, diarréia (35,6%, freqüentemente com sangue (43,8% dos casos de diarréia, distúrbios neurológicos (33,3%, vômito (26,7%, petéquias e equimoses nas membranas mucosas e/ou pele (24,4%, hipotermia (20,0%, dor abdominal (15,6%, icterícia (13,3%, aumento de volume e congestão das tonsilas (11,1%, febre (11,1% e ascite (6,7%. A duração do curso clínico variou de poucas horas a 15 dias. Os principais achados de necropsia incluíram alterações hepáticas (87,1%, linfonodos edematosos, congestos e hemorrágicos (51,6%, líquido sanguinolento, líquido claro ou sangue na cavidade abdominal (35,5%, víbices, sufusões e petéquias sobre a pleura visceral (27,4% e superfície serosa das vísceras gastrintestinais (24,2%. Em 12,9% dos casos a serosa do intestino tinha aspecto granular. Hemorragias cerebrais nas leptomeninges e na substância do encéfalo foram observadas em 9,7% dos casos. As alterações hepáticas macroscópicas incluíam fígados moderadamente aumentados de volume, mais friáveis, com acentuação do padrão lobular, congestos e com múltiplos focos de necrose pálidos ou hemorrágicos. Películas e filamentos de fibrina cobriam a superfície hepática em 20,4% dos casos e em 27,8% dos casos a parede da vesícula biliar estava espessada por edema. Necrose hepática zonal ou aleatória (93,5% dos casos associada a corpúsculos de inclusão intranucleares foi a lesão histológica mais regularmente encontrada. Os corpúsculos de inclusão intranucleares ocorreram no fígado em todos os casos e esse foi o crit

  14. Neuropatologia da cinomose canina: 70 casos (2005-2008

    Directory of Open Access Journals (Sweden)

    Marcia C. Silva

    2009-08-01

    Full Text Available Este estudo teve como objetivo realizar uma investigação anátomo-patológica detalhada das lesões e sua distribuição no sistema nervoso central (SNC de cães com cinomose. Foram avaliadas secções padronizadas do encéfalo e da medula espinhal de 70 cães. Os casos foram agrupados de acordo com a idade dos cães e classificados conforme a evolução das lesões. Os resultados permitem concluir que: (1 encefalomielite induzida pelo vírus da cinomose canina é mais prevalente em filhotes e adultos; (2 lesões macroscópicas no SNC ocorrem com baixa freqüência; (3 o encéfalo é mais acometido do que a medula espinhal; (4 as cinco regiões anatômicas mais afetadas do encéfalo são, em ordem decrescente de freqüência, o cerebelo, o diencéfalo, o lobo frontal, a ponte e o mesencéfalo; (5 a região anatômica mais afetada da medula espinhal é o segmento cervical cranial (C1-C5; (6 lesões subagudas e crônicas são mais comuns do que lesões agudas; (7 desmielinização é a lesão mais prevalente e ocorre principalmente no cerebelo, na ponte e no diencéfalo, quase sempre acompanhada de astrogliose e inflamação não-supurativa; (8 na maior parte dos casos em que há astrogliose, observam-se astrócitos gemistocíticos, freqüentemente com formação de sincícios; (9 leptomeningite não-supurativa, malacia e necrose cortical laminar são lesões relativamente freqüentes no encéfalo, mas não na medula espinhal; (10 corpúsculos de inclusão no encéfalo são muito comuns, ocorrem principalmente em astrócitos e com freqüência menor em neurônios; no entanto, independentemente da célula afetada, são vistos predominantemente no núcleo; (11 uma classificação da encefalite na cinomose com base em síndromes clínicas relacionadas com a idade do cão é imprecisa.The current study was performed to determine the pathology and distribution of lesions in the central nervous system (CNS of 70 dogs naturally affected by canine

  15. Infrared Image Edge Detection Algorithm Based on Improved Canny Algorithm%一种基于Canny算子的红外图像边缘检测算法

    Institute of Scientific and Technical Information of China (English)

    郭慧鑫; 牛竹云; 郭会兵; 于红娟; 闫建鹏

    2014-01-01

    边缘检测是图像特征提取的关键技术。传统的Canny边缘检测算法中高斯滤波方差不具备自适应性,并且不能有效滤除红外图像特有的噪声,对红外图像的边缘提取存在局限性。深入研究了Canny边缘检测算法,并分析了红外图像噪声类型,针对高斯滤波影响红外图像去噪和边缘保持效果的问题,提出了用形态学滤波代替高斯滤波的改进的Canny算法。经过仿真实验,验证了本方法的有效性。改进算法能有效提取含噪红外图像的边缘,较好地保持了红外图像的边缘强度和细节。%Edge detection is the key technology of image feture extraction.In the traditional Canny edge detection algorithm,gaussian filter variance do not have the adapt ability,and can not effectively filter the specific noise of infrared image,have limitations for the edge extraction of infrared image.This paper deeply study the Canny edge detection algorithm and analysis the infrared image noise type,aim at the question that gaussian filter influents the denoising and edge preserving of infrared image,put forward the improved Canny algorithm using morphological filtering instead of gaussian filtering. The simulation verify the effectiveness of this method. Improved algorithm can effectively extract the edge of infrared image with noise,effectively keep the edge strength and details of infrared image.

  16. Remote Sensing Visual Extraction Based on Morlet Wavelet and Canny Edge Detection%基于Morlet小波Canny边缘检测的遥感视觉提取

    Institute of Scientific and Technical Information of China (English)

    童菲; 盛延刚

    2014-01-01

    传统的Canny边缘检测方法提取遥感图像边缘视觉特征在设定不变矩阈值采用经验模式,导致视觉提取分辨率不好,特征提取不准。提出采用Morlet小波变换对遥感图像边缘特征进行不变矩阈值函数构建,提出一种基于Morlet小波Canny边缘检测算法的遥感图像视觉特征提取。将图像数据经过Canny边缘检测和标记分水岭分割,实现遥感图像视觉提取。仿真实验表明,该方法在遥感图像视觉特征提取上比传统的Canny边缘检测方法效果明显,提取正确率最高可以达到94.20%,算法将在远距离遥感目标识别和监测等领域具有很好的应用价值。%Traditional Canny edge detection methods for feature extraction of remote sensing image edge vision in the set-ting of moment invariant threshold is taken by using empirical mode, resulting in visual resolution is not good. The remote sensing image edge features are invariant threshold function constructed by Morlet wavelet transform, and we propose a kind of remote sensing image feature visual Morlet wavelet edge detection algorithm based on the extraction of Canny. Re-mote sensing image extraction is obtained. Simulation results show that, the method in remote sensing image visual feature extraction than conventional Canny edge detection methods and obvious effect, extraction accuracy can reach 94.20% of the maximum, the algorithm will have good application value in the field of remote sensing target identification and monitor-ing.

  17. Mordedura canina e atendimento antirrábico humano em Minas Gerais

    OpenAIRE

    V.M.R. Oliveira; P.L.L. Pereira; Silva, J. A.; C.F.J. Miranda; K.O. Rodrigues; T.O. Rodrigues; E.C. Moreira

    2012-01-01

    O objetivo do presente trabalho foi descrever e avaliar a mordedura canina e o atendimento antirrábico humano em Minas Gerais, de 1999 a 2004, correlacionando fontes de informação e áreas de risco predeterminadas para raiva humana transmitida por cão. Realizou-se um estudo observacional descritivo retrospectivo, utilizando-se, de forma adaptada, a análise exploratória de prontuários dos atendimentos da Superintendência de Epidemiologia da Secretaria de Estado da Saúde de Minas Gerais (339.012...

  18. Proyecciones de rabia canina en Argentina, Bolivia y Paraguay, usando series de tiempo

    OpenAIRE

    1997-01-01

    Se estudió el número de casos mensuales de rabia canina en Argentina (1971-1993), Bolivia (1987-1993) y Paraguay (1976-1993), a fin de identificar fluctuaciones regulares y predecir el comportamiento futuro de la rabia en dichos países. Los métodos empleados consistieron en análisis de series de tiempo, incluyendo el análisis armónico de Fourier y los modelos multiplicativos ARIMA-SARIMA de Box-Jenkins. Se evidenciaron ciclos en Argentina y Paraguay. La estacionalidad ocurrió a fines de invie...

  19. Volatile Oil Constituents of Rosa canina L.: Quality As Affected by the Distillation Method

    OpenAIRE

    Karim Hosni; Amel Kerkenni; Wafa Medfei; Nadia Ben Brahim; Houcine Sebei

    2010-01-01

    The volatile oils of R. canina flowers were isolated by hydrodistillation (HD) and traditional dry distillation (DD) and analyzed by HRGC-FID and GC-MS. Compared to HD, DD at 50°C leads to the isolation of high quality oil which contains the highest content of oxygenated compounds (83%). The main components are the 2-phenethyl alcohol and eugenol. The percentage of the 2-phenethyl alcohol, a highly desirable component in rose oil, was significantly higher (58.4%) in DD extract when compared t...

  20. Volatile Oil Constituents of Rosa canina L.: Quality As Affected by the Distillation Method

    Directory of Open Access Journals (Sweden)

    Karim Hosni

    2010-01-01

    Full Text Available The volatile oils of R. canina flowers were isolated by hydrodistillation (HD and traditional dry distillation (DD and analyzed by HRGC-FID and GC-MS. Compared to HD, DD at 50°C leads to the isolation of high quality oil which contains the highest content of oxygenated compounds (83%. The main components are the 2-phenethyl alcohol and eugenol. The percentage of the 2-phenethyl alcohol, a highly desirable component in rose oil, was significantly higher (58.4% in DD extract when compared to that of HD one (13.6%. As temperature increased (100°C during DD, the oil quality decreased. The most significant changes were observed in 2-phenethyl alcohol percentage (4.5%. Moreover, an increase of alkanes/alkenes and the production of furan derivatives were observed. So, DD at moderate temperature (50°C seemed more suitable to improve the volatile oil quality and hence, to make more value of R. canina.

  1. Effects of organohalogen pollutants on haematological and urine clinical-chemical parameters in Greenland sledge dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Kirkegaard, Maja;

    2008-01-01

    Seven West Greenland sledge dog bitches (Canis familiaris) and their three pups were fed 50-200 g of contaminated West Greenland minke whale (Balaenoptera acutorostrata) blubber, and in a control cohort eight sister bitches and their .ve pups were fed a similar amount pork fat. Blood plasma and u...

  2. Comparative NMR studies of diffusional water permeability of red blood cells from different species: XVI Dingo (Canis familiaris dingo) and dog (Canis familiaris).

    Science.gov (United States)

    Benga, Gheorghe; Chapman, Bogdan E; Matei, Horea; Cox, Guy C; Romeo, Tony; Mironescu, Eugen; Kuchel, Philip W

    2010-03-08

    As part of a programme of comparative measurements of Pd (diffusional water permeability) the RBCs (red blood cells) from dingo (Canis familiaris dingo) and greyhound dog (Canis familiaris) were studied. The morphologies of the dingo and greyhound RBCs [examined by light and SEM (scanning electron microscopy)] were found to be very similar, with regard to aspect ratio and size; the mean diameters were estimated to be the same (approximately 7.2 microm) for both dingo and greyhound RBCs. The water diffusional permeability was monitored by using an Mn2+-doping 1H NMR technique at 400 MHz. The Pd (cm/s) values of dingo and greyhound RBCs were similar: 6.5 x 10(-3) at 25 degrees C, 7.5 x 10(-3) at 30 degrees C, 10 x 10(-3) at 37 degrees C and 11.5 x 10(-3) at 42 degrees C. The inhibitory effect of a mercury-containing SH (sulfhydryl)-modifying reagent PCMBS (p-chloromercuribenzene sulfonate) was investigated. The maximal inhibition of dingo and greyhound RBCs was reached in 15-30 min at 37 degrees C with 2 mmol/l PCMBS. The values of maximal inhibition were in the range 72-74% when measured at 25 degrees C and 30 degrees C, and approximately 66% at 37 degrees C. The lowest value of Pd (corresponding to the basal permeability to water) was approximately 2-3 x 10(-3) cm/s in the temperature range 25-37 degrees C. The Ea,d (activation energy of water diffusion) was 25 kJ/mol for dingo RBC and 23 kJ/mol for greyhound RBCs. After incubation with PCMBS, the values of Ea,d increased, reaching 46-48 kJ/mol in the condition of maximal inhibition of water exchange. The electrophoretograms of membrane polypeptides of the dingo and greyhound RBCs were compared and seen to be very similar. We postulate that the RBC parameters reported in the present study are characteristic of all canine species and, in particular in the two cases presented here, these parameters have not been changed by the peculiar Australian habitat over the millennia (as in the case of the dingo) or over

  3. Canine visceral leishmaniosis: a comparative analysis of the EIE-leishmaniose-visceral-canina-Bio-Manguinhos and the IFI-leishmaniose-visceral-canina-Bio-Manguinhos kits.

    Science.gov (United States)

    Lira, R A; Cavalcanti, M Paiva; Nakazawa, M; Ferreira, A G P; Silva, E D; Abath, F G C; Alves, L C; Souza, W V; Gomes, Y M

    2006-04-15

    This study evaluated the performance of the EIE-leishmaniose-visceral-canina-Bio-Manguinhos (EIE-LVC) kit and to compare it with that of the IFI-leishmaniose-visceral-canina-Bio-Manguinhos (IFI-LVC) kit. Four groups of dogs were studied: group 1 (G1), dogs with clinical signs indicative of CVL and testing positive for the parasite (n = 25); group 2 (G2), dogs with only a presumed diagnosis of CVL (n = 62); group 3 (G3), dogs that had never lived in an area where CVL is endemic and never received a blood transfusion (n = 16); group 4 (G4), dogs carrying other parasites: such as babesiosis (n = 4), ehrlichiosis (n = 6) and demodicosis (n = 1). G1 and G3 were used for the calculation of sensitivity and specificity, respectively. The EIE-LVC showed a sensitivity of 72% (IC 95%: 50.4-87.1%) and a specificity of 87.5% (IC 95%: 60.4-97.8%). The value of the kappa index was 0.975 (CI 95%: 0.926-1.024), which represents an excellent fit. For IFI-LVC, the sensitivity was 68.0% (CI 95%: 46.4-84.3%) and the specificity 87.5% (CI 95%: 60.4-97.8%). When the tests were conducted in parallel, sensitivity was 92.0% (CI 95%: 72.5-98.6%) and specificity 75.0% (CI 95%: 47.4-91.7%). However, when conducted consecutively, the tests showed a sensitivity of 48.0% (CI 95%: 28.3-68.2%) and a specificity of 100.0% (CI 95%: 75.9-99.4%). The analysis of clinically suspected dogs using IFI-LVC and EIE-LVC kits in parallel, revealed that 26/62 animals were positive. Cross-reaction was observed in a dog with demodicosis. These results lead to the following conclusions: (1) the performance of the EIE-LVC kit is not statistically different from the IFI-LVC and (2) the kits must be used in parallel if higher sensitivity is required, reducing the number of false-negative results.

  4. Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species

    DEFF Research Database (Denmark)

    Sonne, Christian; Gustavson, Kim; Eulaers, Igor;

    2016-01-01

    The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First...

  5. Doença pancreática canina : estudo retrospectivo

    OpenAIRE

    2012-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A doença pancreática tem sido alvo de investigação, principalmente durante a última década, e de avanços significativos na compreensão dos mecanismos fisiopatológicos, diagnóstico, tratamento e prognóstico. Relativamente à doença inflamatória, o diagnóstico baseia-se maioritariamente na medição da concentração de lipase pancreática canina (cPL) e imagem ecográfica compatível. No presente estudo a ecografia, pela sua d...

  6. Dermatofitose canina causada pelo fungo antropofílico Trichophyton tonsurans - Relato de caso

    OpenAIRE

    Oliveira, Lorena Mayana Beserra de; Universidade Estadual do Ceará; Pinheiro, Adriana de Queiroz; Universidade Estadual do Ceará; Macedo, Iara Tersia Freitas; Universidade Estadual do Ceará; Silva, Isaac Neto Goes da; Universidade Estadual do Ceará; Moreira, Odanir Cruz; Universidade Estadual do Ceará; Silva, Bárbara Wilka Leal; Universidade Estadual do Ceará; Alencar, Érika Carvalho de; Universidade Estadual do Ceará; Leite, João Jaime Giffoni; Universidade Estadual do Ceará

    2015-01-01

    A dermatofitose é uma enfermidade cutânea de origem fúngica que merece destaque por sua elevada incidência na clínica de pequenos animais e importância na saúde animal e humana, pois pode ser transmitida do animal para o homem ou do homem para o animal. Este trabalho teve como objetivo relatar um caso de dermatofitose canina causado por uma espécie antropofílica de dermatófito, envolvendo o diagnóstico clínico e laboratorial. Uma cadela, da raça York Shire, com aproximadamente três anos de id...

  7. Investigation of Polyhenolic Content of Rose Hip (Rosa canina L. Tea Extracts: A Comparative Study

    Directory of Open Access Journals (Sweden)

    Zeynep İlbay

    2013-02-01

    Full Text Available Three different brands of Rose hip (Rosa canina L. tea were extracted with water, ethanol (EtOH, methanol (MeOH, and aqueous mixtures (50%, v/v by ultrasound-assisted extraction (UAE and Soxhlet methods. Total phenolic content was determined according to the Folin-Ciocalteu method. The results were presented by means of the extract yields and total phenolic contents, expressed in gallic acid equivalent (GAE per g of dried matter (DM. The greatest amount of extract observed in tea samples was obtained by UAE through water with the value of 619.37 ± 0.58 mg/g DM. Regarding the phenolic content, the best result was achieved by the Soxhlet method through 50% MeOH mixture (59.69 ± 0.89 mg GAE/g DM, followed by the UAE method with water (48.59 ± 0.29 mg GAE/g DM.

  8. The Dogs of CA-SRI-2: Osteometry of Canis familiaris from Santa Rosa Island, California

    Directory of Open Access Journals (Sweden)

    Courtney Hofman

    2014-05-01

    Full Text Available Domesticated dogs (Canis familiaris are an important human companion around the world and have long been a focus of archaeological research. Osteometric analysis of six dogs from a Late Holocene Chumash village on Santa Rosa Island, California indicates that adults, juvenile/young adults, and a puppy were present. Similar to dogs on other Channel Islands, these dogs fall into the large Indian dog category, standing some 43-54 cm tall, with mesaticephalic or mild brachycephalic facial characteristics. No cutmarks were found on the bones, but one of the mandibles was burned. The CA-SRI-2 dogs appear to have eaten high trophic marine foods similar to what humans consumed, documenting the close bond between dogs and humans on the Channel Islands and broader North American Pacific Coast.

  9. Diphyllobothrium sp. in Canis familiaris from the subtropical area of Argentina (Puerto Iguazú, Misiones).

    Science.gov (United States)

    Rivero, María R; Motta, Carlos E; Salas, Martín M; Chiaretta, Alicia; Salomón, Oscar D

    2015-01-01

    This paper reports the first finding of Diphyllobothrium sp. eggs in Canis familiaris (domestic dog) from Puerto Iguazú, a subtropical city of Misiones province, Argentina. In 2013, two positive cases of Diphyllobothrium sp. eggs were detected during an annual parasitological survey of dogs. Dog feces were collected in vials containing 10% formalin and processed using Telemann's sedimentation and Sheather's flotation techniques. The two cases were detected in rural areas of the municipality. Since Misiones is not a part of the endemic area of diphyllobothriasis and given the fact that it is located in the three-border area of Argentina, Brazil and Paraguay, we consider this finding of great importance to public health. We stress the need for updating the current knowledge about the life cycle of these parasites considering the range of intermediate and definitive hosts, their zoonotic potential, and the epidemiological situation in non-endemic areas.

  10. Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-03-01

    Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.

  11. Aspectos epidemiologicos da babesiose canina em área semi-árida do Estado de Minas Gerais

    OpenAIRE

    Monica Guerra Maia

    2005-01-01

    O objetivo deste trabalho foi estudar os aspectos epidemiológicos da babesiose canina em animais de uma cidade localizada em área semi-árida do estado de Minas Gerais. Foi realizada uma amostragem aleatória na população canina da cidade de Porterinha, na região de Itacambira, baseada numa prevalência esperada de 20% e grau de confiança de 90%, perfazendo um total de 505 animais. Amostras de sangue foram coletadas no mês de março de 2003 e examinadas por meio da Reação de Imunofluorescência In...

  12. New Blind Graphic Printing Technology Based on Canny Operator%基于caany算子的新型盲用图形生成技术

    Institute of Scientific and Technical Information of China (English)

    李博; 王治平; 刘俊标; 方光荣

    2011-01-01

    Nowadays , Graphic printing becomes more and more important for the blind. As a new Braille printing tool, New Braille Printer(NBP) has overcome many shortcomings of traditional Braille printer. But, till now, the NBP could't has the functin of graphic printing. In order to improve the new Braille printer, a blind graphic printing method has been proposed. Considering the characteristics of the printing image, it utilized loop iteration method to select Canny operators with different thresholds, and then, took edge detection on the printing image to gained a series of edge images with the selected Canny operators. The accurate shape information of printing image was translated into NBP's control information, then the control information was used to control the NBP to print the blind graphic which gained from iterative calculation of this edge images. This method has been test on NBP, and blind graphics were printed on A4 paper clearly and completely.%随着信息技术的发展,盲用图形对于盲人而言,变得越来越重要。新型盲文打印机作为盲文印刷的新型工具,它克服了传统盲文印刷的许多缺点,但是,目前该盲文打印机还不具备打印盲文图形的功能,为了完善新型盲文打印机,本文针对待打印的盲文图像的特点,采用循环迭代的方式,选择不同阈值的Canny算子对待打印图像进行边缘提取,并对所得到的一系列的边缘图像进行迭代计算,从而实现了待打印图像边缘特征的精确提取。待打印图像的边缘信息最终被转化为新型盲文打印机的控制信息控制新型盲文打印机完成打印,生成盲用图形,从而实现了新型盲文打印机图形打印功能。目前,该方法已经在新型盲文打印机试验,成功的实现了待打印图像在A4纸张上的清晰完整的打印。

  13. 自适应Retinex与Canny的炉膛火焰边缘检测算法%Adaptive Retinex and Modified Canny Edge Detection Algorithm for Furnace Flame

    Institute of Scientific and Technical Information of China (English)

    谭亚鹏; 李丽华; 张书真

    2016-01-01

    对炉膛火焰图像的增强与检测是获得炉膛内部燃烧情况的重要手段。首先,提出了一种自适应多尺度 Retinex算法,提高了火焰清晰度和炉膛火焰与炉膛的对比度。其次,提出了识别火焰边缘改进的 Canny算法,提高了火焰边缘清晰度。仿真结果表明,炉膛火焰与环境对比度得到提高,改善了图像的视觉效果,火焰边界连续且轮廓清晰。%Analysis of furnace flame is an important method to obtain the combustion condition inside the furnace.Accordingly.an adaptive multi-scale Retinex (MSR)algorithm is proposed.which effectively im-proves the clarity and detail of the fire flame and enhances the contrast of fire flame with the back-ground.In order to get a better monitoring result,improved Canny algorithm is adopted to identify the flame edge,and improves the ability of extracting the flame edge details and suppressing the false edge. After image enhancement and edge detection,it can more accurately grasp the internal combustion situa-tion of furnace.The simulation experiment shows that the brightness of the flame is improved effective-ly.the contrast of flame with furnace is obvious.and the edge of the flame is continuous and clear.

  14. Juvenile cellulitis in a puppy – case reportsCelulite juvenil canina – relato de casos

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Fonseca-Alves

    2012-08-01

    Full Text Available Juvenile cellulitis or juvenile sterile granulomatous lymphadenitis is a rare disorder that affects puppies between three weeks to six months years old. Clinical signs include alopecia, edema, papules, pustules and crusts especially on eyelids. Definitive diagnosis requires cytological and histological evaluation and early and aggressive therapy is recommended, once scars after recovery can be severe .The choice treatment is the high dose of corticosteroids use such as prednisone. Three animals of canine species were attended at the Veterinary Hospital Clinical Small Animal Service presenting different clinical signs. Hemogram, skin lesions and submandibular lymph nodes cytological examination was collected and analyzed. The treatment was instituted, using cephalexin (22mg/kg, twice daily up to control of secondary bacterial infection, and prednisone (2mg/kg, once a day until clinical resolution. Complete cure was obtained at the end of treatment. The aim of this work is to report three clinical cases of juvenile cellulitis in dogs. A celulite juvenil ou linfadenite granulomatosa estéril juvenil, é um distúrbio raro que acomete filhotes com idade entre três semanas a seis meses. Os sinais clínicos incluem alopecia, edema, pápulas, pústulas e crostas especialmente em pálpebras. O diagnóstico definitivo requer exames citológico e histopatológico e a terapia precoce e agressiva é preconizada, pois as cicatrizes após recuperação podem ser graves. O tratamento de escolha consiste no uso de altas doses dos glicocorticoides, como prednisona. Foram atendidos no Hospital Veterinário, três animais da espécie canina, apresentando sinais clínicos variados. Foram realizados hemograma, exame citológico das lesões de pele e dos linfonodos submandibulares. O tratamento foi instituído, utilizando-se cefalexina na dose de 22 mg/kg, duas vezes ao dia, até controle de infecção bacteriana secundária e prednisona na dose de 2mg/kg, uma vez

  15. The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls

    DEFF Research Database (Denmark)

    Nielsen, Bente Kirkeskov; Christensen, Robin; Bügel, Susanne Gjedsted

    2011-01-01

    OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains antioxid......OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains...

  16. El Pennhip modificado y la sinfisiodesis juvenil pubiana como prevención de displasia de cadera canina en las Fuerzas Armadas

    OpenAIRE

    C. Sánchez Alonso; A. García Luque; M.J. Chamorro Sancho; P. Arias Sanz; P. De Vega Terán; F. Crespo Castejón

    2015-01-01

    Introducción: La displasia de cadera canina es la principal causa física de exclusión de los perros de los programas de adiestramiento en las Fuerzas Armadas y los Cuerpos y Fuerzas de Seguridad del Estado, es por ello importante realizar una criba temprana de esta patología. Objetivo: Determinar la eficacia del procedimiento del Penn-Hip modificado y la sinfisiodesis juvenil pubiana como método para prevenir el desarrollo de la displasia de cadera canina. Material y método: Estudio descripti...

  17. The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls: A prospective cohort study

    DEFF Research Database (Denmark)

    Kirkeskov, Bente; Christensen, Robin; Bügel, Susanne Gjedsted

    2011-01-01

    OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains antioxid......OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains...

  18. Development of a non-invasive polysomnography technique for dogs (Canis familiaris).

    Science.gov (United States)

    Kis, Anna; Szakadát, Sára; Kovács, Enikő; Gácsi, Márta; Simor, Péter; Gombos, Ferenc; Topál, József; Miklósi, Adám; Bódizs, Róbert

    2014-05-10

    Recently dogs (Canis familiaris) have been demonstrated to be a promising model species for studying human behavior as they have adapted to the human niche and developed human-like socio-cognitive skills. Research on dog behavior, however, has so far almost exclusively focused on awake functioning. Here we present a self-developed non-invasive canine polysomnography method that can easily be applied to naive pet dogs. N=22 adult pet dogs (with their owners present) and N=12 adult humans participated in Study I. From these subjects, N=7 dogs returned on two more occasions for Study II. In Study I, we give a descriptive analysis of the sleep electroencephalogram of the dog and compare it to human data. In order to validate our canine polysomnography method in Study II, we compare the sleep macrostructure and the EEG spectrum of dogs after a behaviorally active day without sleep versus passive day with sleep. In Study I, we found that dogs' sleep EEG resembled that of human subjects and was generally in accordance with previous literature using invasive technology. In Study II, we show that similarly to previous results on humans daytime load of novel experiences and sleep deprivation affects the macrostructural and spectral aspects of subsequent sleep. Our results validate the family dog as a model species for studying the effects of pre-sleep activities on the EEG pattern under natural conditions and, thus, broaden the perspectives of the rapidly growing fields of canine cognition and sleep research.

  19. Experience matters: Dogs (Canis familiaris) infer physical properties of objects from movement clues.

    Science.gov (United States)

    Kuroshima, Hika; Nabeoka, Yukari; Hori, Yusuke; Chijiiwa, Hitomi; Fujita, Kazuo

    2017-03-01

    Reasoning about physical properties of objects such as heaviness by observing others' actions toward them is important and useful for adapting to the environment. In this study, we asked whether domestic dogs (Canis familiaris) can use a human's action to infer a physical property of target objects. In Experiment 1, dogs watched an experimenter opening two differently loaded swinging doors with different corresponding degrees of effort, and then were allowed to open one of the doors. Dogs chose randomly between the two doors. In Experiment 2, we gave new dogs the same test as in Experiment 1, but only after giving them experience of opening the doors by themselves, so that they already knew that the doors could be either light or heavy. In this test the dogs reliably chose the light door. These results indicate that dogs are able to infer physical characteristics of objects from the latters' movement caused by human action, but that this inferential reasoning requires direct own experience of the objects.

  20. Aspectos moleculares del virus de la parvovirosis canina y sus implicaciones en la enfermedad

    Directory of Open Access Journals (Sweden)

    César A. Díaz R.

    2008-06-01

    Full Text Available El parvovirus canino tipo 2 (CPV-2 es el agente causal de una enfermedad infecto-contagiosa que produce una gastroenteritis aguda hemorrágica que afecta a caninos jóvenes. El CPV-2 se adaptó a la especie canina por mutación del virus de la Panleucopenia felina (FPV luego de su paso por animales silvestres como el hurón y los zorros. La alta variabilidad de la proteína viral 2 (VP2 es la causa principal del amplio rango de hospedadores y de las reacciones cruzadas entre las variantes. En la actualidad, la secuenciación de esta proteína ha permitido identificar tres variantes del virus conocidas como 2a, 2b y 2c que conviven en el mundo con diferencias en tropismo celular, infecciocidad y patogenicidad. El virus ssADN ha presentado una gran variación génica en cortos períodos de tiempo lo que indica un alto grado de selección por evolución sólo comparable con virus RN, esta alta variabilidad no se ha aclarado totalmente. El empleo de las técnicas moleculares permitirá diferenciar entre cepas vacunales y de campo, tanto como contar con técnicas diagnósticas confiables y específicas.

  1. A systematic review on the Rosa canina effect and efficacy profiles.

    Science.gov (United States)

    Chrubasik, Cosima; Roufogalis, Basil D; Müller-Ladner, Ulf; Chrubasik, Sigrun

    2008-06-01

    Rose hip, rose hip and seed and rose hip seed, all were negatively monographed by the German Commission E due to insufficient evidence of effects and effectiveness. Therefore a comprehensive review of the literature was conducted to summarize the pharmacological and clinical effects of Rosa canina L. to reevaluate its usefulness in traditional medicine. For various preparations of rose hip and rose hip and seed, antioxidative and antiinflammatory effects have been demonstrated. Lipophilic constituents are involved in those mechanisms of action. The proprietary rose hip and seed powder Litozin has been employed successfully in a number of exploratory studies in patients suffering from osteoarthritis, rheumatoid arthritis and low back pain. However, the sizes of the clinical effects for the different indications need to be determined to assure clinical significance. There is also a rationale behind the use of Litozin as part of a hypocaloric diet based on the rose hip probiotic, stool regulating and smooth muscle-relaxing actions, as well as the rose hip seed lipid-lowering, antiobese and antiulcerogenic effects. Further research is needed to clarify the importance of the reported promising experimental effects in clinical use and to characterize the optimum rose hip seed oil preparation for topical use in the treatment of skin diseases.

  2. Diagnóstico por imagen de la articulación de la rodilla en la especie canina

    OpenAIRE

    Soler Laguía, Marta

    2003-01-01

    En la especie canina, la rodilla es la articulación que más frecuentemente presenta alteraciones, siendo las patologías de los ligamentos y meniscos las más comunes, asociadas a cambios degenerativos articulares secundarios. Para evaluar las estructuras que componen la rodilla y poder diagnosticar dichas alteraciones podemos emplear numerosas técnicas de diagnóstico por imagen como la artrografia, ecografía así como estudios de imagen por resonancia magnética (IRM). La artrografia de la rodil...

  3. Mielopatía Degenerativa canina: signos clínicos, diagnóstico y terapéutica (Canine degenerative myelopathy: clinical signs, diagnosis and therapy)

    OpenAIRE

    2011-01-01

    ResumenLa mielopatía degenerativa canina es una enfermedad neurológica progresiva autoinmune que afecta principalmente a caninos adultos de talla grande sin predilección de sexo.SummaryCanine degenerative myelopathy is a progressive neurological autoimmune disease that primarily affects large size adult dogs and no sex predilection.

  4. Mielopatía Degenerativa canina: signos clínicos, diagnóstico y terapéutica (Canine degenerative myelopathy: clinical signs, diagnosis and therapy

    Directory of Open Access Journals (Sweden)

    Suraniti, A.P

    2011-08-01

    Full Text Available ResumenLa mielopatía degenerativa canina es una enfermedad neurológica progresiva autoinmune que afecta principalmente a caninos adultos de talla grande sin predilección de sexo.SummaryCanine degenerative myelopathy is a progressive neurological autoimmune disease that primarily affects large size adult dogs and no sex predilection.

  5. Effect of training and familiarity on responsiveness to human cues in domestic dogs (Canis familiaris).

    Science.gov (United States)

    Cunningham, Clare L; Ramos, Mari F

    2014-05-01

    Domestic dogs (Canis familiaris) seem to possess an evolved competency to follow human-given cues, often out-performing their wild progenitor the wolf (Canis lupus) on cue-following tasks. However, domestication may not be solely responsible for the socio-cognitive skills of dogs, with ontogenetic experience also playing a role. This research evaluated the effects of intensive training on cue-following behaviour using an unreinforced object-choice paradigm. The responses of dogs that were trained to competitive levels were compared to those of pet dogs with only basic training, and dogs living in an animal shelter that demonstrated no or only rudimentary following of basic commands. Using a cue-following task where three types of cues were presented by familiar and unfamiliar human partners, the number of cues followed by each training group were recorded. All dogs found cues where gesture was combined with a congruent head and eye movement easier to follow than either gesture or eye gaze alone. Whether the cue-giver was familiar or not had a significant effect on number of cues followed in homed dogs, and the performance of shelter dogs was comparable to the other groups when faced with an unfamiliar cue-giver. Contrary to predictions, level of training did not improve performance on the cue-following task. This work does provide support for the presence of an evolved adaptation to exploit social cues provided by humans that can be augmented by familiarity with the cue giver. However, additional joint activity as experienced in an intensive training regime does not seem to increase accuracy in following human-given cues.

  6. The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

    Science.gov (United States)

    Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

    2016-05-01

    Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills.

  7. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    James Hunt

    Full Text Available Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris, but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions

  8. Alfaxalone Anaesthesia Facilitates Electrophysiological Recordings of Nociceptive Withdrawal Reflexes in Dogs (Canis familiaris).

    Science.gov (United States)

    Hunt, James; Murrell, Jo; Knazovicky, David; Harris, John; Kelly, Sara; Knowles, Toby G; Lascelles, B Duncan X

    2016-01-01

    Naturally occurring canine osteoarthritis represents a welfare issue for affected dogs (Canis familiaris), but is also considered very similar to human osteoarthritis and has therefore been proposed as a model of disease in humans. Central sensitisation is recognized in human osteoarthritis sufferers but identification in dogs is challenging. Electromyographic measurement of responses to nociceptive stimulation represents a potential means of investigating alterations in central nociceptive processing, and has been evaluated in conscious experimental dogs, but is likely to be aversive. Development of a suitable anaesthetic protocol in experimental dogs, which facilitated electrophysiological nociceptive withdrawal reflex assessment, may increase the acceptability of using the technique in owned dogs with naturally occurring osteoarthritis. Seven purpose bred male hound dogs underwent electromyographic recording sessions in each of three states: acepromazine sedation, alfaxalone sedation, and alfaxalone anaesthesia. Electromyographic responses to escalating mechanical and electrical, and repeated electrical, stimuli were recorded. Subsequently the integral of both early and late rectified responses was calculated. Natural logarithms of the integral values were analysed within and between the three states using multi level modeling. Alfaxalone increased nociceptive thresholds and decreased the magnitude of recorded responses, but characteristics of increasing responses with increasing stimulus magnitude were preserved. Behavioural signs of anxiety were noted in two out of seven dogs during recordings in the acepromazine sedated state. There were few significant differences in response magnitude or nociceptive threshold between the two alfaxalone states. Following acepromazine premedication, induction of anaesthesia with 1-2 mg kg-1 alfaxalone, followed by a continuous rate infusion in the range 0.075-0.1 mg kg-1 min-1 produced suitable conditions to enable assessment

  9. ESTUDIO SEROLÓGICO DE BRUCELOSIS CANINA EN DOS ALBERGUES DEL MUNICIPIO DE ENVIGADO, COLOMBIA (2011

    Directory of Open Access Journals (Sweden)

    P. Agudelo

    2014-01-01

    Full Text Available El objetivo de este estudio fue buscar la presencia de anticuerpos de brucelosis en la población de dos albergues caninos del municipio de Envigado (Antioquia, Colombia y a tal fin se seleccionaron 54 perros. Se tomaron muestras sanguíneas en 10 machos y 44 hembras que fueron procesadas bajo la técnica de inmunocromatografía para Brucella canis. No hubo diferencia estadística entre albergues en los parámetros ‘sexo’ y ‘raza’ de cada grupo de estudio y tampoco se encontró evidencia serológica de la presencia de brucelosis canina en el grupo de animales muestreados. Los resultados indican que, aunque los animales permanecieron en calidad de abandono durante un período de su vida, su condición feral no era permanente debido a que en el momento del estudio se encontraban en albergues. Las políticas intensivas de recolección se orientan más a la atención de mascotas abandonadas que a aquellos animales ferales (los cuales, con mayor frecuencia, pueden ser portadores de la enfermedad. El tipo de población in - cluida en el estudio, sumado a la práctica estricta de esterilización inmediata dentro del albergue —que a su vez impide los apareamientos entre individuos—, pueden incidir en la reducción la propagación de la enfermedad en el municipio.

  10. Efecto del sacrificio de perros vagabundos en el control de la rabia canina

    Directory of Open Access Journals (Sweden)

    Ricardo Castillo-Neyra

    Full Text Available En la ciudad de Arequipa, Perú, se han detectado perros con rabia desde marzo de 2015, señal de la reintroducción del virus de la rabia (VR en esta zona previamente declarada libre de esta enfermedad. La alta densidad de perros vagabundos ha sido considerada una de las causas de la continua transmisión del VR en el brote de la ciudad de Arequipa, alentando el sacrificio de perros como medida de salud pública. Sin embargo, la efectividad de esta medida de control no ha sido evaluada. El objetivo de esta revisión fue determinar la efectividad del sacrificio de perros vagabundos como medida de control de la rabia urbana. Se realizó la búsqueda de artículos sobre control de rabia canina o urbana en las bases de datos de Medline, Scopus y LILACS. Se incluyeron estudios originales y revisiones que hayan evaluado algún efecto del sacrificio de perros en la transmisión del VR. Veinte de 21 artículos concluyen que el sacrificio de perros vagabundos es inefectivo en reducir la trasmisión del VR e, incluso, puede tener consecuencias imprevistas que empeoren el problema. En conclusión, la evidencia disponible indica que sacrificar perros vagabundos no es efectivo para controlar la rabia urbana. Además, las diversas consecuencias negativas del sacrificio de los perros vagabundos reportadas en otras partes del mundo sugieren que el sistema de rabia urbana es altamente complejo y todos sus componentes deben ser tomados en cuenta durante la implementación de actividades de control.

  11. Criptococose canina: relato de caso Canine ocular cryptococcosis: a case report

    Directory of Open Access Journals (Sweden)

    C.E. Larsson

    2003-10-01

    Full Text Available Descreve-se, pela primeira vez no Brasil, um caso de criptococose canina com acometimento oftalmo e dermatopático, com diagnóstico intra-vitam, em animal da raça Pastor Alemão, fêmea, com 24 meses de vida, criado em São Paulo, em contacto com outros cinco cães assintomáticos, que havia se infectado pelo contato com dejetos de pombos (Columba livia. Evoluia há 90 dias, com quadro tegumentar e ósseo, sintomas e lesões características, sendo, ainda, detectada forma assintomática de coriorretinite, de início unilateral. O diagnóstico foi estabelecido pelos dados da anamnese, dos exames físico, dermatológico e complementares (radiográfico, cultivo micológico, histopatologia de pele tendo-se evidenciado e isolado cepa de Criptococcus neoformans var. neoformans. Após nove meses de terapia com itraconazol (9mg/kg/SID/VO houve involução total do quadro, sem qualquer efeito adverso à droga.A case of cryptococcosis with ocular and cutaneous involvement is reported by the first time in Brazil in a dog. A two-year-old female German Shepherd living in a hold house with other five healthy dogs was infected through the contact with pigeon (Columba livia feces. The illness started 90 days previously with cutaneous and bone involvement resulting in characteristic clinical signs and lesions, in addition to a initially unilateral asymptomatic chorioretinitis. The diagnosis was established based on anamnesis, physical and dermatologic examinations and complementary exams (radiographs, skin biopsy and histopathology and the isolation of a Cryptococcus neoformans var. neoformans strain was accomplished. There was a complete resolution of the disease after nine months of therapy using itraconazole (9mg/kg, q24h, PO and no side effect was observed.

  12. Patologias genitais associadas à leishmaniose visceral canina Genital pathologies associated with canine visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Vinícius Vasconcelos Gomes de Oliveira

    2012-09-01

    Full Text Available A leishmaniose visceral canina (LVC é uma doença parasitária crônica causada por protozoários pertencentes ao gênero Leishmania. No Brasil, a transmissão se dá, principalmente, pela ação hematófaga de insetos vetores pertencentes à subfamília Phlebotominae, particularmente, a espécie Lutzomyia longipalpis. Todavia, a trasmissão vertical e venérea da LVC está presente. Os principais sinais clínicos observados nos animais acometidos pela LVC são linfoadenomegalia, dermatopatias, hepatoesplenomegalia, onicogrifose e oftalmopatias, contudo quadros atípicos podem ser observados, inclusive com o envolvimento do sistema genital. Dessa forma, o objetivo deste artigo é realizar revisão sobre as principais patologias genitais em cães machos e fêmeas com leishmaniose visceral (LV.The canine visceral leishmaniasis (CanL is a chronic parasitic disease caused by protozoa belonging to the genus Leishmania. In Brazil, the transmission occurs mainly by the action of blood-sucking insects belonging to the subfamily Phlebotominae, particularly the Lutzomyia longipalpis species. However, the venereal and vertical transmission of the CanL is present. The main clinical signs observed in animals affected by the CanL are lymphadenopathy, skin diseases, hepatosplenomegaly, onychogryphosis and ophthalmopathy, however atypical manifestations can be observed, including the involvement of the genital system. Thus, the aim of this paper is to review on the major pathologies in genital male and female dogs with visceral leishmaniasis (VL.

  13. Fungal lectin of Peltigera canina induces chemotropism of compatible Nostoc cells by constriction-relaxation pulses of cyanobiont cytoskeleton.

    Science.gov (United States)

    Díaz, Eva Maria; Vicente-Manzanares, Miguel; Sacristan, Mara; Vicente, Carlos; Legaz, Maria-Estrella

    2011-10-01

    A glycosylated arginase acting as a fungal lectin from Peltigera canina is able to produce recruitment of cyanobiont Nostoc cells and their adhesion to the hyphal surface. This implies that the cyanobiont would develop organelles to motility towards the chemoattractant. However when visualized by transmission electron microscopy, Nostoc cells recently isolated from P. canina thallus do not reveal any motile, superficial organelles, although their surface was covered by small spindles and serrated layer related to gliding. The use of S-(3,4-dichlorobenzyl)isothiourea, blebbistatin, phalloidin and latrunculin A provide circumstantial evidence that actin microfilaments rather than MreB, the actin-like protein from prokaryota, and, probably, an ATPase which develops contractile function similar to that of myosin II, are involved in cell motility. These experimental facts, the absence of superficial elements (fimbriae, pili or flagellum) related to cell movement, and the appearance of sunken cells during of after movement verified by scanning electron microscopy, support the hypothesis that the motility of lichen cyanobionts could be achieved by contraction-relaxation episodes of the cytoskeleton induced by fungal lectin act as a chemoattractant.

  14. Parásitos zoonóticos en heces caninas en la ciudad de Bahía Blanca

    OpenAIRE

    La Sala, Luciano Francisco; Sixto R. COSTAMAGNA; Leiboff, Anastasia

    2016-01-01

    [En Comunicaciones breves de la Revista Argentina de Zoonosis y Enfermedades Infecciosas Emergentes] Existe una gran cantidad de agentes infecciosos transmisibles entre el perro doméstico (Canis lupus familiaris) y el hombre. Entre estos se encuentran enteroparásitos, algunos de los cuales representan un riesgo para la salud pública aún en países desarrollados. La ciudad de Bahía Blanca, en Argentina, tiene una población de 301.531 habitantes distribuidos en 126.639 hogares. Asimismo, existen...

  15. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;

    2014-01-01

    This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six exp...

  16. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

    Directory of Open Access Journals (Sweden)

    Héctor Rubén Ávila Adarme

    2016-06-01

    Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la

  17. DETECCIÓN DE ANTICUERPOS ANTI-Leishmania (Trypanosomatidae EN POBLACIONES CANINAS DEL DEPARTAMENTO DE SUCRE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luís Enrique Paternina Tuirán

    2015-11-01

    Full Text Available RESUMENEl objetivo de la investigación fue determinar la prevalencia de anticuerpos anti-Leishmania en perros del departamento de Sucre, Colombia. Se analizaron 122 perros del área rural de los municipios de Ovejas, Sampués y Sincelejo, mediante la técnica de inmunofluorescencia indirecta (IFI. Anticuerpos anti-Leishmania fueron detectados en el 69,6 % (IC95 % = 61,1 – 78,2 de la población canina estudiada. En el municipio de Sincelejo la seropositividad fue del 72 % (IC95 % = 61,1 – 82,8, en el municipio de Sampués del 68,4 % (IC95 % = 52,3 – 84,5 y en el municipio de Ovejas del 55,5 % (IC95 % = 21,2 – 86,3. Los animales seropositivos fueron principalmente caninos jóvenes y adultos. El 17,6 % de los perros seropositivos mostró signos clínicos compatibles con leishmaniasis canina, entre los cuales la onicogrifosis, alopecia y caquexia fueron los más comunes. La alta frecuencia de caninos con anticuerpos a Leishmania detectada en el presente estudio, pone de manifiesto la hiperendemicidad de la leishmaniasis canina en esta zona del país, así como el alto riesgo de brotes epidémicos de la enfermedad.ABSTRACTThe aim of this survey was to determine prevalence of antibodies against Leishmania in dogs from Sucre, Colombia. We analyzed 122 dogs in rural areas from municipalities of Sampués, Ovejas and Sincelejo, by indirect immunofluorescence (IFA. Anti-Leishmania antibodies were detected in 69.6 % (95 % CI = 61.1 to 78.2 of the selected canine population. In the municipality of Sincelejo, Sampues and Ovejas, the seropositivities were 72 % (95 % CI = 61.1 to 82.8, 68.4 % (95 % CI = 52.3 to 84.5 and 55.5 % (95 % CI = 21.2 to 86.3 respectively. Seropositive animals were mainly young and adult dogs. The 17.6 % of seropositive dogs showed clinical signs compatible with canine leishmaniasis; onychogryphosis, alopecia and cachexia were the most common ones. The detected high frequency of canines with antibodies against Leishmania in the

  18. Mordedura canina e atendimento antirrábico humano em Minas Gerais

    Directory of Open Access Journals (Sweden)

    V.M.R. Oliveira

    2012-08-01

    Full Text Available O objetivo do presente trabalho foi descrever e avaliar a mordedura canina e o atendimento antirrábico humano em Minas Gerais, de 1999 a 2004, correlacionando fontes de informação e áreas de risco predeterminadas para raiva humana transmitida por cão. Realizou-se um estudo observacional descritivo retrospectivo, utilizando-se, de forma adaptada, a análise exploratória de prontuários dos atendimentos da Superintendência de Epidemiologia da Secretaria de Estado da Saúde de Minas Gerais (339.012 de atendimentos, do Sistema de Informação de Notificação de Agravos, do Sistema de Informações sobre Mortalidade, do Sistema de Informações Hospitalares e do Programa Nacional de Imunizações (132.452 fichas. Para a classificação dos agravos, usou-se o Código Internacional de Doenças (10ª revisão. Os dados foram armazenados e analisados com auxílio dos softwares Epi-Info, Tab-Win e Office®. Verificou-se que o tratamento antirrábico humano é excessivo nas áreas de baixo e médio risco para raiva e, ao contrário, reduzido nas áreas de alto risco. O perfil do paciente é estudante masculino, menor de 14 anos, residente em área urbana de baixo risco para raiva humana transmitida por cão, com mordedura única nos membros, provocada por cão sadio e observável. Os sistemas de informação não oferecem a confiabilidade necessária ao médico responsável para a prescrição do tratamento antirrábico adequado. A profilaxia da raiva deve ter um aspecto multicêntrico, com interfaces na atenção tanto à saúde humana quanto à animal, o que não tem ocorrido, propiciando falhas na vigilância e no atendimento do agravo.

  19. Thidiazuron Triggers Morphogenesis in Rosa canina L. Protocorm-Like Bodies by Changing Incipient Cell Fate

    Science.gov (United States)

    Kou, Yaping; Yuan, Cunquan; Zhao, Qingcui; Liu, Guoqin; Nie, Jing; Ma, Zhimin; Cheng, Chenxia; Teixeira da Silva, Jaime A.; Zhao, Liangjun

    2016-01-01

    Thidiazuron (N-phenyl-N′-1,2,3-thiadiazol-5-ylurea; TDZ) is an artificial plant growth regulator that is widely used in plant tissue culture. Protocorm-like bodies (PLBs) induced by TDZ serve as an efficient and rapid in vitro regeneration system in Rosa species. Despite this, the mechanism of PLB induction remains relatively unclear. TDZ, which can affect the level of endogenous auxins and cytokinins, converts the cell fate of rhizoid tips and triggers PLB formation and plantlet regeneration in Rosa canina L. In callus-rhizoids, which are rhizoids that co-develop from callus, auxin and a Z-type cytokinin accumulated after applying TDZ, and transcription of the auxin transporter gene RcPIN1 was repressed. The expression of RcARF4, RcRR1, RcCKX2, RcCKX3, and RcLOG1 increased in callus-rhizoids and rhizoid tips while the transcription of an auxin response factor (RcARF1) and auxin transport proteins (RcPIN2, RcPIN3) decreased in callus-rhizoids but increased in rhizoid tips. In situ hybridization of rhizoids showed that RcWUS and RcSERK1 were highly expressed in columella cells and root stem cells resulting in the conversion of cell fate into shoot apical meristems or embryogenic callus. In addition, transgenic XVE::RcWUS lines showed repressed RcWUS overexpression while RcWUS had no effect on PLB morphogenesis. Furthermore, higher expression of the root stem cell marker RcWOX5 and root stem cell maintenance regulator genes RcPLT1 and RcPLT2 indicated the presence of a dedifferentiation developmental pathway in the stem cell niche of rhizoids. Viewed together, our results indicate that different cells in rhizoid tips acquired regeneration competence after induction by TDZ. A novel developmental pathway containing different cell types during PLB formation was identified by analyzing the endogenous auxin and cytokinin content. This study also provides a deeper understanding of the mechanisms underlying in vitro regeneration in Rosa. PMID:27200031

  20. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.

  1. Bioactive ingredients of rose hips (Rosa canina L with special reference to antioxidative and anti-inflammatory properties: in vitro studies

    Directory of Open Access Journals (Sweden)

    Winther K

    2016-02-01

    Full Text Available Kaj Winther,1 Anne Sophie Vinther Hansen,1 Joan Campbell-Tofte2 1Department of Nutrition, Exercise and Sports, University of Copenhagen, Frederiksberg C, Denmark; 2Coordinating Research Unit, Frederiksberg University Hospital, Copenhagen, Denmark Abstract: Rosa canina pseudo fruits, often referred to as rose hips, have been used as herbal medicine for more than 2,000 years, yet research has only recently begun to clarify specific mechanisms by which this plant product affects human health. Numerous compounds have been identified, and speculations of their bioactivity have implicated flavonoids, carotenoids, and fatty acids (FAs. With more than 4,500 representatives, flavonoids have been subjected to comprehensive research, with results that suggest various individual structures may be health-promoting compounds, also in rose hips. The importance of carotenoids from R. canina is currently being debated, because the demonstration of specific bioactivity among this group is presently less clear. The benefits of specific FAs have been investigated for decades, and several types of FAs are termed “essential” for human health. The specific mechanisms for bioactivity associated with three FAs that are abundant in R. canina fruits have been clarified in research. For example, linoleic acid, α-linolenic acid (mostly present in the seeds from R. canina and a galactolipid ((2S-1,2-di-O-[(9Z,12Z,15Z-octadeca-9-12-15-trienoyl]-3-O-β-d-galactopyranosyl glycerol, referred to as GOPO, have been shown to have anti-inflammatory properties. The aim of this review is to critically analyze the published literature on rose hip research, with emphasis on the broadness and varying significance of the publications. Initially, we describe the chemical ingredients of R. canina pseudo fruits, with some focus on what ingredients are found in the whole pseudo fruit and what we know is confined to the seeds (achene seeds, and/or the shells (hypanthium. Then, we evaluate

  2. Estudi de la resistència i la susceptibilitat genètica a la leishmaniosi canina

    OpenAIRE

    Sánchez i Robert, Elisenda

    2008-01-01

    Consultable des del TDX Descripció del recurs: el 8 octubre 2008 Títol obtingut de la portada digitalitzada La leishmaniosi canina és una zoonosi causada pel paràsit Leishmania infantum, sent el gos el principal reservori. És endèmica de la conca Mediterrània, de l'orient Mitjà i d'Amèrica del Sud arribant la prevalença de la infecció en aquestes zones al 67%. A més, és una malaltia en expansió ja que recentment s'han descrit casos als Estats Units i Regne Unit. L'objectiu d'aquesta ...

  3. Factors genètics de la leishmaniosi canina: caracterització del Nramp1 com a gen candidat

    OpenAIRE

    Altet i Sanahujes, Laura

    2002-01-01

    Descripció del recurs: el 22 d'octubre de 2003 L'objectiu d'aquesta tesi és la recerca de gens candidats de resistència o susceptibilitat a leishmaniosi canina. Aquesta malaltia, que és endèmica en l'area mediterranea, és una zoonosi causada pel paràsit Leishmania infantum, on el gos és el principal reservori. A més, està guanyant molta importància en l'home, ja que ha esdevingut una de les coinfeccions principals en malalts del virus de la SIDA. El món dels gossos aporta un material molt ...

  4. Investigação de áreas de risco como metodologia complementar ao controle da leishmaniose visceral canina

    OpenAIRE

    Fred S. Julião; Bárbara M.P.S. Souza; FREITAS,DANIELA S. DE; Oliveira, Lídia S. de; Larangeira,Daniela F.; Dias-Lima, Artur G.; Souza,Verena M.M.; Stella M. Barrouin-Melo; Moreira Jr,Edson D.; Paule, Bruno J.A.; Franke, Carlos R.

    2007-01-01

    Foram investigadas áreas de risco de leishmaniose visceral canina no município de Camaçari, Bahia. Um total de 278 cães distribuídos em 141 residências, pertencentes a 20 áreas de risco investigadas, foi examinado sorologicamente (ELISA). A soroprevalência geral foi 21,7% (56/258) depois da exclusão dos 20 cães usados no início do estudo para delimitar a área. Os resultados respectivos das análises univariada e multivariada dos fatores relacionados à infecção do cão por Leishmania chagasi, a ...

  5. Focos de dirofilariose canina na Ilha do Marajó: um fator de risco para a saúde humana

    OpenAIRE

    Garcez,Lourdes Maria; SOUZA, Nazaré Fonseca de; Mota, Eduardo Ferreira; Dickson,Luís Antonio Jerônimo; Abreu,Wandercleyson Uchoa; Cavalcanti,Vânia de Fátima do Nascimento; Gomes,Patrick Abdala Fonseca

    2006-01-01

    A ocorrência de dirofilariose pulmonar humana relaciona-se com a prevalência de infecção por Dirofilaria immitis na população canina. Várias espécies de mosquitos são vetores desse nematóide. Analisaram-se amostras de sangue canino coletados nas vilas Pingo d'Água e União, município de Salvaterra (Ilha do Marajó, PA), em junho, 2004 (n=34) e abril, 2005 (N=90). Os diagnósticos parasitológico e imunológico (ELISA - kit SNAP® 3DX™, Biobrasil) foram comparados (chi2, alfa=0,05) no exame de...

  6. Next-generation sequencing yields the complete mitochondrial genome of the longfang moray, Enchelynassa canina (Anguilliformes: Muraenidae).

    Science.gov (United States)

    Loh, Kar-Hoe; Shao, Kwang-Tsao; Chen, Hong-Ming; Chen, Ching-Hung; Loo, Poh-Leong; Hui, Amy Then Yee; Lim, Phaik-Eem; Chong, Ving-Ching; Shen, Kang-Ning; Hsiao, Chung-Der

    2016-07-01

    In this study, the complete mitogenome sequence of the longfang moray, Enchelynassa canina (Anguilliformes: Muraenidae) has been sequenced by the next-generation sequencing method. The length of the assembled mitogenome is 16,592 bp, which includes 13 protein coding genes, 22 transfer RNAs, and 2 ribosomal RNAs genes. The overall base composition of longfang moray is 28.4% for A, 28.0% for C, 18.4% for G, 25.1% for T, and show 82% identities to Kidako moray, Gymnothorax kidako. The complete mitogenome of the longfang moray provides an essential and important DNA molecular data for further phylogeography and evolutionary analysis for moray eel phylogeny.

  7. Factors genètics de la leishmaniosi canina: caracterització del Nramp1 com a gen candidat

    OpenAIRE

    Altet i Sanahujes, Laura

    2003-01-01

    Descripció del recurs: el 22 d'octubre de 2003 L'objectiu d'aquesta tesi és la recerca de gens candidats de resistència o susceptibilitat a leishmaniosi canina. Aquesta malaltia, que és endèmica en l'area mediterranea, és una zoonosi causada pel paràsit Leishmania infantum, on el gos és el principal reservori. A més, està guanyant molta importància en l'home, ja que ha esdevingut una de les coinfeccions principals en malalts del virus de la SIDA. El món dels gossos aporta un material molt ...

  8. Isolation and characterization of a cyanobacterium-binding protein and its cell wall receptor in the lichen Peltigera canina.

    Science.gov (United States)

    Díaz, Eva-María; Sacristán, Mara; Legaz, María-Estrella; Vicente, Carlos

    2009-07-01

    Peltigera canina, a cyanolichen containing Nostoc as cyanobiont, produces and secretes arginase to a medium containing arginine. Secreted arginase acts as a lectin by binding to the surface of Nostoc cells through a specific receptor which develops urease activity. The enzyme urease has been located in the cell wall of recently isolated cyanobionts. Cytochemical detection of urease is achieved by producing a black, electron-dense precipitate of cobalt sulfide proceeding from CO(2) evolved from urea hydrolysis in the presence of cobalt chloride. This urease has been pre-purified by affinity chromatography on a bead of active agarose to which arginase was attached. Urease was eluted from the beads by 50 mM alpha-D-galactose. The experimentally probed fact that a fungal lectin developing subsidiary arginase activity acts as a recognition factor of compatible algal cells in chlorolichens can now been expanded to cyanolichens.

  9. Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

    OpenAIRE

    Carine Fernandes B.; Marcelo José V.; Ricardo Junqueira Del C.; Liana Mesquita V.; Mastoby Martinez M.

    2012-01-01

    RESUMENObjetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquími...

  10. AGLUTINACIÓN EN LÁTEX, ELISA Y HEMOAGLUTINACIÓN: ALTERNATIVAS PARA EL DIAGNÓSTICO DE LA PARVOVIROSIS CANINA EN HECES

    Directory of Open Access Journals (Sweden)

    Ramírez G. C.

    2005-12-01

    Full Text Available En vista de su alta morbilidad y letalidad, se han desarrollado varios métodos para el diagnóstico de la parvovirosis canina. Los más utilizados se basan en la detección de partículas virales excretadas en las heces durante la fase aguda de la enfermedad. Algunos requieren equipos especializados, lo que aumenta los costos y el tiempo de diagnóstico. Por esto, la simplificación de los métodos de diagnóstico con alta sensibilidad y especificidad es prioritaria. Este trabajo presenta el desarrollo de la técnica de aglutinación en látex para el diagnóstico de la parvovirosis canina en heces, comparada con un ELISA comercial y una hemoaglutinación. Sobre una población de 71 caninos con signos compatibles con parvovirosis canina, utilizando la prueba ELISA (SNAP® como referencia, se seleccionaron 21 caninos positivos. Empleando las muestras de materia fecal de los animales positivos se desarrollaron y compararon las pruebas de hemoaglutinación y aglutinación en látex. Se encontró una sensibili¬dad del 100% y una especificidad del 100% para aglutinación en látex y una sensibilidad del 95% y una especificidad del 100% para hemoaglutinación. Dada la sencillez de la prueba, los resultados obtenidos y sus costos, se recomienda la prueba de aglutinación en látex para el diagnóstico rápido y seguro de la parvovirosis canina.

  11. 车道线识别中的自适应Canny边缘检测及改进研究%Achievement and Improvement of Adaptive Canny Operator in Lane Identification

    Institute of Scientific and Technical Information of China (English)

    陈阳舟; 闫豪杰; 辛乐

    2012-01-01

    针对Canny边缘检测阈值在车道线识别中不易选取的问题,提出了基于Otsu算法实现自适应Canny边缘检测的方法.实验验证表明,其对远视野道路图像可以获得良好的边缘检测效果,而对近视野道路图像效果较差.进一步提出了目标区域补偿策略改进上述算法.结合Hough变换算法,实现了车道线的识别.实验结果表明,改进的算法可以达到实时获取车道线的要求.%For the difficulty of selecting the segmentation threshold in the process of Canny operator-based lane I-dentification, a method of adaptive segmentation threshold in virtue of Otsu algorithm is proposed. Experiments to verify the effectiveness of the algorithm show that it can get good binarization results for far field images, but unavailability for close vision images. Therefore, further improvement is made by proposing a target area compensation strategy. Finally, combining with Hough transform, the lane recognition is ultimately achieved. The Experimental results show that the improved algorithm meet real-time performance of lane detection and identification.

  12. FATORES EPIDEMIOLÓGICOS ASSOCIADOS E NOVAS ABORDAGENS DIAGNÓSTICAS PARA LEISHMANIOSE E BABESIOSE CANINA NO MUNICÍPIO DE SÃO LUÍS-MA, BRASIL

    OpenAIRE

    ANDRESSA ALMEIDA SANTANA

    2011-01-01

    A babesiose canina e a leishmaniose visceral canina são doenças transmitidas por vetores, sendo os cães competentes reservatórios e fonte alimentar dos artrópodes envolvidos. Babesia canis vogeli, é um parasita intraeritrocitário transmitido pelo carrapato Rhipicephalus sanguineus. Leishmania infantum (sin. Leishmania chagasi) transmitidos a mamíferos pela picada dos flebotomíneos (Lutzomyia longipalpis), infectando macrófagos do Sistema Fagocítico Mononuclear do hospedeiro. O presente trabal...

  13. Correlación de factores pronóstico clínicos, histopatológicos e inmunohistoquímicos en lesiones neoplásicas mamarias malignas en la especie canina

    OpenAIRE

    Pastor Sirvent, Nieves

    2016-01-01

    El objetivo final de este estudio ha sido analizar si la interacción de ciertos factores clínicos, morfológicos e inmunohistoquímicos tienen influencia sobre la evolución del carcinoma mamario en la especie canina. En este trabajo se ha realizado un examen retrospectivo previo sobre 858 pacientes para determinar la incidencia e importancia de la patología oncológica mamaria en las hembras de la especie canina, mediante el análisis de variables epidemiológicas (raza, mestizaje, edad y ta...

  14. Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

    Science.gov (United States)

    Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

    2016-01-01

    Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.

  15. Potent anti-obese principle from Rosa canina: structural requirements and mode of action of trans-tiliroside.

    Science.gov (United States)

    Ninomiya, Kiyofumi; Matsuda, Hisashi; Kubo, Mizuho; Morikawa, Toshio; Nishida, Norihisa; Yoshikawa, Masayuki

    2007-06-01

    The 80% aqueous acetone extracts from the fruit (50 mg/kg/d) and seeds (12.5 and 25 mg/kg/d) of Rosa canina L., but not from the pericarps, were found to show substantial inhibitory effect on the gain of body weight and/or weight of visceral fat without affecting food intake in mice for 2 weeks after administration of the extracts. With regard to the active constituents, the principal constituent, trans-tiliroside (0.1-10 mg/kg/d), potently inhibited the gain of body weight, especially visceral fat weight, and significantly reduced blood glucose levels after glucose loading (1 g/kg, ip) in mice. On the other hand, kaempferol and p-coumaric acid lacked such effect and kaempferol 3-O-beta-D-glucopyranoside tended to reduce the gain of body weight and visceral fat weight, but not significantly, at a dose of 10 mg/kg/d. These results indicate the importance of both kaempferol 3-O-beta-D-glucopyranoside and p-coumaroyl moieties for anti-obese effects. Furthermore, a single oral administration of trans-tiliroside at a dose of 10 mg/kg increased the expression of PPAR-alpha mRNA of liver tissue in mice.

  16. Hernia perineal canina: reconstrucción del diafragma pélvico con malla de polipropileno a través de doble abordaje

    OpenAIRE

    Fernández Martín, Araceli

    2016-01-01

    La hernia perineal es una patología que se presenta en el macho de la especie canina de forma casi exclusiva, apareciendo de forma muy esporádica en la hembra y el gato, pero no se presenta en las otras especies domésticas. Se ha descrito en la especie humana sobre todo asociada a cirugías agresivas del abdomen caudal y siempre en relación a trastornos del suelo pélvico. En el perro la hernia perineal se produce por un fallo del diafragma pélvico, en el que destaca la atrofia y a veces la tot...

  17. Estudio epidemiológico de las patologías corneales en la especie canina en el Hospital Docente Universitario durante el periodo 2001-2011

    OpenAIRE

    2013-01-01

    Programa de doctorado: Clínica e investigación terapéutica. [ES] Objetivos: Describir y analizar, desde un punto de vista clínico-epidemiológico las patologías corneales de los pacientes de especie canina atendidos en el Hospital Clínico Veterinario de la ULPGC durante el período comprendido entre los años 2001 y 2011. Obtener resultados que puedan ayudar a mejorar el diagnóstico y el protocolo de manejo de las diferentes enfermedades corneales. Desarrollar un modelo experimental de diagnó...

  18. Desarrollo de piómetra y su relación con ovarios poliquísticos en hembras caninas

    OpenAIRE

    Duarte, Luz Soraya; Sánchez Pico, Favio; Ortega, Carolina

    2014-01-01

    El presente trabajo tuvo como objetivo encontrar una relación entre el desarrollo del complejo hiperplasia endometrial quística (heq) - piómetra y los ovarios poliquísticos, por medio de la observación y las mediciones macroscópicas de úteros de pacientes caninas diagnosticadas con piómetra, a las que se les hizo cirugía de ovariouterotomía para la resolución del problema; dichos órganos fueron obtenidos en dos clínicas de Bucaramanga. Todas las variables registradas fueron tabuladas en Excel...

  19. Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

    Directory of Open Access Journals (Sweden)

    Carine Fernandes B.

    2012-08-01

    Full Text Available Objetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquímica la técnica de la avidina- biotina- peroxidasa, con utilización del anticuerpo monoclonal 32-2B (anti-desmogléina-1. Resultados. A los estudios histológicos y morfológicos las células de la glándula mamaria normal humana demostraron semejanzas con las células de la glándula mamaria normal canina. Se observó adhesión y proliferación de células normales en ambas especies por aproximadamente tres meses de cultivo. Las células normales de las especies humana y canina mostraron baja actividad de proliferación cuando se compararon con las cancerosas de las especies en estudio. Los grupos de células epiteloides que se adhirieron al sustrato de los dos cultivos tuvieron dependencia de las células estromales, porque en la medida que las células fibroblastoides se retiraron, las células epiteloides detuvieron su crecimiento. Conclusiones. Comparando los resultados obtenidos por medio de análisis inmuno-histoquímico de células normales de mujeres y perras fue posible observar cambios en el patrón de coloración en células cancerosas en ambas especies, demostrando que las estructuras relacionadas con la adhesión celular (desmosomas pueden estar alteradas.

  20. ??ndice de distracci??n en el diagn??stico de la displasia de cadera en razas caninas aut??ctonas castellano-leonesas: el Perdiguero de Burgos

    OpenAIRE

    Melo Alonso, Beatriz

    2012-01-01

    376 p. Siendo el Perdiguero de Burgos (PB) es una de las razas caninas aut??ctonas de Castilla y Le??n m??s importantes, y no habi??ndose llevado a cabo un control radiogr??fico de la laxitud articular pasiva (LPA) de la cadera en la misma; y considerando que la LPA es el primer factor de riesgo para el desarrollo de la displasia de cadera (DC), y habi??ndose desarrollado t??cnicas diagn??sticas cl??nicas y radiogr??ficas para evaluarla, hemos considerado oportuno: En primer lugar, en 5...

  1. Manejo clínico y diagnóstico terapéutico de un caso presuntivo de anemia hemolítica inmunomediada canina

    OpenAIRE

    Solano-Rodríguez, José Pablo; Suárez-Esquivel, Marcela; Astorga-Miranda, Nancy

    2015-01-01

    Las enfermedades autoinmunes (EAI) continúan representando un gran reto diagnóstico en medicina veterinaria y pueden ser confundidas fácilmente con otras patologías. El objetivo de este trabajo es ilustrar dicha situación con un caso presuntivo de anemia hemolítica autoinmune canina, una de las EAI más frecuente en caninos. Este caso fue atendido en el Hospital de Especies Menores y Silvestres de la Escuela de Medicina Veterinaria de la Universidad Nacional.Se recibió una hembra Pastor Austra...

  2. Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda

    OpenAIRE

    1999-01-01

    Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI) canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers") e ensaios biológicos: 1) os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2) os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3) o A23187, vasodila...

  3. Miastenia gravis canina: Um diagnóstico diferencial para doenças infecciosas de origem neurológica. Relato de Caso

    OpenAIRE

    Gadêlha, Kamylla Moura; Universidade Federal Rural do Semi-Árido (UFERSA), Mossoró, RN, Brasil; Oliveira, Ilanna Vanessa Pristo de Medeiros; Universidade Federal Rural do Semi-Árido, Mossoró, Rio Grande do Norte, Brasil.; Macêdo, Luã Barbalho de; Universidade Federal Rural do Semi-Árido, Mossoró, Rio Grande do Norte, Brasil.; Pimentel, Muriel Magda Lustosa; Universidade Federal Rural do Semi-Árido (UFERSA); Calado, Eraldo Barbosa; Universidade Federal Rural do Semi-Árido (UFERSA), Mossoró, RN, Brasil.; Costa, Mirela Tinucci; Faculdade de Ciências Agrárias e Veterinárias de Jaboticabal, Universidade Estadual Paulista Júlio de Mesquita Filho, Jaboticabal, SP, Brasil; Filgueira, Kilder Dantas; Universidade Federal Rural do Semi-Árido (UFERSA), Mossoró, RN, Brasil.

    2015-01-01

    A Miastenia gravis (MG) é uma desordem neuromuscular causada por uma redução no número de receptores nicotínicos funcionais de acetilcolina na membrana pós-sináptica. Algumas doenças neurológicas infecciosas podem mimetizar o quadro. O trabalho objetivou descrever um caso de MG na espécie canina, explicitando a conduta no diagnóstico e terapia, além de realizar o discernimento para as principais doenças infecciosas, de repercussão neurológica, que possam apresentar sintomatologia similar. Um ...

  4. Dieta del perro (canis familiaris) y sus interacciones con la fauna silvestre de la cuenca alta del Río Otún-Risaralda (Colombia)

    OpenAIRE

    2015-01-01

    El perro (Canis familiaris) interactúa con la fauna silvestre principalmente por medio de la depredación, competencia y transmisión de enfermedades. Sin embargo, no se conoce con mucha claridad cómo se presentan estas interacciones. Para responder a este interrogante, en este trabajo se identificó la dieta del perro y la presencia de la enfermedad de Parvovirus (CPV). A partir de esta información, contrastada con el conocimiento de los pobladores del área de estudio, se determinaron las posib...

  5. Distribución de mastocitos del estroma de la glándula mamaria de perra (Canis familiaris), en periodos activo e inactivo

    OpenAIRE

    Héctor Villaseñor Gaona; Rosa Emilia Laville; Santiago R. Anzaldúa Arce; Mario Pérez Martínez

    1999-01-01

    Los mastocitos (MC) son células del tejido conjuntivo que participan activamente en los mecanismos de comunicación paracrina mediante la liberación de diversos mediadores químicos contenidos en sus gránulos. El presente estudio se efectuó con el propósito de evaluar la distribución de los MC en la glándula mamaria de la perra (Canis familiaris), en periodos activo e inactivo. Las muestras de tejido mamario se obtuvieron a partir de perras adultas. Dichas muestras se procesaron siguiendo el mé...

  6. Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris)?

    Science.gov (United States)

    Owczarczak-Garstecka, Sara C.; Burman, Oliver H. P.

    2016-01-01

    Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris) housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts). There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as ‘relaxed’ across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect. PMID:27732667

  7. Neospora Caninum and Leishmania Infantum Co-Infection in Domestic Dogs (Canis Familiaris in Meshkin-Shahr District, Northwestern Iran

    Directory of Open Access Journals (Sweden)

    A Rahimi Foroushani

    2011-12-01

    Full Text Available Background: Mediterranean visceral leishmaniasis (MVL is an infectious disease that affects both human and ani­mals. Domestic dogs (Canis familiaris are principal reservoir hosts of MVL caused by Leishmania infantum. Dogs are definitive hosts for Neospora caninum and a risk factor for infecting intermediate hosts. The immunosuppression caused by visceral leishmaniasis (VL can promote the occurrence of co-infections with other agents such as neosporo­sis. This study aimed to determine the frequency of co-infection of the both protozoan parasites in the en­demic areas of VL from Meshkin-Shahr District, north-west of Iran. Methods: Altogether, 171 serum samples were collected from domestic dogs of Meshkin- Shahr District by multistage cluster sampling from October 2008 to August 2009. The collected serum samples were tested for the detection of simultaneous infection of L. infantum and N. caninum using direct agglutination test (DAT and indirect ELISA, respectively. Results: Of the 171 domestic dogs, 27 (15.8% and 52 (30.4% were showed antibodies against L. infantum and N. caninum, respectively. Simultaneous infections of N. caninum and L. infantum was found in 16 (9.4% of the dogs. In VL-positive and VL-negative dogs, N. caninum infection was found in 59.3% and 25.0%, respectively. A statisti­cally significant difference was found between VL-positive and VL-negative dogs with N. caninum infection (P= 0.001. Conclusion: These findings indicate that Meshkin-Shahr District in northwestern Iran is an active focus of canine visceral leishmaniasis (CVL. Neospora caninum and L. infantum co-infection is prevalent in the area and infection by L. infantum seems to enhance susceptibility to N. caninum infection in domestic dogs.

  8. Neospora caninum and Leishmania infantum Co-Infection in Domestic Dogs (Canis familiaris in Meshkin-Shahr District, Northwestern Iran

    Directory of Open Access Journals (Sweden)

    M Sharifdini

    2011-12-01

    Full Text Available Background: Mediterranean visceral leishmaniasis (MVL is an infectious disease that affects both human and ani­mals. Domestic dogs (Canis familiaris are principal reservoir hosts of MVL caused by Leishmania infantum. Dogs are definitive hosts for Neospora caninum and a risk factor for infecting intermediate hosts. The immunosuppression caused by visceral leishmaniasis (VL can promote the occurrence of co-infections with other agents such as neosporo­sis. This study aimed to determine the frequency of co-infection of the both protozoan parasites in the en­demic areas of VL from Meshkin-Shahr District, north-west of Iran. Methods: Altogether, 171 serum samples were collected from domestic dogs of Meshkin- Shahr District by multistage cluster sampling from October 2008 to August 2009. The collected serum samples were tested for the detection of simultaneous infection of L. infantum and N. caninum using direct agglutination test (DAT and indirect ELISA, respectively. Results: Of the 171 domestic dogs, 27 (15.8% and 52 (30.4% were showed antibodies against L. infantum and N. caninum, respectively. Simultaneous infections of N. caninum and L. infantum was found in 16 (9.4% of the dogs. In VL-positive and VL-negative dogs, N. caninum infection was found in 59.3% and 25.0%, respectively. A statisti­cally significant difference was found between VL-positive and VL-negative dogs with N. caninum infection (P= 0.001. Conclusion: These findings indicate that Meshkin-Shahr District in northwestern Iran is an active focus of canine visceral leishmaniasis (CVL. Neospora caninum and L. infantum co-infection is prevalent in the area and infection by L. infantum seems to enhance susceptibility to N. caninum infection in domestic dogs.

  9. Physiological, physical and behavioural changes in dogs (Canis familiaris) when kennelled: testing the validity of stress parameters.

    Science.gov (United States)

    Part, C E; Kiddie, J L; Hayes, W A; Mills, D S; Neville, R F; Morton, D B; Collins, L M

    2014-06-22

    Domestic dogs (Canis familiaris) housed in kennelling establishments are considered at risk of suffering poor welfare. Previous research supporting this hypothesis has typically used cortisol:creatinine ratios (C/Cr) to measure acute and chronic stress in kennelled dogs. However, the value of C/Cr as a welfare indicator has been questioned. This study aimed to test the validity of a range of physiological, physical and behavioural welfare indicators and to establish baseline values reflecting good dog welfare. Measurements were taken from 29 privately-owned dogs (14 males, 15 females), ranging in age and breed, in their own home and in a boarding kennel environment, following a within-subjects, counterbalanced design. Pairwise comparisons revealed that C/Cr and vanillylmandelic acid:creatinine ratios (VMA/Cr) were higher in the kennel than home environment (P=0.003; P=0.01, respectively) and were not associated with differences in movement/exercise between environments. Dogs' surface temperature was lower in kennels (P=0.001) and was not associated with ambient temperature. No association with age, or effects of kennel establishment, kennelling experience, sex or source were found. Dogs were generally more active in kennels, but showed considerable individual variability. C/Cr and 5-HIAA:creatinine ratios (5-HIAA/Cr) were negatively correlated with lip licking in kennels. Baseline values for each parameter are presented. The emotional valence of responses was ambiguous and no definitive evidence was found to suggest that dogs were negatively stressed by kennelling. It was concluded that C/Cr and, particularly, VMA/Cr and surface temperature provide robust indicators of psychological arousal in dogs, while spontaneous behaviour might be better used to facilitate interpretation of physiological and physical data on an individual level.

  10. Influenza delle misure preventive sulla prevalenza di leishmaniosi canina in un focolaio identificato in Nord Italia nel 2006

    Directory of Open Access Journals (Sweden)

    Rudi Cassini

    2013-06-01

    Full Text Available La leishmaniosi canina è un'infezione endemica nel bacino del Mediterraneo con una documentata tendenza a diffondersi verso nord. L'uso massiccio di misure di protezione contro i rischi del contatto con i flebotomi (collari e formulazioni spot-on è stato studiato in un focolaio registrato in una zona collinare dei Colli Euganei in Italia nord-orientale nel 2006. Nel 2006 e 2007 sono stati testati i sieri di 449 cani provenienti dalla stessa zona. Trentuno animali (6,9% sono risultati positivi al test di immunofluorescenza indiretta (IFI. L'analisi dei fattori di rischio ha chiaramente dimostrato come il focolaio fosse limitato alla località di Calaone, situata nel comune di Baone (PD. Per verificare l'efficacia delle misure preventive adottate, nel 2010, 63 cani di Calaone sono stati campionati e i loro proprietari intervistati. In base alle informazioni rilasciate dai proprietari, la protezione dei cani nei confronti della leishmaniosi ha avuto inizio nel 2006 (66,7% dei cani protetti crescendo negli anni seguenti (90% dei cani protetti. Il valore di sieroprevalenza (4,2% della classe di cani di età più giovane (<5 anni è risultato significativamente minore di quello delle altre classi, dimostrando che gli animali nati dopo il 2006 hanno avuto meno probabilità di infettarsi. Inoltre, i valori di sieroprevalenza riferiti esclusivamente ai cani di Calaone sono risultati del 32,4% (23/71 nel 2006-2007 e 20,6% (13/63 nel 2010, mostrando una tendenza decrescente. I risultati ottenuti mostrano un alto livello di sensibilizzazione dei proprietari dei cani e sembrano evidenziare come l'uso pervasivo di collari e spot-on agisca positivamente nel ridurre l'intensità di circolazione di Leishmania infantum.

  11. Aspectos clínicos, morfológicos e imuno-histoquímicos da pitiose gastrintestinal canina

    Directory of Open Access Journals (Sweden)

    Maria E. Trost

    2009-08-01

    Full Text Available Através de um estudo retrospectivo dos casos de biópsias e necropsias de cães recebidos no Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria, constatou-se a ocorrência de dois casos confirmados e de quatro casos suspeitos de pitiose gastrintestinal canina. Os dois casos diagnosticados e publicados tiveram a etiologia confirmada através da cultura e indução de zoosporogênese ou por nested-PCR. Neste estudo utilizou-se a técnica de imuno-histoquímica com anticorpo policlonal anti-Pythium insidiosum para confirmação da etiologia dos quatro casos suspeitos. A epidemiologia, sinais clínicos, lesões macroscópicas e microscópicas, características histoquímicas e imuno-histoquímicas e diagnósticos diferenciais são relatados e discutidos.Four suspect and two confirmed cases of gastrointestinal pythiosis were found in a retrospective study of biopsy and necropsy cases of dogs received in the Laboratório de Patologia Veterinária at the Universidade Federal de Santa Maria. The two diagnosed and published cases have had the etiology confirmed by culture and zoosporogenesis induction or by nested-PCR. On this study, the etiologic diagnosis of four suspect cases was confirmed by immunohistochemistry using anti-Pythium insidiosum policlonal antibody. Epidemiology, clinical signs, gross and microscopic lesions, histochemistry, immunohistochemistry, and differential diagnoses are reported and discussed.

  12. Diagnóstico de la ehrlichiosis monocítica canina: una revisión actualizada

    Directory of Open Access Journals (Sweden)

    Roger Iván Rodríguez-Vivas

    2015-01-01

    Full Text Available La ehrlichiosis monocítica canina (EMC es causada por la infección de una rickettsia denominada Ehrlichia canis; este microorganismo se reproduce solamente en el citoplasma de los monocitos sanguíneos y macrófagos tisulares. La EMC ha sido reportada en todo el mundo, pero las frecuencias más altas se reportan en las regiones tropicales y subtropicales. La EMC no siempre es reconocida clínicamente, pues es difícil de diagnosticar debido a que los signos clínicos son variables, a que se presenta en diferentes fases y a la existencia de coinfecciones con otros patógenos transmitidos por garrapatas y otros agentes infecciosos. Las manifestaciones clínicas y las técnicas de diagnóstico tradicionales, como el diagnóstico hematológico y la demostración típica de mórulas de E. canis en el citoplasma de monocitos en frotis sanguíneos, se han utilizado para el diagnóstico de la EMC; sin embargo, las pruebas de diagnóstico por PCR y la serología mediante el uso de antígenos específicos son las pruebas más sensibles y específicas para el diagnóstico de la enfermedad. Este artículo presenta una revisión actualizada sobre el diagnóstico de la infección por E. canis en perros.

  13. Técnica Pasteur São Paulo para dimensionamento de população canina

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2002-10-01

    Full Text Available Este artigo apresenta técnica para dimensionar e classificar populações caninas, segundo graus de dependência e restrição. Foi desenvolvida pelo Instituto Pasteur de São Paulo, com a seguinte metodologia: (1 realização de um inquérito domiciliar para identificação dos cães com proprietário e do grau de restrição. Aos proprietários de cães restritos, totalmente ou parcialmente, e aos moradores que não se definiram como proprietários únicos foram entregues coleiras de três cores distintas, solicitando-lhes colocação nos cães sob seus cuidados; (2 contagem de cães que circulavam na rua e classificação conforme cor da coleira, cuja ausência identificou os cães sem proprietário. Os pesquisadores foram posicionados em locais pré-determinados, distantes em média cinqüenta metros. O tempo de cada contagem foi de trinta segundos, repetindo-se a cada 15 minutos, por uma hora, com início e término marcados por apito. A técnica, aplicada em dois setores censitários do Município de Serra Azul, Estado de São Paulo, Brasil, foi realizada por adolescentes de 13 a 17 anos, submetidos a um dia de treinamento. O procedimento foi simples e possibilitou acesso à informação de difícil obtenção, como o percentual de cães sem proprietário ou sem proprietário definido, que, no caso estudado, foi de 5%.

  14. Dirofilariose canina na Ilha de São Luís, Nordeste do Brasil: uma zoonose potencial

    Directory of Open Access Journals (Sweden)

    Silvia Maria Mendes Ahid

    Full Text Available Um inquérito sobre a prevalência da dirofilariose canina foi realizado entre 1.495 cães de 64 localidades na Ilha de São Luís, de 1991 a 1994, através da pesquisa de microfilárias. Desses, 1.358 cães (12,8% positivos não tinham história pregressa conhecida, sendo 1.265 errantes (10,3% microfilarêmicos e 93 domiciliados (37,8%. A dirofilariose foi detectada em 46 das localidade, porém a prevalência da infecção aumenta consideravelmente quando se trata de cães da orla marítima, de onde procederam 47% dos animais positivos. Em alguns bairros costeiros, a prevalência é elevada, como em Olho d'Água e Calhau (46% e 43% positivos, respectivamente. A pesquisa de microfilárias em 137 cães estritamente domiciliados (DO e com história pregressa conhecida (43% microfilarêmicos permitiu a comprovação da existência de transmissão na Ilha. Este estudo é o primeiro dessa natureza e abrangência realizado no Nordeste do País. Sabendo-se que a dirofilariose é uma zoonose, e diante da elevada prevalência de cães microfilarêmicos, particularmente os domiciliados da orla marítima da Ilha, chama-se a atenção para que se considere tal parasitose como possível causa de lesões pulmonares solitárias na população humana local e naquelas assentadas em áreas com clima e paisagem semelhantes no Nordeste.

  15. Prevalência da filariose canina causada por Dirofilaria immitis e Dipetalonema reconditum em Maceió, Alagoas, Brasil

    Directory of Open Access Journals (Sweden)

    Brito Ana Cristina

    2001-01-01

    Full Text Available A prevalência da filariose canina causada por Dirofilaria immitis e Dipetalonema reconditum, foi estimada após a realização de inquérito hemoscópico em 1.519 cães domiciliados. Foram examinados 1.097 cães nos sete distritos sanitários da cidade de Maceió, Alagoas, 204 na Ilha de Santa Rita e 218 na cidade de Paripueira. Em Maceió, foram detectados 15 (1,3% cães com microfilárias (MF de D. immitis e 15 (1,3% com MF de D. reconditum. Todos os casos positivos foram considerados autóctones. As MF de D. immitis e de D. reconditum mediram 298,1µm e 249,2µm de comprimento e 7,3µm e 4,4µm de largura, respectivamente. Além do diagnóstico parasitológico pela técnica de gota espessa (100µL, foi utilizado o teste imunológico Witness, para detecção de antígeno filarial circulante, o qual confirmou os dados parasitológicos e permitiu a detecção de casos de infecção oculta. De um total de 6.579 fêmeas examinadas, pertencentes a seis espécies de mosquitos, oito (0,1% fêmeas de Culex quinquefasciatus foram encontradas naturalmente infectadas com larvas de D. immitis. Estes resultados demonstram a presença simultânea de D. immitis e D. reconditum na mesma área geográfica.

  16. Dirofilariose canina na Ilha de São Luís, Nordeste do Brasil: uma zoonose potencial

    Directory of Open Access Journals (Sweden)

    Ahid Silvia Maria Mendes

    1999-01-01

    Full Text Available Um inquérito sobre a prevalência da dirofilariose canina foi realizado entre 1.495 cães de 64 localidades na Ilha de São Luís, de 1991 a 1994, através da pesquisa de microfilárias. Desses, 1.358 cães (12,8% positivos não tinham história pregressa conhecida, sendo 1.265 errantes (10,3% microfilarêmicos e 93 domiciliados (37,8%. A dirofilariose foi detectada em 46 das localidade, porém a prevalência da infecção aumenta consideravelmente quando se trata de cães da orla marítima, de onde procederam 47% dos animais positivos. Em alguns bairros costeiros, a prevalência é elevada, como em Olho d'Água e Calhau (46% e 43% positivos, respectivamente. A pesquisa de microfilárias em 137 cães estritamente domiciliados (DO e com história pregressa conhecida (43% microfilarêmicos permitiu a comprovação da existência de transmissão na Ilha. Este estudo é o primeiro dessa natureza e abrangência realizado no Nordeste do País. Sabendo-se que a dirofilariose é uma zoonose, e diante da elevada prevalência de cães microfilarêmicos, particularmente os domiciliados da orla marítima da Ilha, chama-se a atenção para que se considere tal parasitose como possível causa de lesões pulmonares solitárias na população humana local e naquelas assentadas em áreas com clima e paisagem semelhantes no Nordeste.

  17. GC×GC-TOF/MS Chromatographic Analysis, Antioxidant Capacity and Phenolic Content of Rosa Canina L. at Different Maturities

    Directory of Open Access Journals (Sweden)

    Dilek Ozyurt

    2016-01-01

    Full Text Available The relationship between food and health has become increasingly significant as consumers now demand healthy, tasty and natural foods which perform a useful function in the body. In Turkey, rose hip (Rosa canina L. is in popular use in foodstuffs such as marmalade, pestil (a traditional Turkish sweet and syrup or in traditional medicine, mainly as herbal tea. The composition, total antioxidant capacity (TAC and total phenolic content (TPC of volatiles of rose hip samples were compared in relation to their stage of maturity and collection location. Rose hip fruit and seed were analyzed using a direct thermal desorption technique coupled with comprehensive two-dimensional gas chromatography time-of-flight mass spectrometry (GCxGC-TOF/MS. The major components found in the volatile fraction released on extraction were free fatty acids. The various stages of maturity of rose hips (green, light yellow, yellow, orange and red coloured and the place of collection (Istanbul, Mersin, York resulted in some changes in volatile compound speciation, in TAC and TPC levels. Various extraction methods were compared; methanol extraction, traditional hot water infusion and boiling in water. Boiling in water for ten minutes was the method which demonstrated the highest extraction efficiency. TAC and TPC were determined using different electron transfer−based assays; the Cerium (IV ions reducing antioxidant capacity, Cupric Reducing Antioxidant Capacity and Folin-Ciocalteu methods. The highest TAC and TPC were found in the red coloured (fully ripe rose hip fruit, suggesting that colour is a suitable indicator for optimal harvesting time.

  18. Biofabrication of zinc oxide nanoparticles using fruit extract of Rosa canina and their toxic potential against bacteria: A mechanistic approach.

    Science.gov (United States)

    Jafarirad, Saeed; Mehrabi, Meysam; Divband, Baharak; Kosari-Nasab, Morteza

    2016-02-01

    The use of plant extract in the biosynthesis of nanoparticles (NPs) can be an eco-friendly approach and have been suggested as a possible alternative to classic methods namely physical and chemical procedures. In this study, the biosynthesis of zinc oxide (ZnO) NPs by both "conventional heating" (CH) and "microwave irradiation" (MI) methods has been reported. Stable and spherical ZnONPs were produced using zinc nitrate and flesh extract of Rosa canina fruit (rosehip) which was used as a precursor. The flesh extract acts as a reducing and capping agent for generation of ZnONPs. The structural, morphological and colloidal properties of the as-synthesized NPs have been confirmed by X-ray Diffraction (XRD), Scanning Electron Microscopy (SEM), Energy Dispersive X-ray (EDX), Fourier transform Infrared (FT-IR) and Dynamic Light Scattering (DLS). In comparison with the CH method, the MI method has some advantages such as significantly short reaction time (within 8min) owing to the high heating rate and thus the accelerated reaction rate. Both methods led to the synthesis of nearly identical NPs with respect to shape and size according to the results of DLS, XRD and SEM techniques. The possible mechanism for synthesis pathway has been proposed based on FT IR results, XRD patterns, potentiometric data and antioxidant activity. In addition, the antibacterial activity of as-prepared ZnONPs was investigated against several bacteria such as Listeria monocytogenes, Escherichia coli, Salmonella typhimurium. Moreover, the efficacy of ZnONPs to treat cancer cell lines were measured by means of cell viability test via MTT assay in which concentrations of 0.05 and 0.1mg/mL of ZnONPs induced a very low toxicity. Thus, the present investigation reveals that ZnONPs have the potential for various medical and industrial applications.

  19. Improve Algorithm of Radar Image 1/8 Interpolation Based on Canny Edge Detection Operator%基于Canny边缘检测算子的雷达图像1/8插值改进算法

    Institute of Scientific and Technical Information of China (English)

    达平; 张金林; 谷京朝

    2013-01-01

    As the image information of radar scanning image is of singleness, where most background is black, the amplification display using the conventional algorithm of 1/8 image interpolation not only results in the higher operation complexity and bigger processing delay, but also makes the image edge of radar target track completely obscure, thus hard to achieve the satisfactory visual effect. This paper puts forward an improved algorithm of radar image 1/8 interpolation in terms of Canny operator detecting radar scanning the edge of image. Experiment results show that the target edge of radar scanning image amplified by this proposed interpolation algorithm is clear, the algorithm complexity is lower, ease to be implemented in hardware and available for real-time image zooming. At present, this proposed algorithm has been applied to a certain system’s image processing module in radar station.%雷达扫描图像的图像信息单一,大部分为黑色背景,运用传统的1/8图像插值算法放大显示不仅运算复杂度高,处理延时大,而且会使雷达目标航迹的图像边缘十分模糊,难以得到满意的视觉效果。为此,结合Canny算子检测雷达扫描图像的边缘,提出了一种雷达图像1/8插值改进算法。实验结果表明,经本文算法插值放大的雷达扫描图像的目标边缘清晰,且算法复杂度较低,便于硬件实现,可实现实时图像缩放。目前该算法已成功应用于雷达站某系统的图像处理模块。

  20. How do guide dogs and pet dogs (Canis familiaris) ask their owners for their toy and for playing?

    Science.gov (United States)

    Gaunet, Florence

    2010-03-01

    When apes are not fully understood by humans, they persist with attempts to communicate, elaborating their behaviours to better convey their meaning. Such abilities have never been investigated in dogs. The present study aimed to clarify any effect of the visual attentional state of the owner on dogs' (Canis familiaris) social-communicative signals for interacting with humans, and to determine whether dogs persist and elaborate their behaviour in the face of failure to communicate a request. Gaze at a hidden target or at the owner, gaze alternation between a hidden target and the owner, vocalisations and contacts in 12 guide and 12 pet dogs were analysed (i) when the dogs were asked by their owners (blind or sighted) to fetch their inaccessible toy and (ii) when the dogs were subsequently given an unfamiliar object (apparent unsuccessful communication) or their toy (apparent successful communication). No group differences were found, indicating no effect of the visual status of the owner on the dogs' socio-communicative modes (i.e. no sensitivity to human visual attention). Results, however, suggest that the dogs exhibited persistence (but not elaboration) in their "showing" behaviours in each condition, except that in which the toy was returned. Thus, their communication was about a specific item in space (the toy). The results suggest that dogs possess partially intentional non-verbal deictic abilities: (i) to get their inaccessible toy, the dogs gazed at their owners as if to trigger their attention; gaze alternation between the owner and the target direction, and two behaviours directed at the target were performed, apparently to indicate the location of the hidden toy; (ii) after the delivery of the toy, the dogs behaved as if they returned to the play routine, gazing at their owner whilst holding their toy. In conclusion, this study shows that dogs possess partially intentional non-verbal deictic abilities: they exhibit successive visual orienting between a

  1. Biofabrication of zinc oxide nanoparticles using fruit extract of Rosa canina and their toxic potential against bacteria: A mechanistic approach

    Energy Technology Data Exchange (ETDEWEB)

    Jafarirad, Saeed; Mehrabi, Meysam [Research Institute for Fundamental Sciences (RIFS), University of Tabriz, Tabriz (Iran, Islamic Republic of); Divband, Baharak [Research Center for Pharmaceutical Nanotechnology, Tabriz University of Medical Sciences, Tabriz (Iran, Islamic Republic of); Inorganic Chemistry Department, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Kosari-Nasab, Morteza [Drug Applied Research Center, Tabriz University of Medical Sciences, Tabriz (Iran, Islamic Republic of)

    2016-02-01

    The use of plant extract in the biosynthesis of nanoparticles (NPs) can be an eco-friendly approach and have been suggested as a possible alternative to classic methods namely physical and chemical procedures. In this study, the biosynthesis of zinc oxide (ZnO) NPs by both “conventional heating” (CH) and “microwave irradiation” (MI) methods has been reported. Stable and spherical ZnONPs were produced using zinc nitrate and flesh extract of Rosa canina fruit (rosehip) which was used as a precursor. The flesh extract acts as a reducing and capping agent for generation of ZnONPs. The structural, morphological and colloidal properties of the as-synthesized NPs have been confirmed by X-ray Diffraction (XRD), Scanning Electron Microscopy (SEM), Energy Dispersive X-ray (EDX), Fourier transform Infrared (FT-IR) and Dynamic Light Scattering (DLS). In comparison with the CH method, the MI method has some advantages such as significantly short reaction time (within 8 min) owing to the high heating rate and thus the accelerated reaction rate. Both methods led to the synthesis of nearly identical NPs with respect to shape and size according to the results of DLS, XRD and SEM techniques. The possible mechanism for synthesis pathway has been proposed based on FT IR results, XRD patterns, potentiometric data and antioxidant activity. In addition, the antibacterial activity of as-prepared ZnONPs was investigated against several bacteria such as Listeria monocytogenes, Escherichia coli, Salmonella typhimurium. Moreover, the efficacy of ZnONPs to treat cancer cell lines were measured by means of cell viability test via MTT assay in which concentrations of 0.05 and 0.1 mg/mL of ZnONPs induced a very low toxicity. Thus, the present investigation reveals that ZnONPs have the potential for various medical and industrial applications. - Highlights: • We report a green producing route from biomaterials to potentially biomedical applications. • We comprise two methods in respect

  2. Citometria de fluxo no diagnóstico da leishmaniose visceral canina Flow cytometry used in canine visceral leishmaniasis diagnosis

    Directory of Open Access Journals (Sweden)

    A.V. Carvalho Neta

    2006-08-01

    Full Text Available Descreve-se a padronização de nova metodologia para detecção de anticorpos antiformas promastigotas fixadas de L. (L. chagasi, por citometria de fluxo (AAPF-IgG, sua aplicabilidade e desempenho na identificação de casos de leishmaniose visceral canina (LVC. Foram avaliados dois grupos de cães classificados pela reação de imunofluorescência indireta (RIFI, como: não reatores (NR, n=10 e reatores (R, n=50 dos quais foram coletadas amostras de sangue (soro para realização dos testes laboratoriais. Os resultados relacionados ao estabelecimento, aplicabilidade e desempenho da metodologia AAPF-IgG demonstraram que essa metodologia possibilita a identificação de uma região de reatividade diferencial entre cães NR e R, no soro diluído a 1:2048 e o valor de 20% de parasitos fluorescentes positivos (PPFP como ponto de corte entre resultados positivos e negativos, mostrando que a AAPF-IgG aplica-se na identificação de casos de LVC, possibilitando distinguir 96% de cães R como positivos e 100% de cães NR como negativos. Esses resultados em conjunto sugerem que a utilização da AAPF-IgG pode ser um novo instrumento para ensaios clínicos de diagnóstico sorológico da LVC.The current study evaluated the standardization of a new methodology for detection of anti-fixed L. (L. chagasi promastigote antibodies by flow cytometry (AAPF-IgG, as well its applicability and performance in the identification of cases of Canine Visceral Leishmaniasis (CVL. Two groups of dogs were classified by RIFI (gold standard as no reactors (NR, n=10 and reactors (R, n=50. Blood samples were collected and used for the laboratorial tests (RIFI and AAPF-IgG. The results showed that the new AAPF-IgG assay makes possible the identification of an area of differential reactivity between dogs NR and R at the dilution of 1:2048 and 20% of percentage of positive fluorescent parasite as the cut point among positive and negative results. The AAPF-IgG assay was able to

  3. AVALIAÇÃO DA FREQUÊNCIA DE CASOS DE LESISHMANIOSE VISCERAL CANINA NA REGIÃO DE BEBEDOURO

    Directory of Open Access Journals (Sweden)

    PAZZINI, J. M.

    2010-05-01

    ística descritiva. Desta forma, conclui-se que a regiãode Bebedouro -SP está isenta de casos de Leishmaniose visceral canina, mas foi confirmado três casos emhumanos, sendo assim , os cuidados devem continuar, por meio do combate dos mosquitos transmissores emedidas sanitárias.

  4. Extraction and Characterization of Phenolic Compounds from Rose Hip (Rosa canina L. Using Liquid Chromatography Coupled with Electrospray Ionization - Mass Spectrometry

    Directory of Open Access Journals (Sweden)

    Andreea STĂNILĂ

    2015-12-01

    Full Text Available Wild berry are a rich of natural compounds which provide them high antioxidant potential. The compounds which provide them these proprieties are known to be vitamins, flavonoids, anthocyanins and phenolic acids. The aim of this study was to extract and characterize bioactive compounds from rose hip (Rosa canina L. currently found in Romania. A qualitative high-performance liquid chromatography coupled with electrospray ionization mass spectrometric (ESI-MS detection in positive ion mode has been used to identify phenolic compounds from rose hip crude extract. The chromatograms revealed the presence of a large number of compounds (19, identified and grouped as phenolic acids and flavones/ols, flavan-3-ols and also anthocyanins. Based on obtained results these berries can be highly recommended as part of our diet. Also this finding represents a contribution to the chemical characterization of phenolic profile of rose hip.

  5. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Rigét, Frank F; Beck Jensen, Jens-Erik

    2008-01-01

    ) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n=26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n=15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata......) blubber as main lipid sources. The results showed that BMD increased significantly with age (linear regression: p0.3). No differences in BMD(femur) or BMD(vertebrae) between exposed and control...... individuals in the bitch generation were found (linear mixed effect model: both p>0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMD(femur), BMD(vertebrae) and groups of OHCs...

  6. Susceptibilidad canina a rabia después de una campaña de vacunación en zonas endémicas del Perú

    OpenAIRE

    2007-01-01

    Objetivo: Determinar el nivel de la respuesta inmune posterior a una campaña de vacunación antirrábica canina en dos zonas que han presentado en los últimos años casos de rabia canina. Materiales y métodos: Se realizó una encuesta serológica, en 101 y 199 canes localizados en los distritos de Tambo Grande (Piura) y Juliaca (Puno) respectivamente y se efectuó la prueba del seroneutralización en ratón para determinar la proporción de canes con anticuerpos protectores (¡Ý 0,5 UI/mL) según zona d...

  7. EVOLUCIÓN DE LA SOCIALIDAD, ESTRATEGIAS ALIMENTARIAS Y ANATOMÍA CRÁNEODENTAL EN LA SUBFAMILIA CANINAE Evolution of Sociality, Diet, and Craniodental Anatomy in the Subfamly Caninae

    Directory of Open Access Journals (Sweden)

    JOAO MUÑOZ-DURÁN

    2012-04-01

    organization of ancestral and modern mammal communities. Thus, it is important to identify what extinct carnivore species may have been social and to determine when, where and under which environmental contexts they evolved. The first step is to establish if there is an association between morphological traits, susceptible of being preserved in the fossil record, and differences in the degree of sociality of present day carnivores. The aim of this research was to establish if there is an association between variation in shape and variables related to mechanical properties of the skulls, and differences in sociality level, diet and sex in modern canids. The sample included 972 specimens of 33 canid species. We analyzed the shape of the lateral side of the cranium, zygomatic arch, dentary bone and mandibular corpus, as well as 20 variables related to mechanical properties of the skull. Results suggest that hypercarnivorous social canids have shapes and mechanical properties that are different from other modern canids. We found that morphological variation is not affected by sex. Results may be used to identify extinct Caninae species that were social and hypercarnivorous. Results also suggest that the evolution of sociality is dependent on phylogenetic relationships and ecological context, particularly the abundance of large prey and the presence of sympatric carnivores.

  8. Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

    Science.gov (United States)

    Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

    2015-10-01

    This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.

  9. Brucelosis canina en perros de la ciudad de Buenos Aires Canine brucellosis in dogs in the city of Buenos Aires

    Directory of Open Access Journals (Sweden)

    Eduardo Boeri

    2008-08-01

    Full Text Available La brucelosis canina, causada por Brucella canis, provoca epididimitis, atrofia testicular y esterilidad en los perros, mientras que en las hembras el síntoma principal es el aborto. La transmisión al hombre puede ser por contacto con el semen, orina, y/o fetos abortados de animales infectados. El presente estudio de tipo observacional de corte transversal, se realizó en caninos de barrios y asentamientos con alto índice de necesidades básicas insatisfechas (NBI en 8 áreas de la ciudad de Buenos Aires. Se estudiaron 219 perros, 184 hembras y 35 machos, que fueron negativos a la prueba de aglutinación con antígeno tamponado (BPAT, que descartó la infección con especies lisas del género Brucella. Sedetectaron anticuerpos anti-B. canis en 16 perros (7.3%, 9 hembras y 7 machos, este último dato es relevante ya que la orina de los machos es considerada uno de los medios de diseminación de la infección. Aunque sólo se pudieron tomar hemocultivos a 175 animales, en 3 (2 hembras y un macho se aislaron B. canis. Sólo 3 de los dueños de los perros positivos accedieron al diagnóstico serológico y dos resultaron positivos. Destacamos que la prueba de inmunodifusión en gel de agar (IGDA ha demostrado ser poco sensible, detectó sólo uno de los 16 casos positivos y ninguno de los tres confirmados por aislamiento. Concluimos que en las áreas estudiadas el hallazgo de perros serológicamente positivos y el aislamiento de B. canis en 3 casos, son indicadores del riesgo en el que se encuentra la salud de la población expuesta.Canine brucellosis, caused by Brucella canis, provokes epidydimitis, testicular atrophy and sterility in male dogs, while in females the major symptom is miscarriage. Transmission to humans may be through contact with semen, urine and/or aborted fetuses of infected animals. Our study, observational and cross-sectional, focused on dogs in lower class neighborhoods and slums with a high rate of unmet basic needs (UBN in

  10. Microbiological and histopathological aspects of canine pyometra Aspectos microbiológicos e histopatológicos da piometria canina

    Directory of Open Access Journals (Sweden)

    Jennifer Anne Coggan

    2008-09-01

    Full Text Available As pyometra is recognized as one of the main causes of disease and death in the bitch the purposes of this study were to evaluate microbiological and histopathological aspects of canine pyometra and to research the virulence factors of the E. coli isolates identifying possible risks to human health. The microbiological isolation from the intrauterine contents of 100 dogs with pyometra was carried out and the virulence factors in the E. coli strains were identified using PCR method. This study also consisted of the counting of microorganisms colonies forming units in samples of intrauterine content, tests of antimicrobial susceptibility of the E. coli isolates and the histological examination of the uterus. E. coli was the most prevalent microorganism isolated (76.6% and 120 strains (79.5% were positive for sfa, 86 (56.9% were positive for cnf, 87 (57.6% were positive for pap, 52 (34.4% were positive for hly, 51 (33.8% were positive for iuc and 5 (3.3% were positive for afa genes. One observed more sensitivity of E. coli to norfloxacin, polimixin B, sulphazotrin, chloranfenicol and enrofloxacin. In 42% of the samples of uterine walls where microorganisms were isolated, the sizes of the areas of the inflammatory responses corresponded to 39-56%. Virulence factors were identified in 98.0% of the strains evaluated, demonstrating a high frequency of potentially pathogenic E. coli. It must be considered that dogs are animals that are living in close proximity to man for thousands of years and have an important role in the transmission of E. coli to other animals and to man.A piometra é uma enfermidade da cadela adulta, sendo a doença reconhecida como uma das causas mais comuns de morte desta espécie animal. Os objetivos deste trabalho foram a avaliação de aspectos microbiológicos e histopatológicos da piometra canina e pesquisa de fatores de virulência de E. coli, identificando possíveis riscos para a saúde humana. Foi realizado o exame

  11. Aspectos epidemiológicos sobre mordeduras caninas durante el año 2011 en la ciudad de Temuco, Chile.

    Directory of Open Access Journals (Sweden)

    Waldo Armstrong,

    2016-03-01

    Full Text Available Los accidentes causados por mordeduras de perros y gatos son un problema de salud pública y concretamente las mordeduras de perro constituyen el riesgo más grave que estos animales suponen para la salud de las personas. A los costes económicos derivados del tratamiento de las lesiones físicas debemos añadir las secuelas psicológicas que muchas veces aparecen tras las agresiones. La prevención es el único camino para resolver este problema y puede efectuarse mejor cuando se conocen los diversos factores involucrados en la génesis de este tipo de accidentedebido a lo anterior el objetivo del estudio fue describir las características epidemiológicas asociadas a las personas mordidas por perros. La metodología utilizada para la recolección de datos fue la aplicación de una encuesta a 9 centros asistenciales de la ciudad de Temuco. Se solicitó información sobre pacientes atendidos por mordeduras caninas durante el año 2011 y los datos recolectados se ingresaron en una planilla de cálculos. Los resultados indican que niños y adultos presentan 52% de las mordeduras durante el año. Los hombres presentan una mayor incidencia con un 47% a diferencia de las mujeres con un 44%. Con respecto a la región corporal afectada los miembros superiores alcanzan un 25% de frecuencia ante el ataque y los miembros inferiores un 31.3%. Por otra parte, las mordeduras por perros presentaron una marcada estacionalidad en los meses de verano con un 30% de casos. Se concluye que las mordeduras caninas son un problema frecuente y de real importancia en el ámbito de salud pública, generando en la población secuelas físicas y psicológicas por las lesiones generadas durante el ataque.

  12. Outbreak of autochthonous canine visceral leishmaniasis in Santa Catarina, Brazil Surto autóctone de leishmaniose visceral canina no Estado de Santa Catarina

    Directory of Open Access Journals (Sweden)

    Mário Steindel

    2013-04-01

    Full Text Available The present study reports the first outbreak of autochthonous canine visceral leishmaniasis in Florianópolis, Santa Catarina, southern Brazil. Following the report of two cases of CVL, the Control Center of Zoonotic Diseases conducted a serological survey by ELISA and IFAT assays in seven districts of the Santa Catarina Island. Eleven seropositive dogs of autochthonous transmission were used in the present study. Infection by Leishmania sp. was confirmed by parasitological examination of bone marrow, liver, spleen and lymph nodes, culture in Schneider's medium and PCR. Leishmania sp. isolates were characterized by PCR-RFLP and hybridization with specific probes, allowing for the identification of Leishmania infantum. Autochthonous transmission of this disease in an area with high tourist traffic presents a major public health concern and signifies the emergence of an important zoonosis in southern Brazil. Therefore, the implementation of surveillance and control measures is imperative to prevent the spread of the disease among the canine population as well as transmission to the human population.O presente estudo relata o primeiro surto autóctone de leishmaniose visceral canina (LCV em Florianópolis, Santa Catarina, Brasil. Durante levantamento soro-epidemiológico realizado pelo Centro de Controle de Doenças Zoonóticas (CCZ envolvendo 2.124 cães, 29 (1,37% foram soropositivos para VL (ELISA + RIFI. Onze cães positivos por transmissão autóctone foram utilizados no presente estudo. A confirmação da infecção por Leishmania sp. foi realizada pelo exame parasitológico da medula óssea, fígado, baço e linfonodos, cultura em meio Schneider e PCR. Os isolados de Leishmania sp. foram caracterizados por PCR-RFLP e hibridação com sondas específicas, permitindo a identificação de Leishmania infantum. A transmissão autóctone da LCV em uma área com grande fluxo turístico como Florianópolis representa um preocupante risco à saúde p

  13. Associação de variáveis ambientais à ocorrência de leptospirose canina e humana na cidade de São Paulo

    Directory of Open Access Journals (Sweden)

    R.I. Cipullo

    2012-04-01

    Full Text Available Foi realizada uma análise espacial da ocorrência de leptospirose humana e canina na Supervisão de Vigilância em Saúde do Butantã, situada no município de São Paulo, no ano de 2007, associada a variáveis ambientais de risco, tais como: focos de enchente e áreas de desratização. Foram encontrados aglomerados espaciais de pontos de alagamentos em 12 setores censitários e de casos de leptospirose humana em quatro setores censitários, sem correlação entre ambos. Não foram encontrados agrupamentos de casos em cães, possivelmente devido à subnotificação. As proporções casos humanos de leptospirose : população humana dentro e fora da área de desratização foram 7:199.600 e 9:257.980, respectivamente. Conclui-se que medidas de controle de roedores como a desratização foram responsáveis pela minimização dos efeitos dos fatores de risco para a transmissão de leptospirose para humanos.

  14. THE INFLUENCE OF TEMPERATURE AND TIME ON THE ANTIOXIDANT ACTIVITY AND COLOR PARAMETERS OF DOG-ROSE (ROSA CANINA ETHANOLIC EXTRACT

    Directory of Open Access Journals (Sweden)

    ELENA CRISTEA

    2016-07-01

    Full Text Available This paper presents the study of the stability of antioxidant activity and color of the 50 % ethanolic extract of dog-rose (Rosa canina from the Republic of Moldova with the main objective to test a food dye of natural origin. The extract was submitted to: -2 °C for 12 hours; 4 °C for 12 hours; 40 °C for 15 minutes, 60 °C for 15 minutes, 80 °C for 15 minutes and 100 °C for 2 minutes, after which the antioxidant activity and the color (CIELab parameters were measured. Three sets of extracts were kept for 2 weeks at -2 °C; 4 °C and 25 - 30 °C and afterwards the parameters mentioned above were measured once again. Moreover, the total content of polyphenols was determined by Folin-Ciocalteu method. The results were expressed in mg gallic acid equivalents per liter. The antioxidant activity was determined using the method based on the interaction with the ABTS radical, the results being expressed in mmol trolox equivalent per liter. Thermal treatments have not influenced antioxidant activity, but have significantly affected the extract by increasing its luminosity and changing the red/green parameter towards more red tones, while storage at -2 °C caused the decrease of yellowness. Storage at 4 °C was found to be optimal for the preservation of the antioxidant activity.

  15. Manejo de la traqueobronquitis infecciosa canina (TIC “Tos de las Perreras” (Canine infectious tracheobronchitis management “Kennel Cough”

    Directory of Open Access Journals (Sweden)

    Leonardo D. Mauro

    2006-02-01

    Full Text Available Sumario. La traqueobronquitis infecciosa canina es una enfermedad muy contagiosa del sistema respiratorio superior, que puede afectar a perros de diferentes edades, en forma individual, o mas seriamente a poblaciones donde conviven muchos animales y en las que puede ser un problema muy complejo de solucionar. En este trabajo, luego de incursionar en las diferentes etiologías y tratamientos, se intenta unificar toda la información disponible sobre el manejo profiláctico de esta patología, junto a nuestra experiencia de muchos años con poblaciones animales dentro de un local de exposición y venta de cachorros. Summary. The canine infectious traqueobronquitis is a very contagious disease of the high respiratory system that can affect dogs of different ages, in individual form, or more seriously to populations where many animals coexist and in which can be a very complex problem to solve. In this work, after incursionar in the different etiology and treatments, it is tried to unify all the information available on the prophylactic handling of this pathology, next to our experience of many years with populations animals within the premises of exhibition and sale of puppies.

  16. Canine hypertrophic osteopathy associated with extra-thoracic lesions Osteopatia hipertrófica canina associada com lesões extratorácicas

    Directory of Open Access Journals (Sweden)

    Selwyn Arlington Headley

    2005-08-01

    Full Text Available Canine hypertrophic osteopathy is described in a dog that presented extra-thoracic lesions, mainly in the liver. Hepatic lesions were characterized by necrosis, hemorrhage, severe hydropic degeneration of centrolobular hepatocytes, proliferation of epithelial cells of bile ducts, and mild biliary stasis. The disease syndrome was diagnosed based on clinical signs, radiological evaluation, and inspection of macerated bones.Osteopatia hipertrófica canina é descrita em um cão que apresentou lesões extratorácicas, principalmente no fígado. As alterações hepáticas foram caracterizadas por necrose, hemorragia, degeneração hepatocelular severa, proliferação das células epiteliais dos ductos biliares e estase biliar. O diagnóstico desta síndrome foi baseado nos sinais clínicos, a avaliação radiológica e a inspeção dos ossos macerados.

  17. Effects of Fruit of Rosa Canina L.Extract on the Level of Plasma Glucose in Male Diabet-Induced Rats

    Directory of Open Access Journals (Sweden)

    A Mohammad Eini

    2016-03-01

    Full Text Available Introduction: Diabetes mellitus is one of the most prevalent chronic and complex metabolic diseases of human , which hyperglycemia can be mentioned as its prominent characteristic. Therefore, this study aimed to evaluate the hypoglycemic effects of fruit of Rosa canina (R.c. extract in healthy and diabetic rats. Method: A total of 72 Wistar male rats were divided into six group: control,  STZ (diabetic control,  R.c. control (50 mg/kg, R.c. control (100 mg/kg and two experimental groups with 50, and 100 mg/kg of extract dose. Diabetes was induced using streptozotocine (60 mg/kg; IP, and blood collection was carried out on 0, 2 and 4 hours after the oral administration of the extracts. Results: The levels of plasma glucose were determined by spectrophotometric method. In order to statistically analyze the study data, ANOVA test was performed. There was a significant difference between groups concerning the plasma glucose concentration (P<0.0001, which the lowest concentration between diabetes groups was observed in the two experimental groups. Moreover, R.c. had a marked hypoglycemic effect on diabetes mellitus. Conclusion: R.c. extract in hyperglycemic status demands to be further studied in order to control and prevent its complications.

  18. To be or not to be the odd one out - Allele-specific transcription in pentaploid dogroses (Rosa L. sect. Caninae (DC. Ser

    Directory of Open Access Journals (Sweden)

    Theißen Günter

    2011-02-01

    Full Text Available Abstract Background Multiple hybridization events gave rise to pentaploid dogroses which can reproduce sexually despite their uneven ploidy level by the unique canina meiosis. Two homologous chromosome sets are involved in bivalent formation and are transmitted by the haploid pollen grains and the tetraploid egg cells. In addition the egg cells contain three sets of univalent chromosomes which are excluded from recombination. In this study we investigated whether differential behavior of chromosomes as bivalents or univalents is reflected by sequence divergence or transcription intensity between homeologous alleles of two single copy genes (LEAFY, cGAPDH and one ribosomal DNA locus (nrITS. Results We detected a maximum number of four different alleles of all investigated loci in pentaploid dogroses and identified the respective allele with two copies, which is presumably located on bivalent forming chromosomes. For the alleles of the ribosomal DNA locus and cGAPDH only slight, if any, differential transcription was determined, whereas the LEAFY alleles with one copy were found to be significantly stronger expressed than the LEAFY allele with two copies. Moreover, we found for the three marker genes that all alleles have been under similar regimes of purifying selection. Conclusions Analyses of both molecular sequence evolution and expression patterns did not support the hypothesis that unique alleles probably located on non-recombining chromosomes are less functional than duplicate alleles presumably located on recombining chromosomes.

  19. Importancia y propiedades físico química de la Rosa mosqueta (R. canina, R. rubiginosa: una revisión

    Directory of Open Access Journals (Sweden)

    T. Espinoza

    2016-01-01

    Full Text Available Los consumidores cada día exigen productos en sus dietas que no solo aporten los nutrientes requeridos para una vida sana, sino que además son de preferencia aquellos que puedan complementar con propiedades benéficas para la salud. En las últimas décadas se ha reconocido a la Rosa mosqueta, la Rosa canina y a la Rosa rubiginosa, como frutos que contienen muchas propiedades nutracéuticas. El presente trabajo hace una revisión de los artículos de investigación realizados a la Rosa mosqueta desde un punto de vista de su importancia de su consumo y sus beneficios para la salud; describiendo las características químicas, físicas y bioquímicas tales como el contenido de componentes fenólicos, ácidos grasos, ácido linoleico, minerales; y de otros compuestos importantes también desde el punto de vista industrial, tales como el contenido de antioxidantes, pigmentos, entre otros. De acuerdo a los antecedentes recopilados, la Rosa mosqueta es una fuente de micronutrientes incluyendo la vitamina c y el licopeno, entregando además un buen aporte nutricional; por lo anterior debe ser considerado como un alimento funcional. Aun siendo una especie que crece en estado salvaje, sobre suelos forestales; siendo un frutal menor y una planta medicinal su importancia en el consumo masivo debe ser considerada.

  20. Application of Natural Antioxidants from Strawberry Tree (Arbutus unedo L.) and Dog Rose (Rosa canina L.) to Frankfurters Subjected to Refrigerated Storage

    Institute of Scientific and Technical Information of China (English)

    Mónica Armenteros; David Morcuende; Sonia Ventanas; Mario Estévez

    2013-01-01

    The effect of the addition of natural antioxidants from strawberry tree (Arbutus unedo L.; AU) and dog rose (Rosa canina L.; RC), in frankfurters elaborated with or without the addition of antioxidant additives (sodium ascorbate and nitrite) was studied. Six different types of experimental frankfurters were prepared depending on the addition of phenolic-rich extracts from RC and AU and the presence (P) or absence (C) of antioxidant additives. Thiobarbituric acid reactive substances (TBARS)-numbers signiifcantly increased during chilled storage of C-frankfurters while additives and fruit phenolics inhibited lipid oxidation in P-frankfurters. The amount of protein carbonyls signiifcantly increased in all treatments except in P-AU frankfurters. The discoloration process that occurred during the chilled storage was reduced by the addition of substances with proven antioxidant activity (P-frankfurters). Texture characteristics as hardness, springiness, cohesiveness and gumminess also suffered a signiifcant deterioration in C-frankfurters. The use of phenolic fruit extracts in combination with traditional antioxidant additives is a successful strategy to enhance the oxidative stability of frankfurters without modifying their color and texture properties.

  1. Biogas production from spent rose hips (Rosa canina L.): fraction separation, organic loading and co-digestion with N-rich microbial biomass.

    Science.gov (United States)

    Osojnik Črnivec, Ilja Gasan; Muri, Petra; Djinović, Petar; Pintar, Albin

    2014-11-01

    Complex waste streams originating from extraction processes containing residual organic solvents and increased C/N ratios have not yet been considered as feedstock for biogas production to a great extent. In this study, spent rosehip (Rosa canina L.) solid residue (64%VS, 22 MJ/kg HHV, 30C/1N) was obtained from an industrial ethanol aided extraction process, and extensively examined in an automated batch bioreactor system for biogas production. Fraction separation of the compact lignocellulosic seeds increased the available sugar and ethanol content, resulting in high biogas potential of the sieved residue (516 NL/kg VS'). In co-digestion of spent rosehip substrate with non-deactivated nitrogen rich microbial co-substrates, methanogenesis was favored (Y(m) > 68%(CH4)). In individual digestion of microbial co-substrates, this was not the case, as biogas with 28 vol.% N2 was produced from activated sludge supplement. Therefore, effective inhibition of exogenous microbiota was achieved in the presence of carbonaceous spent rose hip.

  2. Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species.

    Science.gov (United States)

    Sonne, Christian; Gustavson, Kim; Eulaers, Igor; Desforges, Jean-Pierre; Letcher, Robert J; Rigét, Frank F; Styrishave, Bjarne; Dietz, Rune

    2016-03-01

    The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First the critical body residues (CBRs) were estimated using the physiologically-based pharmacokinetic (PBPK) model for seven POP compounds based on rat critical daily doses (CDDs). These were then compared with the actual daily oral POP doses (DD) and body residues (BR) in the sledge dogs by calculating risk quotients (RQDD: DD/CDD; RQBR: BR/CBR; ≥1 indicates risk). The results showed that risk quotients for reproductive, immunotoxic and liver histopathological effects were significantly lowest in the control group (pPOP exposure negatively impacts steroid hormones, various immune parameters, as well as liver histopathology in sledge dogs. It is also clear that RQBR is the best reflector of health effects from POP exposure and that it is especially accurate in predicting immune and reproductive effects. We recommend that PBPK modelled (CBR) and RQBR should be used in the assessment of POP exposure and health effects in Arctic top predators.

  3. Does the nutrition profile of vitamins, fatty acids and microelements counteract the negative impact from organohalogen pollutants on bone mineral density in Greenland sledge dogs (Canis familiaris)?

    DEFF Research Database (Denmark)

    Sonne, Christian; Riget, Frank F.; Jensen, Jens-Erik Beck

    2008-01-01

    ) by DXA scanning (g/cm(-2)) in 15 age and weight normalized sledge dog (Canis familiaris) bitches and their 26 pups divided into a control group (n = 26) given 50-200 g/day clean pork (Suis scrofa) fat and a treated group (n = 15) given 50-200 g/day OHC polluted minke whale (Balaenoptera acutorostrata......) blubber as main lipid sources. The results showed that BMD increased significantly with age (linear regression: p 0.0001, r(2)=0.83, n=41) while no sex difference was found in the F-generation (two-way ANOVA: all p>0.3). No differences in BMDfemur or BMDvertebrae between exposed and control individuals...... in the bitch generation were found (linear mixed effect model: both p > 0.38). Likewise, no difference between exposed and control subadults and juveniles in the F-generation was found (two-way ANOVA: all p>0.33). Correlation analyses between BMDfemur, BMDvertebrae and groups of OHCs, respectively, did...

  4. Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

    Directory of Open Access Journals (Sweden)

    Dorey, Nicole R.

    2013-07-01

    Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.

  5. Bacteriological evaluation of bone grafts stored by cryogenic freezing at –24°C from a canine (Canis familiaris bone bank

    Directory of Open Access Journals (Sweden)

    Jaqueline França dos Santos

    2015-12-01

    Full Text Available The scientific basis of bone transplantation was established during the mid-nineteenth century, when the osteogenic properties of the bone and periosteum, beneficial influence of cold preservation of bones, and first conventional attempt to store bones for elective use, were described. A bone bank has several advantages, such as the immediate availability of grafts in large quantities, and different shapes and sizes, and maintenance of osteoinductive activity in grafts. In addition, it reduces patient blood loss, surgical time, and quantity of anesthetics required. Clinical applications include the correction of comminuted fractures, treatment of non-union bones, and replacement of bone loss due to infections or malignancies. The success of these procedures depends on the preservation and integrity of the graft. This study aimed to evaluate the feasibility of maintaining a canine bone bank (Canis familiaris by quantifying the bacterial contamination of bone grafts preserved at –24°C. The samples were evaluated through a monthly assessment of bacteriological cultures over a period of 6 months. The harvest method was efficient and sterile, reducing the risk of contamination. We conclude that the techniques chosen for the implementation of a bone bank were effective and feasible (use of a common freezer reaching a temperature below –24°C. The viability of the bones was attested during a 6-month period, and the samples demonstrated a 100% sterility rate.

  6. Susceptibilidad canina a rabia después de una campaña de vacunación en zonas endémicas del Perú

    Directory of Open Access Journals (Sweden)

    Ricardo López I

    2007-01-01

    Full Text Available Objetivo: Determinar el nivel de la respuesta inmune posterior a una campaña de vacunación antirrábica canina en dos zonas que han presentado en los últimos años casos de rabia canina. Materiales y métodos: Se realizó una encuesta serológica, en 101 y 199 canes localizados en los distritos de Tambo Grande (Piura y Juliaca (Puno respectivamente y se efectuó la prueba del seroneutralización en ratón para determinar la proporción de canes con anticuerpos protectores (¡Ý 0,5 UI/mL según zona de estudio, antecedentes de vacunación, edad del perro y sexo. Resultados: Después de tres meses de la campaña antirrábica 32% del total de canes estuvieron protegidos adecuadamente, 66% tuvieron antecedentes de vacunación y 44% de los canes vacunados tenían anticuerpos ( 0,1 UI/mL. En Juliaca se encontró mayor protección, contra la rabia, que en Tambo Grande en los perros vacunados (51% frente a 34%, p<0,05. Los canes mayores de un año estaban más protegidos que los menores de un año (p<0,01, sin embargo el sexo del perro no tuvo relación con la protección (p0,05. Conclusiones: Existe una deficiente protección inmune contra la rabia en los distritos de Tambo Grande y Juliaca, lo cual hace estas zonas muy susceptibles a desarrollar brotes de rabia canina.

  7. Efectos de la zooterapia canina en las conductas prosociales y el nivel de actividad física de un niño con trastorno autista y sobrepeso

    OpenAIRE

    Fonseca Schmidt, Héctor

    2010-01-01

    Tesis texto completo Aborda de manera simultánea el tratamiento del autismo, la promoción de la salud física y el fortalecimiento de las conductas prosociales de un niño con Trastorno Autista severo, de diez años de edad. Se realizó un plan piloto, desde el que se construye una intervención de dos sesiones semanales de una hora a hora y media de duración, durante tres meses con un total de 25 sesiones, utilizando dos hembras caninas entrenadas para zooterapia, de las razas Cocker Spaniel y...

  8. Análisis comparativo de la rigidez al desplazamiento antero-posterior de la rodilla canina completa, rodilla con rotura del ligamento cruzado anterior y rodilla reparada con la técnica de avance de la tuberosidad tibial

    OpenAIRE

    Musté Rodríguez, Marta

    2013-01-01

    En traumatología canina, una de las patologías de rodilla más frecuentes es la rotura del ligamento cruzado anterior (LCA), cuyo coste en diagnóstico y tratamiento fue de 1,32 billones de dolares en EEUU durante el año 2003. Los efectos a corto plazo son la inestabilidad de la rodilla, osteoartritis, lesiones meniscales, dolor y pérdida de funcionalidad de la articulación. El LCA actúa como estabilizador de la articulación. Su función es limitar el desplazamiento anterior de la tibia con r...

  9. Steroid hormones in blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen polluted minke whalte (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, Rune; Letcher, Robert J.;

    2014-01-01

    conducted in Greenland sledge dogs (Canis familiaris) as a sentinel species for adverse effects on steroid homeostasis. The control and exposed groups were composed of four sister-bitches all fed pork fat (Suis suis) and organohalogen contaminated minke whale (Balaenoptera acutorostrata) blubber......Persistent organic pollutants such as polychlorinated biphenyls (PCB) are known to disrupt steroidogenesis and subsequent concentrations of circulating endogenous hormones. This is also suspected to occur in Arctic predatory species, such as polar bears (Ursus maritimus) and a study was therefore...

  10. Coyote (Canis latrans) and domestic dog (Canis familiaris) mortality and morbidity due to a Karenia brevis red tide in the Gulf of Mexico.

    Science.gov (United States)

    Castle, Kevin T; Flewelling, Leanne J; Bryan, John; Kramer, Adam; Lindsay, James; Nevada, Cheyenne; Stablein, Wade; Wong, David; Landsberg, Jan H

    2013-10-01

    In October 2009, during a Karenia brevis red tide along the Texas coast, millions of dead fish washed ashore along the 113-km length of Padre Island National Seashore (PAIS). Between November 2009 and January 2010, at least 12 coyotes (Canis latrans) and three domestic dogs (Canis familiaris) died or were euthanized at PAIS or local veterinary clinics because of illness suspected to be related to the red tide. Another red tide event occurred during autumn 2011 and, although fewer dead fish were observed relative to the 2009 event, coyotes again were affected. Staff at PAIS submitted carcasses of four coyotes and one domestic dog from November 2009 to February 2010 and six coyotes from October to November 2011 for necropsy and ancillary testing. High levels of brevetoxins (PbTxs) were measured by enzyme-linked immunosorbent assay in seven of the coyotes and the dog, with concentrations up to 634 ng PbTx-3 eq/g in stomach contents, 545 ng PbTx-3 eq/g in liver, 195 ng PbTx-3 eq/g in kidney, and 106 ng PbTx-3 eq/mL in urine samples. Based on red tide presence, clinical signs, and postmortem findings, brevetoxicosis caused by presumptive ingestion of toxic dead fish was the likely cause of canid deaths at PAIS. These findings represent the first confirmed report of terrestrial mammalian wildlife mortalities related to a K. brevis bloom. The implications for red tide impacts on terrestrial wildlife populations are a potentially significant but relatively undocumented phenomenon.

  11. Contagious yawning in domestic dog puppies (Canis lupus familiaris): the effect of ontogeny and emotional closeness on low-level imitation in dogs.

    Science.gov (United States)

    Madsen, Elainie Alenkær; Persson, Tomas

    2013-03-01

    Contagious yawning is a well-documented phenomenon in humans and has recently attracted much attention from developmental and comparative sciences. The function, development and underlying mechanisms of the phenomenon, however, remain largely unclear. Contagious yawning has been demonstrated in dogs and several non-human primate species, and theoretically and empirically associated with empathy in humans and non-human primates. Evidence of emotional closeness modulating contagious yawning in dogs has, nonetheless, been contradictory. Humans show a developmental increase in susceptibility to yawn contagion, with typically developing children displaying a substantial increase at the age of four, when a number of cognitive abilities (e.g. accurate identification of others' emotions) begin to clearly manifest. Explicit tests of yawn contagion in non-human animals have, however, thus far only involved adult individuals. Here, we report a study of the ontogeny of domestic dogs' (Canis lupus familiaris) susceptibility to yawn contagion, and whether emotional closeness to the yawning model affects this. Thirty-five dogs, aged 4-14 months, observed a familiar and unfamiliar human repeatedly yawn or gape. The dogs yawned contagiously, but emotional closeness with the model did not affect the strength of contagion, raising questions as to recent evidence of emotionally modulated auditory contagious yawning in dogs. The dogs showed a developmental effect, with only dogs above 7 months evidencing contagion. The results support the notion of a developmental increase in dogs' attention to others and identification of others' emotional states and suggest that yawn contagion is underpinned by developmental processes shared by humans and other animals.

  12. Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda

    Directory of Open Access Journals (Sweden)

    EVORA Paulo Roberto B.

    1999-01-01

    Full Text Available Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers" e ensaios biológicos: 1 os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2 os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3 o A23187, vasodilatador independente de receptor, induziu relaxamentos dependentes do endotélio; 4 dopamina, dobutamina, papaverina e a poli-L-arginina induziram vasodilatações independentes do endotélio; 5 a NOR induziu intensa vasoconstrição comparável à causada pelo KCI e pela endotelina; 6 em 83% de 24 ensaios, a liberação basal de NO foi maior na AMI esquerda, em comparação com a AMI direita; 7 ensaios biológicos de AMIs demonstraram a importância da PGI2 nas condições de hipóxia, uma vez que a indometacina aboliu vasodilatação adicional em resposta à hipóxia em condições de vasodilatação induzida pela liberação basal de NO; 8 não ocorreram diferenças significantes de resposta, comparando-se estudos realizados em AMIs direita e esquerda.

  13. Hepatite infecciosa canina em cães naturalmente infectados: achados patológicos e diagnóstico imuno-histoquímico

    Directory of Open Access Journals (Sweden)

    Eduardo C. Oliveira

    2011-02-01

    Full Text Available Vinte e três cães com hepatite infecciosa canina (HIC foram analisados com base nos seus dados gerais, achados clínicos, patológicos e imuno-histoquímicos. As principais lesões macroscópicas encontradas foram palidez do fígado (17/23, hepatomegalia (10/23 e hemorragia (21/23. Observou-se também edema da parede da vesícula biliar (11/23, malhas de fibrina cobrindo a superfície capsular hepática (8/23 e icterícia (6/23. Acentuada necrose hepatocelular foi encontrada associada à identificação de corpúsculos intranucleares anfofílicos e basofílicos em hepatócitos e células endoteliais (22/23 característicos de adenovírus. Identificou-se no baço e linfonodos necrose linfoide, hemorragia e menor ocorrência de corpúsculos intranucleares em células reticuloendoteliais. A imuno-histoquímica (IHQ foi positiva para adenovírus canino tipo 1 em todos os animais analisados. Os principais órgãos positivos na IHQ foram fígado (23/23, telencéfalo (22/22, cerebelo (16/20 e rim (16/21. Maior marcação de antígenos viral foi observada em hepatócitos e no endotélio vascular do encéfalo e dos tufos glomerulares renais.

  14. Métodos de diagnóstico para detecção de prostatopatias caninas Canine prostatic disease: diagnosis methods

    Directory of Open Access Journals (Sweden)

    Ceres Mussel

    2010-12-01

    Full Text Available As doenças prostáticas são comuns em cães, desenvolvendo-se após a maturidade sexual. Entre as afecções que acometem a próstata desses animais, a mais frequente é a hiperplasia prostática benigna (HPB. As neoplasias prostáticas, apesar de menos frequentes, são altamente malignas e um diagnóstico tardio está associado a um prognóstico ruim. Os principais métodos de diagnóstico das enfermidades prostáticas em cães incluem um exame clínico detalhado, ultrassonografia, punção aspirativa e biópsia. A utilização de biomarcadores séricos vem sendo estudada como uma maneira de se detectar a doença precocemente, evitando possíveis complicações no quadro clínico dos pacientes. Assim, estudos visando ao diagnóstico precoce de prostatopatias caninas, especialmente o câncer prostático, são cruciais para um tratamento eficaz e melhora da qualidade de vida do animal acometido.Prostatic diseases are common in older dogs, developing after sexual maturity. The most common affecting canine prostate is benign prostatic hyperplasia (BPH. Although less frequent, prostatic neoplasias are highly malignant, and a late diagnosis is closely associated with a poor prognosis. The main methods of diagnosis of the canine prostatic disease include a detailed clinical exam, ultrasound, prostatic fine-needle aspirate and biopsy. Studies towards early diagnosis of this condition are crucial for effective treatment and improvement of quality of life of affected animals. The use of biomarkers has been studied for early detection of the disease, avoiding possible complications in clinical patients.

  15. Canine visceral leishmaniasis in the Krenak indigenous community, Resplendor, Minas Gerais State, Brazil, 2007 Leishmaniose visceral canina na Terra Indígena Krenak, Resplendor, Minas Gerais, Brasil, 2007

    Directory of Open Access Journals (Sweden)

    Eloiza Gonçalves Antônio

    2011-03-01

    Full Text Available The authors conducted a cross-sectional study of the local canine population in the Krenak indigenous community to detect parasites of the genus Leishmania and identify the circulating species and the proportion of asymptomatic dogs, while investigating associations between canine infection and the dogs' sex, age, and hair length. A seroepidemiological survey was performed, including 63 dogs. All the animals underwent clinical examination to verify the presence of characteristic signs, and serum samples were taken for serological tests (ELISA, IIF. Infected dogs culled by the health service were necropsied and the material was analyzed using molecular diagnostic techniques. The cross-sectional study detected a 46% prevalence rate, and the circulating species was Leishmania (L. chagasi. The statistical analysis showed no association between infection and the independent variables. The study generated data on the epidemiological situation with canine infection in the area, which was previously unknown.Foi realizado um estudo seccional para detectar, na população canina, a presença de parasitos do gênero Leishmania e a espécie circulante, a proporção de cães assintomáticos, investigando concomitantemente a existência de associações entre a infecção canina e as variáveis: sexo, idade e tipo de pelo dos cães. Para o estudo seccional, foi realizado um inquérito censitário, que avaliou 63 cães. Todos passaram por uma avaliação clínica para verificar a presença de sintomas característicos da infecção; amostras de soro foram coletadas para os testes sorológicos (ELISA, RIFI. Os cães positivos retirados pelo serviço de saúde foram necropsiados, e o material, analisado pelas técnicas de diagnóstico molecular. O estudo seccional realizado detectou uma prevalência de 46%, sendo a espécie circulante a Leishmania (L. chagasi. A análise estatística não detectou nenhuma associação entre infecção e as vari

  16. Renal involvement in canine leishmaniasis: a morphological and immunohistochemical study Envolvimento renal na leishmaniose canina: estudo morfológico e imunoistoquímico

    Directory of Open Access Journals (Sweden)

    M.J.V. Soares

    2009-08-01

    Full Text Available IgG and IgM deposits in kidneys of dogs with visceral leishmaniasis (VL were studied in 25 symptomatic dogs (case and 15 asymptomatic dogs (control by an immunohistochemical method. All tested dogs were positive for VL by polymerase chain reaction, enzyme-linked immunosorbent assay, and indirect immunofluorescence test. Kidney fragments were submitted to immunohistochemical reaction. Many morphological patterns of distribution of subendothelial granules were identified for IgG and IgM in glomerular capillaries: global, segmental, diffuse, or focal. Intensity of immunohistochemical reaction to IgG was not significantly different when comparing the symptomatic and the asymptomatic animal groups by Fisher's exact test. IgM reactions were significantly different between groups (PCaracterizou-se a deposição de IgG e IgM em rins de cães com leishmaniose visceral (LV pelo uso da técnica imunoistoquímica. Foram estudados rins de 25 cães sintomáticos (caso e de 15 cães assintomáticos (controle. Todos os animais foram positivos para leishmaniose pela reação em cadeia da polimerase, pelo ELISA e pela imunofluorescência indireta. Fragmentos renais foram submetidos à reação imunoistoquímica. Diversos padrões morfológicos de distribuição de grânulos subendoteliais de IgG e IgM foram identificados nos capilares glomerulares: global, segmentar, difuso ou focal. A intensidade da reação imunoistoquímica da IgG, medida pelo teste exato de Fisher não diferiu entre os grupos sintomáticos e assintomáticos e a intensidade de reação da IgM foi diferente entre os grupos (P<0,01. Depósitos de IgM nas células mesangiais e no infiltrado inflamatório raramente foram visualizados, no entanto as reações IgG foram freqüentemente visualizadas nesses locais. Concluiu-se que as reações de IgM foram mais intensas que as reações de IgG na LV canina e caracterizam-se pela distribuição de grânulos subendoteliais nos capilares glomerulares.

  17. Isolation of Candida spp from vaginal microbiota of healthy canine females during estrous cycle Isolamento de Candida spp da microbiota vaginal de fêmeas caninas hígidas durante o ciclo estral

    Directory of Open Access Journals (Sweden)

    Marlete Brum Cleff

    2005-06-01

    Full Text Available Yeasts are commensal organisms found in the skin, genital and gastrointestinal tracts, and other mucosa in mammalians. Candida spp has been frequently isolated from domestic and sylvan animals. Yeast isolation from vaginal mucus is frequent in women, especially of Candida genus. In canine females, however, studies about vaginal fungal microbiota are rare and the connection with estrous cycle is unknown. The purpose of this study was to isolate yeast 5 of Candida genus from healthy canine females and identify the isolated species, establishing their connection with estrous cycle phases. Two hundred twenty-four samples taken from vaginal mucus of 14 canine females were analyzed in this study. Candida spp was observed in 83 (37% from these samples; nine samples were taken in proestrus, 14 in oestrus, 31 in dioestrus, 24 in anoestrus and five samples were obtained during pregnancy. Candida parapsilosis the most frequently isolated specie (21.7%, followed by C. guillermondii (8.4%, C. kefir (6% and C. albicans (4.8%. We concluded that Candida spp is a commion component of healthy canine females' vaginal microbiota, and isolation varies according to the estrous cycle phase.As leveduras são organismos comensais da pele, trato genital e gastrointestinal, e de outras mucosas de mamíferos. O gênero Candida vem sendo isolado freqüentemente de animais domésticos e silvestres. O isolamento de Candida spp da mucosa vaginal de mulheres é freqüente, porém na espécie canina são escassos os estudos referentes à microbiota fúngica vaginal, especialmente do gênero candida, não se tendo conhecimento de sua relação com o ciclo reprodutivo. O presente trabalho teve como objetivo isolar leveduras do gênero Candida em fêmeas caninas hígidas e identificar as espécies isoladas, relacionando-as com as diferentes fases do ciclo estral. Foram analisadas 224 amostras obtidas da mucosa vaginal de 14 fêmeas caninas. Candida spp foi observada em 83 (37

  18. Avaliação neurológica e laboratorial de casos de encefalomielite pelo vírus da cinomose canina na ausência de sinais sistêmicos e mioclonia

    OpenAIRE

    Alexandre Mendes Amude

    2005-01-01

    O diagnóstico clínico da encefalomielite pela cinomose em cães é difícil nos casos em que os sinais sistêmicos e a mioclonia estão ausentes. Nessa situação, o apoio laboratorial é necessário para confirmar a doença, no entanto os métodos disponíveis para o diagnóstico ante mortem da cinomose têm valor limitado. O conhecimento sobre as possíveis apresentações clinico-patológicas, assim como a evolução das síndromes clínicas causadas pelo vírus da cinomose canina (CDV), é importante para o reco...

  19. Erliquiose monocítica canina subclínica, naturalmente adquirida: diagnóstico, aspectos clínico-laboratoriais, envolvimento renal e evolução com o tratamento

    OpenAIRE

    Alves, Marcelo Augusto Moraes Koury [UNESP

    2013-01-01

    A erliquiose canina é uma doença causada pela bactéria Gram-negativa Ehrlichia canis transmitida pelo carrapato Rhipicephalus sanguineus. A enfermidade é endêmica em muitas regiões do mundo e motivo de investigação científica em muitos países. Independentemente dos muitos avanços sobre a patogênese e o diagnóstico da doença existem poucos conhecimentos sobre o acometimento renal. O presente estudo teve por escopo caracterizar a condição clínico-laboratorial, com enfoque na função renal, de cã...

  20. Matrix metalloproteinases 2 and 9 expression in canine normal prostate and with proliferative disorders Expressão de metaloproteinases de matriz 2 e 9 na próstata canina normal e com lesões proliferativas

    Directory of Open Access Journals (Sweden)

    Mariana Batista Rodrigues Faleiro

    2013-06-01

    Full Text Available In this study the expression of metalloproteinases 2 (MMP-2 and 9 (MMP-9 in canine normal prostates and with proliferative disorders was evaluated to verify the role of these enzymes in extracellular matrix remodeling (ECM and in the tissue invasion process. A total of 355 prostatic samples were obtained, from which 36 (10.1% were normal prostates, 46 (13.0% with benign prostatic hyperplasia (BPH, 128 (36.1% with proliferative inflammatory atrophy (PIA, 74 (20.8% with prostatic intraepithelial neoplasia (PIN, and 71 (20.0% with prostatic carcinoma (PC. Difference in cytoplasmic immunohistochemical staining of MMP-2 and MMP-9 between acinar epithelium and periacinar stroma was found regarding the different diagnosis. The correlation between MMP-2 and MMP-9 expression in relation to the number of labeled cells in acinar epithelium and periacinar stroma, as well as to the staining intensity in the periacinar stromal cells was evidenced in canine prostates with PIA. In conclusion, MMP-2 and MMP-9 expression has a variation in canine prostate according to the lesion, with lower expression in normal tissue and with BPH, and higher expression in those with PIA, PIN and PC. Moreover, the inflammatory microenvironment of the PIA has influence in the activity of both enzymes.Este estudo teve como objetivo avaliar a expressão das metaloproteinases 2 (MMP-2 e 9 (MMP-9 em próstatas caninas normais e com desordens proliferativas, verificando o papel dessas enzimas na remodelação da matriz extracelular (MEC e no processo de invasão tecidual. Um total de 355 amostras prostáticas foram obtidas, sendo 36 (10,1% normais, 46 (13,0% com hiperplasia prostática benigna (HPB, 128 (36,1% com atrofia inflamatória proliferativa (PIA, 74 (20,8% com neoplasia intraepitelial prostática (PIN e 71 (20,0% com carcinoma prostático (CP. Houve diferença de imunomarcação citoplasmática para MMP-2 e MMP-9 entre o epitélio acinar e o estroma periacinar, quanto aos

  1. Focos de dirofilariose canina na Ilha do Marajó: um fator de risco para a saúde humana Focus of canine heartworm disease in Marajó Island, North of Brazil: a risk factor for human health

    OpenAIRE

    Lourdes Maria Garcez; Nazaré Fonseca de Souza; Eduardo Ferreira Mota; Luís Antonio Jerônimo Dickson; Wandercleyson Uchoa Abreu; Vânia de Fátima do Nascimento Cavalcanti; Patrick Abdala Fonseca Gomes

    2006-01-01

    A ocorrência de dirofilariose pulmonar humana relaciona-se com a prevalência de infecção por Dirofilaria immitis na população canina. Várias espécies de mosquitos são vetores desse nematóide. Analisaram-se amostras de sangue canino coletados nas vilas Pingo d'Água e União, município de Salvaterra (Ilha do Marajó, PA), em junho, 2004 (n=34) e abril, 2005 (N=90). Os diagnósticos parasitológico e imunológico (ELISA - kit SNAP® 3DX™, Biobrasil) foram comparados (chi2, alfa=0,05) no exame de...

  2. Inquérito epidemiológico da leishmaniose visceral canina em três distritos sanitários do Município de Salvador, Bahia, Brasil

    OpenAIRE

    Barboza, Débora Cristina Portella Medina; Leal, Danielle Custódio; Souza, Bárbara Maria Paraná da Silva; Carneiro, Aroldo José Borges; Gomes Neto, Cyro de Moraes Barbosa; Alcântara, Adriano Costa de; Julião, Fred da Silva; Moura, Sandra Aparecida Balbuena de; Peralva, Lívia Maia Passos; FERREIRA, Fernando; Franke,Carlos Roberto

    2009-01-01

    p. 434-447 Objetivou-se com este estudo investigar a ocorrência da Leishmaniose Visceral (LV) canina nos Distritos Sanitários (DS) de Itapuã, Cajazeiras e Pau da Lima, pertencentes ao município de Salvador, por meio da realização de inquérito sorológico canino; inquérito entomológico, aplicação de questionário epidemiológico aos proprietários dos animais amostrados e a médicos veterinários do município. O estudo identificou seis cães soropositivos para os 811 aleatoriamente amostrados. Em ...

  3. Asociación entre la epidemiología de la rabia canina, la organización del programa de rabia y las condiciones socio-económicas en Colombia. Estudio ecológico. / Association between canine rabies epidemiology, the organization of rabies national control program and the socio-economic conditions in Colombia. Ecologic study

    OpenAIRE

    2007-01-01

    Se realizó un estudio epidemiológico para estimar la asociación entre la epidemiología de la rabia canina y las condiciones socio-económicas y del programa de rabia nacional en Colombia. Se observó una tasa de incidencia de 0,36 por cada 100.000 perros entre el 2001 y 2006. Se calculó un subregistro de la rabia canina del 87% causado por una deficiente vigilancia en la mayoría de los departamentos y distritos. Para la estimación del subregistro de la enfermedad en perros se usó la tasa 1,81 x...

  4. Avaliação da cultura de células-tronco do epitélio olfatório de cães sem raça definida (Canis familiaris Linnaeus, 1758)

    OpenAIRE

    Flávio Ribeiro Alves

    2009-01-01

    As células provenientes do epitélio olfatório apresentam capacidade regenerativa durante toda a vida, embora este mecanismo ainda não esteja completamente elucidado. O potencial de diferenciação de células-tronco provenientes do epitélio olfatório de cães sem raça definida (Canis familiaris Linnaeus, 1758) foi avaliado utilizando-se 12 cães adultos e 12 cães com 60 dias de vida intra-uterina, oriundos do Hospital Veterinário da FMVZ-USP. Após coletado, o epitélio olfatório foi submetido a pro...

  5. Canine ehrlichiosis: clinical, hematological, serological and molecular aspects Erliquiose canina: aspectos clínicos, hematológicos, sorológicos e moleculares

    Directory of Open Access Journals (Sweden)

    Andréa Cristina Higa Nakaghi

    2008-06-01

    écnicas, concluiu-se que a sorologia e a nPCR são testes adequados para a confirmação do diagnóstico da erliquiose canina. Entretanto, os resultados destas técnicas devem sempre ser complementares ao exame clínico e hematológico. A sorologia tem um importante papel nas fases subclínica e crônica da doença, por isso recomenda-se a nPCR para o diagnóstico na fase aguda e, especialmente, para a identificação da espécie de erliquia envolvida.

  6. Denervação capsular percutânea no tratamento da displasia coxofemoral canina Percutaneous hip denervation for the treatment of canine hip dysplasia

    Directory of Open Access Journals (Sweden)

    André Luis Selmi

    2009-04-01

    Full Text Available A displasia coxofemoral canina (DCF é uma afecção ortopédica freqüente, comumente dolorosa, decorrente de instabilidade e que leva à doença articular degenerativa. Várias formas de tratamento cirúrgico são descritas, entre elas a denervação capsular a céu aberto. Neste trabalho, é descrita a denervação capsular percutânea e seus efeitos em 92 cães com sensibilidade dolorosa na articulação do quadril atribuída à DCF. Foram avaliados os seguintes aspectos: o grau de claudicação (CLAUD, a dor por escala analógica visual, a perimetria da coxa (PC e os graus máximos de extensão (GME e flexão (GMF passiva do quadril imediatamente antes da cirurgia e aos sete, 15, 30, 180 e 360 dias de pós-operatório (p.o.. Os animais foram pré-medicados e submetidos à anestesia geral inalatória e, posteriormente, a borda acetabular crânio-dorsal foi denervada por meio da introdução percutânea de um pino de Steinman com aproximadamente 4,5mm de diâmetro. A CLAUD e a dor foram analisadas por meio da ANOVA e do teste de Friedman. A PC, a GME e a GMF foram analisadas por meio da ANOVA e do teste de Tukey. Foi observada melhora significativa na CLAUD e dor a partir dos 15 dias de p.o. A GME apresentou aumento significativo já aos 30 dias de p.o., enquanto que a PC apresentou aumento significativo após os 60 dias de p.o. Conclui-se que a denervação capsular percutânea é alternativa cirúrgica eficaz em restabelecer a movimentação do quadril displásico e promove melhora significativa da dor e claudicação.Canine hip dysplasia is a common painfull orthopedic disorder, resulting from articular instability and causing degenerative joint disease. Several treatment options are available, including capsular denervation. This study describes the results of percutaneous capsular denervation in 92 dogs diagnosed with hip dysplasia. Lameness (LAM and pain on palpation (PN were determined using a visual analogue scale (VAS, muscle girth

  7. Caracterización de un dispositivo intrauterino para controlar la natalidad canina - Characterization of Intrauterine devices for the canine birth-rate control

    Directory of Open Access Journals (Sweden)

    Mendoza Escanell, Pastor Felipe

    2010-03-01

    Full Text Available ResumenEn Cuba no se notifica el uso de ningún dispositivo intrauterino comométodo para controlar la reproducción de las mascotas caninas,empleándose sin embargo con frecuencia la esterilización quirúrgica, apesar de los riesgos que ésta implica. Las causas son: falta deinformación, desconocimiento de las ventajas de un DIU, einexistencia de dispositivos adecuados. En este trabajo proponemos lautilización de Dispositivo Intrauterino Canino (DIUC como medio pararesolver esa situación donde se evaluó la efectividad del dispositivo y se comparó con la técnica de ovario - histerectomía (OVH en cuanto a riesgos de realización, tiempo de recuperación, complicaciones,aumento de peso del animal y una valoración parcial de los costos. Eltrabajo se desarrolló durante un año en la clínica de animales afectivos del municipio de las Tunas con 21 perras adultas fértiles entre 10 y 25 Kg de peso. El DIUC fue elaborado en plástico recubierto de cobre y con un dispositivo adicional para su implantación. La recuperación total con el DIUC fue como máximo de 6 horas, mientras con la OVH fue necesario un mínimo de 8 días hasta la retirada de los puntos. Las complicaciones con el DIUC fueron casi nulas no así en el caso de OVH y las perras con OVH incrementaron significativamente su peso corporal.SummaryIn Cuba there is not record the use of any IUD as a method to controlof the reproduction canine mascots, however, surgery sterilization iscommonly used. There are many reasons for not using this method: The lack information, people don’t know the advantages of IUD, thereis not adequate devices. In our work we propose the use ofintrauterine canine devices (IUCD as a way to resolve this situation,where it we evaluated the effectiveness of this device and alsocompared with the ovary-hysterectomy (OVH when applying it, timeof recovering, complications, increment of animal’s weight, and costs – benefits relation. This work was developed

  8. Hepatic granulomas in canine visceral leishmaniasis and clinical status Granulomas hepáticos na leishmaniose visceral canina e classificação clínica

    Directory of Open Access Journals (Sweden)

    J.A.P. Sant’Ana

    2007-10-01

    Full Text Available The histopathological description of intralobular hepatic granulomas in animals with a defined clinical status (asymptomatic, oligosymptomatic and symptomatic animals was reported. Seventy-one mongrel dogs naturally infected with Leishmania chagasi were obtained from two Brazilian endemic areas: João Pessoa, PB and Belo Horizonte, MG. The hepatic parasite load was determined and compared to granuloma formation. Liver fragments from all infected animals showed remarkable leishmaniotic granulomatous inflammatory reaction. Granulomas with variable size were constituted by macrophages (parasitized or not with amastigotes of L. chagasi, some epithelioid cells, small numbers of lymphocytes, plasma cells, and rare neutrophils. Asymptomatic dogs had higher numbers of granulomas than oligosymptomatic and symptomatic animals from both geographical regions. However, the average diametric size of granulomas was very heterogeneous in all groups, independently of the geographic region (P>0.05. Parasite tissue load did not show any difference among liver fragments of all animals, especially when considering the defined clinical status and/or their geographic origin.Descreve-se a formação de granulomas hepáticos na leishmaniose canina em animais com classificação clínica definida - assintomáticos, oligossintomáticos e sintomáticos. Setenta e um animais, sem raça definida e naturalmente infectados com Leishmania chagasi, foram obtidos de duas regiões endêmicas brasileiras: João Pessoa, PB e Belo Horizonte, MG. A carga parasitária tecidual foi determinada mediante emprego do Leishmania Donovani Units (LDU e comparada com a formação de granulomas hepáticos. Fragmentos de fígado de todos os animais infectados mostraram reação granulomatosa notadamente leishmaniótica. Granulomas de variáveis tamanhos eram constituídos por macrófagos, parasitados ou não com formas amastigotas de L. chagasi, algumas células epitelióides, pequeno número de

  9. Estimativa de populações canina e felina domiciliadas em zona urbana do Estado de São Paulo Estimate of the owned canine and feline populations in urban area in Brazil

    Directory of Open Access Journals (Sweden)

    Ricardo Augusto Dias

    2004-08-01

    Full Text Available OBJETIVO: Dada a importância do conhecimento acerca da população de cães e gatos domiciliados para o adequado planejamento e avaliação das ações de controle da raiva em áreas urbanas, propõe-se a utilização de um valor preciso de estimativa dessas populações com base em indicadores populacionais humanos. MÉTODOS: Foi calculada a razão entre as populações humana e animal (canina e felina por meio de inspeções domiciliares, no Município de Taboão da Serra, SP. O município foi dividido em duas áreas homogêneas distintas socioeconomicamente, de acordo com o algoritmo da média k, de modo a permitir a comparação das razões homem:animal (cão e gato das áreas homogêneas. RESULTADOS: A razão entre a população humana e a população canina foi 5,14 e a entre a humana e a felina foi 30,57. Não foi observada diferença significativa ao comparar-se as razões entre as populações humana e animal das áreas homogêneas. CONCLUSÕES: A adoção de uma metodologia de estimativa populacional canina e felina domiciliada, baseada em indicadores populacionais humanos, é a mais indicada e facilmente exeqüível quando comparada ao censo canino.OBJECTIVE: Given the importance of assessing owned dog and cat populations to adequate planning and evaluation of rabies control measures in urban areas, it is proposed the use of an estimate of these populations based on human population parameters. METHODS: The ratio between human population and owned animal (dogs and cats population was calculated in the municipality of Taboão da Serra, state of São Paulo, Brazil. This municipality was divided into two distinct social and economic homogeneous areas through k-mean algorithm, allowing for comparison between the ratios of the two homogeneous areas. RESULTS: A 5.14 ratio was calculated for human and dog populations and a 30.57ratio for human and feline populations. A significant difference was not observed when comparing the ratios for

  10. Accidentes por mordedura canina, casos registrados en un hospital de niños de Lima, Perú 1995 - 2009 Dog bite accidents in a children hospital at Lima, Peru. Retrospective study from 1995 - 2009

    Directory of Open Access Journals (Sweden)

    Carmen Morales

    2011-12-01

    Full Text Available Entre 1995 a 2009 se registraron 206 hospitalizaciones en el Instituto Nacional de Salud del Niño debido a accidentes por mordedura canina. La mediana de edad de los pacientes fue cuatro años y para los días de hospitalización tres. El 61,7 % fueron varones. Los accidentes ocurrieron en el domicilio de una tercera persona (39,3 %, en vía pública (33,5 % y en el domicilio del agredido (27,2 %. El 66,5 % de los episodios fueron precedidos por un estímulo del niño y el 88,8 % causado por animales reconocidos por los lesionados. El 34,0 % reconoció la raza del animal (52,9 % animales cruzados. El 79,1 % fueron lesiones múltiples y la región anatómica más afectada fueron la cabeza y cuello (79,1 %. Se registraron complicaciones en un 20,4 % y secuelas estéticas en el 94,7 %. Las mordeduras caninas afectan la salud física de los niños.From 1995 to 2009, 206 cases of dog bites were recorded among hospitalized patients at the Children National Health of, Lima-Peru. The median of age was 4 years, and for hospitalization time was 3 days. Most patients were males (61.7 %. The bites occurred in the house of a third person (39.3 %, on the street (33.5 %, or in the victim’s house (27.2 %. A 66.5 % of the bites were provoked and 88.8 % were from animals known to the victim. The dog breed was recognized in 34 % (52.9 % were mongrel dogs. Multiple lesions were identified in 79.1 %, and the most frequently bitten areas were head and neck (79.1 %. Complications were reported in 20.4 % and aesthetic sequelae in 94.7 %.

  11. Leishmaniose tegumentar americana canina em municípios do norte do Estado do Paraná, Brasil Canine American cutaneous leishmaniasis in municipalities of northern Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Paulo Donizeti Zanzarini

    2005-12-01

    Full Text Available A leishmaniose tegumentar americana (LTA é endêmica no norte do Estado do Paraná, Brasil, afetando tanto o homem como os cães. O objetivo deste trabalho foi estudar a ocorrência da doença na população canina em áreas endêmicas de LTA. No período de setembro de 1999 a julho de 2002, foram investigados cães em sete localidades rurais de cinco municípios onde ocorreram casos humanos autóctones da doença, utilizando métodos parasitológicos e sorológicos. Dos 67 cães estudados, 14 (20,9% tinham lesões sugestivas de LTA, dos quais 3 (21,4% estavam infectados por Leishmania sp. Trinta e sete (55,2% cães apresentaram imunofluorescência indireta positiva para Leishmania (Viannia braziliensis. Os resultados mostram a ocorrência simultânea de leishmaniose humana e canina e indicam a necessidade de estudos adicionais para esclarecer o papel do cão no ciclo de transmissão do parasito nessas áreas.American cutaneous leishmaniasis (ACL is an endemic disease in northern Paraná State, where it affects humans and dogs. This study aimed to verify the occurrence of the canine disease in ACL endemic areas. From September 1999 to July 2002, dogs were investigated in 7 rural areas of 5 municipalities where autochthonous human cases of ACL had been reported. Parasitological and serological methods were used. Fourteen of 67 dogs studied (20.9% had lesions suggestive of ACL, of which 3 (21.4% were infected with Leishmania sp. Indirect immunofluorescence for Leishmania (Viannia braziliensis was positive in 37 (55.2% of 67 dogs. The results showed that human and canine ACL occur simultaneously and indicate the need for additional studies to elucidate the role of dogs in the ACL transmission cycle in the area studied.

  12. Evolución de la Socialidad, Estrategias Alimentarias y Anatomía Cráneodental en la Subfamilia Caninae

    Directory of Open Access Journals (Sweden)

    Fuentes Jesualdo Arturo

    2012-04-01

    Full Text Available

     

    Los carnívoros sociales afectan los parámetros poblacionales, la ecología, el 

    comportamiento, y las probabilidades de especiación y extinción de presas y otros 

    carnívoros simpátricos. Así, los carnívoros sociales pudieron influenciar la evolución de la estructura y organización de las comunidades ancestrales y modernas de mamíferos. Por tanto es importante identificar qué especies de carnívoros fósiles pudieron ser sociales y establecer cuándo, dónde y bajo qué contexto ecológico evolucionaron. El primer paso en la exploración de este tema es determinar si existe alguna asociación entre la variación en rasgos morfológicos, susceptibles de ser preservados en el registro fósil, y diferencias en niveles de socialidad en carnívoros actuales. Entre los carnívoros, la subfamilia Caninae es la más adecuada para este tipo de trabajo ya que poseen un registro fósil abundante y bien conocido, así como una marcada variación morfológica, ecológica y de comportamiento. El objetivo principal de este trabajo fue el de establecer si existe alguna asociación entre la variación de la conformación y variables que expresan propiedades mecánicas cráneo-dentales con diferencias en niveles de socialidad, hábitos alimentarios y sexo en cánidos modernos. Utilizamos una muestra de 972 especímenes de 33 especies de cánidos. Analizamos la conformación de la región lateral del cráneo, el arco zigomático, el hueso dentario y el corpus mandibular; así como 20 variables que indican propiedades mecánicas cráneodentales. Los resultados indican que los cánidos sociales e

  13. Investigação de áreas de risco como metodologia complementar ao controle da leishmaniose visceral canina Investigation of risk areas as complemental methodology for the control of canine visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Fred S. Julião

    2007-08-01

    Full Text Available Foram investigadas áreas de risco de leishmaniose visceral canina no município de Camaçari, Bahia. Um total de 278 cães distribuídos em 141 residências, pertencentes a 20 áreas de risco investigadas, foi examinado sorologicamente (ELISA. A soroprevalência geral foi 21,7% (56/258 depois da exclusão dos 20 cães usados no início do estudo para delimitar a área. Os resultados respectivos das análises univariada e multivariada dos fatores relacionados à infecção do cão por Leishmania chagasi, a captura e distribuição do vetor na área e a metodologia usada para localizar os focos caninos são discutidos.Risk areas of canine visceral leishmaniasis in the city of Camaçari, Bahia, Brazil, were investigated. A total of 278 dogs from 141 homes pertaining to 20 investigated risk areas was serologically screened (ELISA. The general seroprevalence was 21.7% (56/258 after exclusion of 20 dogs used at the beginning of the survey to limit the study area. The respective results of the univariated and multivariated analysis of factors related to infection of dogs by Leishmania chagasi, to vector distribu-tion pattern in the area and to the methodology used to localize the canine focuses are discussed.

  14. Aspectos biomecânicos compressivos de diáfises femorais caninas conservadas em glicerina a 98% ou em mel Biomechanical compressive aspects of canine femoral shafts preserved in 98% glycerin or honey

    Directory of Open Access Journals (Sweden)

    Gustavo Frassetto Amendola

    2008-08-01

    Full Text Available Neste estudo foi comparada a resistência compressiva axial de diáfises femorais caninas a fresco (grupo F, conservadas por trinta dias em glicerina a 98% (grupo G ou em mel (grupo M. Cada grupo continha 50 amostras que foram submetidas a testes biomecânicos compressivos, em uma prensa de compressão axial, até ocorrer fissura. Os ossos conservados em glicerina ou mel foram reidratados antes da avaliação. Pelos resultados obtidos, foi verificada maior resistência nos ossos conservados em glicerina, depois nos ossos conservados em mel, sendo mais frágeis aqueles testados a fresco.This study aimed at evaluating the axial compressive resistance of fresh canine femoral shafts (group F, canine femoral shafts preserved in 98% glycerin (group G or honey (group M for a 30-day period. The femoral shafts (50 samples in each group were submitted to biomechanical evaluation in a machine of axial compression in order to observe the pressure necessary to determine bone fissure. The shafts preserved in 98% glycerin or honey were rehydrated in saline 0.9% before evaluation. Bones stored in 98% glycerin have more resistance than bones preserved in honey and fresh implants presented the worst performance.

  15. Botanical Extracts from Rosehip (Rosa canina, Willow Bark (Salix alba, and Nettle Leaf (Urtica dioica Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes

    Directory of Open Access Journals (Sweden)

    Mehdi Shakibaei

    2012-01-01

    Full Text Available The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina, willow bark (Salix alba, and nettle leaf (Urtica dioica in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG, β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was examined by western blotting. Results. The botanical extracts suppressed IL-1β-induced NF-κB activation by inhibition of IκBα phosphorylation, IκBα degradation, p65 phosphorylation, and p65 nuclear translocation. These events correlated with downregulation of NF-κB targets including COX-2 and MMPs. The extracts also reversed the IL-1β-induced downregulation of collagen type II, CSPG, β1-integrin, and cartilage-specific transcription factor SOX-9 protein expression. In high-density cultures botanical extracts stimulated new cartilage formation even in the presence of IL-1β. Conclusions. Botanical extracts exerted anti-inflammatory and anabolic effects on chondrocytes. The observed reduction of IL-1β-induced NF-κB activation suggests that further studies are warranted to demonstrate the effectiveness of plant extracts in the treatment of OA and other conditions in which NF-κB plays pathophysiological roles.

  16. Avaliação da produção da vacina LBSapSal contra Leishmaniose visceral canina, frente ao desafio intradérmico experimental com Leishmania chagasi e extrato de glândula salivar de Lutzomyia longipalpis.

    OpenAIRE

    Mendonça, Caroline Amaral de

    2011-01-01

    Programa de Pós-Graduação em Ciências Farmacêuticas. CIPHARMA, Escola de Farmácia, Universidade Federal de Ouro Preto. No Brasil, o controle da leishmaniose visceral (LV) tem sido baseado num “tripé” de ações que preconiza o tratamento de casos humanos, o combate ao vetor e a eliminação de cães soropositivos, que infelizmente não tem alcançado bons resultados na redução dos casos de LV humana e canina. Assim, a imunoprofilaxia surge como uma das alternativas mais importantes para o control...

  17. Seroprevalencia de la infección por Borrelia burgdorgferi y Rickettsia conorii en población humana y canina de la zona básica de salud de San Andrés del Rabanedo (León, España)

    OpenAIRE

    1997-01-01

    FUNDAMENTOS: Se estudia la seroprevalencia de la infección por Borrelia burgdorferi y Rickettsia conorii en población humana y canina para conocer la situación de ambas en humanos, al mismo tiempo que la significación del perro, como indicador de la circulación de estos agentes entre aquéllos, en la Zona de Salud de San Andrés del Rabanedo, León. MÉTODO: Se realizó un estudio en 98 sueros humanos y 95 caninos (de diversas razas y aptitudes) frente a B. burgdorferi (títulos de positividad > a ...

  18. ESPOROTRICOSE NA ESPÉCIE CANINA: RELATO DE UM CASO NA CIDADE DE MOSSORÓ-RN SPOROTRICHOSIS IN THE CANINE SPECIES: A CASE REPORT ON CITY OF MOSSORO-RN

    Directory of Open Access Journals (Sweden)

    Kilder Dantas Filgueira

    2009-07-01

    Full Text Available A esporotricose é uma micose causada pelo Sporothrix schenckii e pouco frequente em cães. A confirmação diagnóstica é por isolamento fúngico em meio de cultura, mas este procedimento pode ser difícil em caninos infectados. Em virtude de ser rara nesta espécie, por possuir diagnóstico definitivo difícil e pela carência de relatos da doença no Nordeste brasileiro, o presente trabalho objetivou a descrição de um caso de esporotricose canina, na cidade de Mossoró, RN. Uma cadela, de três anos de idade, apresentava lesões cutâneas crônicas. O animal era alojado em quintal com areia, plantas e felinos peridomiciliados. O exame dermatológico demonstrou alopecia e nódulos subcutâneos cervicais. Exame citológico, raspado cutâneo para pesquisa de ácaro, sorologia para leishmaniose e cultura fúngica foram solicitados. O resultado sorológico foi não reagente e o raspado exibiu negatividade. Porém, a citologia evidenciou estruturas, no citoplasma de macrófagos, sugestivas de S. schenckii. O isolamento do fungo em cultura confirmou o diagnóstico de esporotricose. Fez-se o tratamento com itraconazol. A inclusão constante da esporotricose para o diagnóstico diferencial de pápulas, nódulos e ou úlceras cutâneas é fundamental na espécie canina.
     
    PALAVRAS-CHAVES: Canino, dermatologia, esporotricose, Mossoró.
    Sporotrichosis is a mycosis caused by Sporothrix schenckii and little frequent in canines. The diagnosis confirmation occurs by fungal isolation in culture medium, but this procedure can be difficult on infected dogs. Because it is rare in canines, its definitive diagnosis is difficult to achieve and due to a lack of reports about the disease in the northeast region of Brazil, the present study aimed to describe a canine sporotrichosis case, in the city of Mossoro, RN. A three-year-old female canine presented chronic cutaneous injuries. The animal was lodged at the backyard, in touch with sand, plants

  19. Análisis coste-beneficio y coste-efectividad, de las nuevas alternativas de inmunización surgidas en el mercado para la prevención de la leishmaniosis canina en las Fuerzas Armadas

    Directory of Open Access Journals (Sweden)

    M.B. Salinas Granell

    2013-12-01

    Full Text Available Antecedentes y objetivos: La incorporación de estudios epidemiológicos y métodos de análisis de costes suponen herramientas de primer orden dentro de la Sanidad Militar. Permiten optimizar los recursos y estructuras disponibles, manteniendo así la eficacia y efectividad en la lucha frente a las enfermedades, una de ellas la Leishmaniosis. La epidemiología de campo, se nos presenta como una útil herramienta para alcanzar nuestro objetivo sanitario estratégico que es el de controlar esta enfermedad. La leishmaniosis canina es una de las parasitosis de mayor repercusión en las Fuerzas Armadas tanto desde el punto de vista de salud pública como de operatividad de nuestros perros de trabajo militar. El trabajo tiene como objetivo comparar el coste-beneficio (C-B de dos tipos de vacunas con los costes que supondría la externalización de los servicios. Para ello se analiza el coste-efectividad (C-E, que supondría ampliar el actual programa de vacunación, con la incorporación de la nueva vacuna frente a LI (CaniLeish®, y analizar el coste-efectividad (C-E que supondría ampliar el actual programa preventivo antivectorial con la adquisición de un nuevo medicamento preventivo frente a LI (Leisguard®. Material y Método: Se ha estimado mediante el análisis coste-beneficio y coste-efectividad, la eficiencia que supondría, teniendo en cuenta la seroprevalencia actual, el ampliar el existente programa preventivo con la adquisición de las nuevas alternativas de inmunización (vacunación y uso de domperidona surgidas en el mercado frente a la leishmaniosis canina. Requiriéndose una valoración monetaria apropiada de los efectos sobre la salud de las alternativas evaluadas. Resultados: Se obtuvo que los costes globales de ambas alternativas son superiores al coste del tratamiento de la enfermedad, con relaciones coste-beneficio y coste-efectividad negativas (en términos de coste por mantenimiento de operatividad del efectivo canino, es

  20. Efectos terapéuticos del Oleozón en la Piodermitis Canina, considerando algunos procedimientos microbiológicos y micológicos - Therapeutic effects Oleozon in Piodermitis Dog, considering somme microbiological processes and mycological

    Directory of Open Access Journals (Sweden)

    Camps, Ana María

    2009-12-01

    Full Text Available ResumenLa investigación se realizó en el Consejo Popular Pedro Pompaperteneciente al municipio de Bayamo. Fueron analizados 70 canesmestizos, de ellos, 20 resultaron positivos a la Piodermitis Canina. Se tuvo en cuenta la edad, características de la lesión y factorespredisponentes. Se formaron cuatro grupos de cinco animales cada uno(A, (B, (C, (D. A cada mascota se le realizó el examen clínico porsistemas incluyendo la tríada (frecuencia respiratoria, frecuencia delpulso y temperatura. Luego se analizó la anamnesis de cada caso conmucha profundidad tratando de sensibilizar a los propietarios paraaportar la totalidad de los datos a la investigación. Al grupo (A, se le aplicó Oleozón 1 vez al día; al grupo (B Oleozón 2 veces al día; al grupo (C, Gentamicina Crema al 0.1% 1 vez al día y al grupo (DGentamicina Crema al 0.1% 2 veces al día. La duración de lostratamientos fue de siete días. Se evaluó la efectividad de los diferentes tratamientos, obteniéndose los mejores resultados en el grupo B (4.2 días para p < 0.05 con relación a los restantes concluye que el uso tópico del Oleozón durante siete días fue efectivo para el tratamiento de la Piodermitis Canina. El principal agente causal aislado fue el Staphylococcus intermedius, teniendo como causas primarias: parasitosis externa, heridas por peleas, intoxicación y quemaduras. SummaryThe investigation was carried out in the Popular Council Pedro Pompabelonging to the municipality of Bayamo. Seventhly mestizo dogs wereanalyzed, of them, 20 were positive to the Canine Piodermitis. One kept in mind the age, characteristic of the lesion and factors predisponentes.They were formed four groups of five animals each one (A, (B, (C,(D. To each mascot was carried out the clinical exam by systemsincluding the triad (breathing frequency, frequency of the pulse andtemperature. Then the anamnesis of each case was analyzed with a lotof depth trying to sensitize the proprietors to

  1. Identificación por PCR de Brucella canis en sangre y leche canina: Reporte de un caso PCR identification of Brucella canis in canine blood and milk: A case report

    Directory of Open Access Journals (Sweden)

    M Olivera

    2011-01-01

    Full Text Available La brucelosis canina, producida por Brucella canis, es una enfermedad asociada a problemas reproductivos y de carácter zoonótico. Estas bacterias son excretadas en orina, leche, fetos o semen de los animales infectados y la transmisión ocurre por contacto vía sexual, oral, nasal o conjuntival. El diagnóstico de rutina se realiza por serología, pero la confirmación requiere aislamiento del cultivo bacterial, lo cual es costoso y requiere laboratorios con nivel 3 de bioseguridad. Las técnicas moleculares son una posibilidad reconocida para determinar el ADN bacterial, con alta especificidad y sensibilidad. Este reporte evaluó como prueba de aplicación clínica una técnica de PCR desarrollada para cultivos bacteriales. A una hembra canina asintomática, con historia previa de la enfermedad, amamantando una camada sana de 4 días de nacidos, se le realizó la prueba serológica rápida en placa con 2ß-mercaptoetanol, hemocultivo y PCR, de leche y de sangre. Todas las pruebas fueron positivas a Brucella canis. Este es el primer reporte de diagnóstico en leche por PCR, lo que corrobora que animales clínicamente asintomáticos eliminan la bacteria por esta vía, lo que constituye un riesgo de infección para los neonatos y el riesgo zoonótico para veterinarios, propietarios del animal o personas que intervengan en el parto si no se toman medidas higiénicas preventivas.Canine brucellosis is a disease caused by Brucella canis that is associated to reproductive problems in dogs, and it is also known as zoonosis. These bacteria are excreted in urine, milk, fetus or semen of infected animals, and the transmission occurs via sexual, oral, nasal or conjunctival contact. Diagnosis is usually done through serology but confirmation requires isolation of bacterial culture, a costly process that requires laboratory biosafety level 3. Molecular techniques are a valid method to determine the bacterial DNA, offering high specificity and sensitivity

  2. Achados patológicos e imuno-histoquímicos em cães infectados naturalmente pelo vírus da cinomose canina Pathologic and immunohistochemistry findings in dogs naturally infected by canine distemper virus

    Directory of Open Access Journals (Sweden)

    Luciana Sonne

    2009-02-01

    Full Text Available A cinomose canina é uma doença viral e afeta principalmente os sistemas respiratório, gastrintestinal e nervoso. Neste trabalho foram analisados os achados patológicos e imuno-histoquímicos de 54 cães com cinomose de um total de 760 cães necropsiados no período de julho de 2006 a outubro de 2007. As lesões macroscópicas observadas foram caracterizadas por corrimento ocular e nasal mucopurulentas, hiperqueratose dos coxins digitais, pulmões avermelhados e não colapsados, atrofia do timo, conteúdo intestinal diarréico e placas de Peyer proeminentes. Os achados histológicos caracterizavam-se principalmente por pneumonia intersticial, rarefação linfóide, desmielinização da substância branca, manguitos perivasculares e corpúsculos de inclusão intranucleares e intracitoplasmáticos, que se localizam principalmente na mucosa do estômago, epitélios da bexiga, brônquios e bronquíolos, pelve renal, coxins digitais, pálpebra, orelha e tonsila no sistema nervoso central e em células mononucleares dos linfonodos, baço e tonsilas. Os tecidos foram marcados pela técnica imuno-histoquímica utilizando anticorpo monoclonal anti-cinomose canina. O coxim digital foi o tecido com maior número de casos marcados positivamente (67,4% dos casos, seguido pelo estômago com 62,7%. A imuno-histoquímica mostrou ser uma ferramenta importante para o estudo da distribuição do antígeno em cães infectados pela cinomose bem como indicou o melhor tecido para a confirmação do diagnóstico de casos suspeitos.Canine distemper is a viral disease that affects mainly respiratory, gastrointestinal and nervous system. The present study analyzes pathologic and immunohistochemical findings in 54 dogs with canine distemper of a total of 760 canine necropsies performed from July 2006 to October 2007. The gross lesions were characterized by mucopurulent oculonasal discharge, hyperkeratosis of footpads, red and not collapsed lungs, thymic atrophy, watery

  3. Amiodarona causa vasodilatação dependente do endotélio em artérias coronárias caninas Amiodarone causes endothelium-dependent vasodilation in canine coronary arteries

    Directory of Open Access Journals (Sweden)

    Alfredo José Rodrigues

    2005-03-01

    Full Text Available OBJETIVO: Avaliar os efeitos vasodilatadores da amiodarona em artérias coronárias caninas empregando soluções de amiodarona dissolvida em polisorbato 80 ou em água. MÉTODOS: Anéis de artéria coronária, com e sem o endotélio íntegro, foram imersos em solução de krebs e conectadas a um transdutor para aferição de força isométrica promovida por contração vascular. As artérias foram expostas a concentrações crescentes de polisorbato 80, amiodarona dissolvida em água, amiodarona dissolvida em polisorbato 80 e uma apresentação comercial da amiodarona (Cordarone®. Os experimentos foram conduzidos na presença e na ausência dos seguintes bloqueadores enzimáticos: apenas indometacina, Nômega-nitro-L-arginina associada à indometacina e apenas Nômega-nitro-L-arginina. RESULTADOS: O polisorbato 80 causou pequeno relaxamento não dependente do endotélio. O Cordarone®, a amiodarona dissolvida em água e em polisorbato 80 promoveram relaxamento dependente do endotélio, que foi de maior magnitude para a amiodarona dissolvida em polisorbato e para o Cordarone®. Apenas a associação de indometacina com a Nômega-nitro-L-arginina foi capaz de abolir o relaxamento dependente do endotélio provocado pela amiodarona dissolvida em polisorbato 80. CONCLUSÃO: Os resultados obtidos indicam que a vasodilatação promovida pela amiodarona em artérias coronárias caninas é causada principalmente pela estimulação da liberação de óxido nítrico e fatores endoteliais relaxantes dependentes das ciclo-oxigenases.OBJECTIVE: To assess the vasodilating effects of amiodarone on canine coronary arteries by using solutions of amiodarone dissolved in polysorbate 80 or water. METHODS: Rings of coronary arteries, with or without intact endothelium, were immersed in Krebs solution and connected to a transducer for measuring the isometric force promoted by a vascular contraction. The arteries were exposed to increasing concentrations of

  4. Focos de dirofilariose canina na Ilha do Marajó: um fator de risco para a saúde humana Focus of canine heartworm disease in Marajó Island, North of Brazil: a risk factor for human health

    Directory of Open Access Journals (Sweden)

    Lourdes Maria Garcez

    2006-08-01

    Full Text Available A ocorrência de dirofilariose pulmonar humana relaciona-se com a prevalência de infecção por Dirofilaria immitis na população canina. Várias espécies de mosquitos são vetores desse nematóide. Analisaram-se amostras de sangue canino coletados nas vilas Pingo d'Água e União, município de Salvaterra (Ilha do Marajó, PA, em junho, 2004 (n=34 e abril, 2005 (N=90. Os diagnósticos parasitológico e imunológico (ELISA - kit SNAP® 3DX™, Biobrasil foram comparados (chi2, alfa=0,05 no exame de 34 amostras. A prevalência na população (N=90 foi avaliada pelo ELISA. O ELISA revelou mais positivos (25/34; 73,5% que a gota espessa (23/34, 67,6% e o Knott (21/34, 61,8%, mas a diferença não foi significativa (p>0,05. A freqüência de infecção por D. immitis na faixa de 0 a 2 anos foi 58%, enquanto em cães mais velhos foi 100%. A prevalência da dirofilariose canina em Pingo d'Água e Vila União foi alta (53,5%, indicando risco de transmissão do parasito às pessoas nessa área.The occurrence of human pulmonary dirofilariasis maintains a relation with the prevalence of Dirofilaria immitis infection in the canine population. Several mosquito species are vectors of this nematode. Canine blood samples collected in Pingo d'Água and União villages, Salvaterra municipality (Marajó Island, Pará, in June, 2004 (n=34 and April, 2005 (N=90 were analyzed. Parasitological and immunological (ELISA - kit SNAP® 3DX™, Biobrasil diagnoses were compared following the examination of 34 samples. The prevalence in the population (N=90 was evaluated by means of ELISA. ELISA revealed more positive samples (25/34; 73.5% than thick smears (23/34, 67.6% or Knott (21/34, 61.8%, but the differences were not significant (p>0.05. The frequency of D. immitis infection was 58% in dogs ranging from 0-2 years old, whereas in older dogs it was 100%. The prevalence of canine dirofilariasis was high in Pingo d'Água and Vila União (53.5%, indicating the risk of

  5. Gastroenterite canina - agentes virais nas fezes de cães diarréicos e não diarréicos Canine gastroenteritis - viral agents in feces from diarrheic and non-diarrheic dogs

    Directory of Open Access Journals (Sweden)

    V.S.F. Homem

    1999-12-01

    Full Text Available Foram analisadas 33 amostras de fezes de cães com diarréia (n=25 e sem diarréia (n=8, de variadas idades e raças, de ambos os sexos, a fim de se determinar a ocorrência de agentes virais considerados causadores da gastroenterite no cão, suas possíveis associações e a participação no complexo gastroenterite canina, buscando relacionar a etiologia viral com o histórico de vacinação, além do exame clínico dos animais. Utilizou-se microscopia eletrônica nas 33 amostras fecais e o teste ELISA em 71 amostras para detecção de antígeno de rotavírus e adenovírus. Partículas virais foram detectadas em 75,8% (25/33 do total de amostras diarréicas ou não, examinadas à microscopia eletrônica. Em 44% dos espécimes positivos para vírus (11/25, o vírus-like tipo 1 foi o mais detectado nas amostras fecais, seguido pelo parvovírus (24%. A ocorrência de diarréia com sangue esteve associada a 90,9% dos agentes detectados, variando em freqüência de 25% a 100% dos casos.Fecal samples from both diarrheic (n=25 and non-diarrheic (n=8 dogs of both sexes, with varying ages and breeds, were examined by electronic microscopy (EM in order to determine candidate viral pathogens which would be associated with gastroenteritis, particularly the canine gastroenteritis complex, in an attempt to correlate viral etiology and clinical and vaccination history. In addition to EM, 71 stool samples were tested by ELISA to detect either rotavirus or adenovirus antigens. Viral particles could be visualized by EM in 25 (75.8% of the 33 samples. Type-I virus-like structures and parvoviruses were frequently detected, accounting for 44% and 36% of the virus-positive preparations. Bloody diarrhea was noted in 90.9% of dogs that were excreting viral particles.

  6. Leishmaniose visceral: estudo de flebotomíneos e infecção canina em Montes Claros, Minas Gerais Visceral leishmaniasis: a study on phlebotomine sand flies and canine infection in Montes Claros, State of Minas Gerais

    Directory of Open Access Journals (Sweden)

    Érika Michalsky Monteiro

    2005-04-01

    Full Text Available A leishmaniose visceral no Brasil estava inicialmente associada a áreas rurais, mas devido às diversas alterações no ambiente como, desmatamentos, urbanização e intenso processo migratório, ocorreu a expansão das áreas endêmicas, levando à urbanização da doença, principalmente nas regiões Sudeste e Centro Oeste do país. No município de Montes Claros, situado ao norte de Minas Gerais, foi feito um estudo para verificação da situação da LV. No ano de 2002 foi realizado inquérito sorológico canino e no período de setembro de 2002 a agosto de 2003 foi feito levantamento entomológico, utilizando armadilhas luminosas de CDC. A prevalência da LV canina apresentou taxa média de infecção em torno de 5%. A fauna de flebotomíneos estimada foi de 16 espécies, totalizando 1043 exemplares. Lutzomyia longipalpis foi a espécie predominante com 74%, o que sugere a sua participação na transmissão de LV em Montes Claros.Visceral leishmaniasis in Brazil was initially associated with rural areas. However, due to several environmental modifications such as deforestation, urbanization and intense migratory processes, there has been an expansion of endemic areas, leading to urbanization of the disease, mainly in the central and northeastern regions of Brazil. In the municipality of Montes Claros, located in the north of the state of Minas Gerais, an epidemiological survey on VL was carried out. A canine serological inquiry was carried out in 2002 and an entomological survey, using luminous CDC traps, was performed from September 2002 to August 2003. Canine VL prevalence showed an average infection rate of approximately 5%. An estimated 16 species comprised the phlebotomine sand fly fauna, based on a total of 1043 specimens. The predominant species was Lutzomyia longipalpis with a rate of 74%, suggesting its participation in the transmission of VL in the municipality of Montes Claros.

  7. CONSTITUTIVE EXPRESSION OF RaWUS GENE IN Rosa canina ON MORPHOLOGICAL ALTERATION OF TRANSGENIC TOBACCO LEAVES%狗蔷薇RaWUS基因组成型表达对烟草叶片形态的影响

    Institute of Scientific and Technical Information of China (English)

    姜福星; 刘凤栾; 马男; 张建甫; 赵梁军

    2012-01-01

    为验证从狗蔷薇类原球茎克隆的RaWUS基因的功能,构建了组成型表达载体,并用根瘤农杆菌介导的叶盘转化法对烟草进行了遗传转化。通过除草剂草丁膦筛选,获得了转基因植株并对其进行了表型观察和RT.PCR分析。结果显示转基因烟草叶片形态和叶脉表现出形态变化,包括叶片浅裂、叶片边缘波浪状、叶脉紊乱,甚至叶片的主脉上有不定芽的产生等。RT-PCR分析表明,RaWUS基因仅仅在经过草丁膦筛选的抗性转基因烟草中强烈表达,在野生型烟草中没有表达。表明RaWUS基因已经被成功转入烟草中,并可能通过改变激素的水平和调控维管束的发育来影响叶片形状。%To analyze the function of RaWUS gene isolated from protocorm-like body of Rosa canina, constitutive expression vector was constructed and transformed into tobacco(Nicotiana tabacum) plants by using the leaf disc method mediated through Agrobacterium-tumefaciens. Screening with herbicide glufosinate resistance,transgenic tobacco plants were obtained. Their phenotypes were observed and RT-PCR was conducted. Transgenic tobacco plants exhibited changes in the leaf shape and veins, including lobed leaves,leaves with wary margin, disorder veins even ectopic bud formation on the leaves, and so on. The RT-PCR analysis indicated the RaWUS gene was expressed strongly in the regenerated plants which showed glyphosate resistance,but not in the wild-type tobacco. The results showed that RaWUS gene had been introduced into tobacco. Regulation of vascular tissue through changes in hormone levels was possible to alter leaf morphology. The effect of the gene on development of protocorm-like body and application in plant biotechnology were also discussed in this study.

  8. Farklı Test Sistemleri ile Somatik Hücrelerde Profenofos Genotoksisitesine Karşı Kuşburnu (Rosa canina L. Ekstrelerinin Doğal Bir Antigenotoksik Ajan Olarak Kullanılması

    Directory of Open Access Journals (Sweden)

    Caner KASIMOĞLU

    2016-04-01

    Full Text Available Bu çalışmada, profenofos insektisitinin genotoksik etkileri, Drosophila melanogaster’de somatik mutasyon ve rekombinasyon testi (SMART ve insan periferal lenfosit hücrelerinde mikronükleus (MN testi ile araştırılmıştır. Bu maddenin olası genotoksik etkilerinin giderilebilmesi için de kuşburnu (Rosa canina bitkisine ait su ve etanol ekstreleri kullanılmıştır. SMART için D.melanogaster’in kanat preparatları incelendiği zaman, profenofosun artan konsantrasyonuna (0,025, 0,05, 0,075 ve 0,1ppm bağlı olarak normal kanat fenotipinde mutasyon frekansının arttığı özellikle en yüksek uygulama grubunda (0,1 ppm bu artışın pozitif etkili (+ olduğu gözlenmiştir (P0,05. Kuşburnu bitkisinin su (RCsu ve etanol (RCeta ekstreleri, profenofosun en yüksek konsantrasyonu (0,1 ppm ile birlikte uygulandığı zaman (profenofos+ RCsu/RCeta mutasyon frekansındaki artışın azaldığı ve bunun da istatistiksel olarak önemli olduğu gözlenmiştir (P<0,05. Bu çalışmada, farklı konsantrasyonlarda in vitro profenofos uygulaması (0,25, 0,5, 0,75 ve 1ppm ile insan periferal lenfosit hücrelerinde mikronükleus frekansının arttığı ve nükleer bölünme indeksinin (NBİ azaldığı da görülmüştür (P<0,05. Ancak profenofos+RCsu ve RCeta uygulamaları ile mikronükleus frekansı düşerken NBİ değeri de kontrol grubuna yaklaşmıştır (P<0,05.

  9. Etiology, antimicrobial susceptibility profile and epidemiological aspects in canine otitis: a retrospective study of 616 casesEtiologia, perfil de sensibilidade aos antimicrobianos e aspectos epidemiológicos na otite canina: estudo retrospectivo de 616 casos

    Directory of Open Access Journals (Sweden)

    Verônica Baldim de Oliveira

    2012-12-01

    Full Text Available A retrospective study of etiology, antimicrobial susceptibility profile and multiple drug resistance, and major epidemiological aspects were investigated in 616 cases of canine otitis. Staphylococcus ? hemolitic (26.27%, Malassezia pachydermatis (12.35%, and Pseudomonas aeruginosa (8.8% were the most common microorganisms identified. The isolates were susceptible mainly to norfloxacin (89.62%, gentamicin (83.25%, and ofloxacin (80.16%. High occurrence of resistance of isolates was observed to neomicin (30.84% and cephalexin (27.63%. Multiple drug resistance to three or more and five or more of antimicrobials tested was observed in 34.9% and 15.5% of isolates, respectively. The cases of canine otitis occurred predominantly in first years of age, in mixed breeds animals, at autumn season. The presence of itch, bad smell, and secretion in ear conduct were the major signs observed at clinical examination. Estudo retrospectivo da etiologia, perfil de sensibilidade microbiana, ocorrência de multirresistência dos isolados e os principais aspectos epidemiológicos foram investigados em 616 casos de otite canina. Staphylococcus ? hemolítico (26,27%, Malassezia pachydermatis (12,35% e Pseudomonas aeruginosa (8,8% foram os micro-organismos mais frequentes. Os isolados foram sensíveis “in vitro” principalmente a norfloxacina (89,62%, gentamicina (83,25% e ofloxacina (80,16%. Alta ocorrência de resistência das linhagens foi observada frente à neomicina (30,84% e cefalexina (27,63%. A ocorrência de resistência múltipla a três ou mais e cinco ou mais dos antimicrobianos foi observada em, respectivamente, 34,9% e 15,5% dos isolados. Os casos ocorreram predominantemente nos primeiros anos de idade, em animais sem raça definida, no período do outono. A presença de prurido, mau cheiro e secreção no conduto auditivo foram os principais sinais observados ao exame clínico.

  10. Risk factors and clinical disorders of canine ehrlichiosis in the South of Bahia, Brazil Fatores de risco e alterações clínicas da erhlichiose canina no sul da Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Renata Santiago Alberto Carlos

    2011-09-01

    Full Text Available The aim of this work was to study the clinical disorders and risk factors of canine ehrlichiosis in Ilhéus and Itabuna, Bahia, and compare different diagnostic methods. Blood samples were collected from 200 dogs. Each dog was clinically examined. A questionnaire was used to evaluate the risk factors. The blood samples were analyzed using the Dot-ELISA test; hematometry, platelet counts and searches for morulae on blood smears were performed. Nested PCR was carried out on 50 serologically positive samples and 50 negative samples. Three positive PCRs were sequenced. Thirty-six percent were serologically positivity and 5.5% from blood smears. The animals were anemic and thrombocytopenic. Presence of ticks and living in areas on the urban periphery were considered to be risk factors (p Objetivou-se com este trabalho estudar as alterações clínicas, fatores de risco da ehrlichiose canina nos municípios de Ilhéus e Itabuna, Bahia, e comparar diferentes métodos de diagnóstico. Amostras de sangue foram coletadas de 200 cães e cada animal foi examinado clinicamente. Foi preenchido um questionário para avaliar os fatores de risco. As amostras de sangue foram analisadas pelo teste Dot-ELISA e foram realizadas hematimetria, contagem de plaquetas e procura de mórulas em esfregaço de sangue. Nested-PCR foi realizada em 50 amostras positivas e 50 negativas na sorologia. Três amostras PCRs positivas foram seqüenciadas. Foi encontrado 36,0% de positividade na sorologia e 5,5% nos esfregaços sanguíneos. Os animais apresentavam anemia e trombocitopenia. Ter carrapatos e residir em áreas suburbanas foram considerados fatores de risco (p < 0,05. A Nested-PCR identificou 11 cães positivos, sendo 9 com sorologia positiva e 2 negativos. O sequenciamento de DNA foi compatível com a presença de Ehrlichia canis.

  11. Estudo da dinâmica populacional canina e felina e avaliação de ações para o equilíbrio dessas populações em área da cidade de São Paulo, SP, Brasil

    OpenAIRE

    Rita de Cássia Maria Garcia

    2009-01-01

    Procurou-se avaliar o comportamento da população humana do bairro Vargem Grande, município de São Paulo, SP, no período de 2005 a 2008, em relação à guarda de cães e gatos com ênfase aos aspectos sanitários e de bem estar. Paralelamente, buscou-se avaliar a dinâmica dessas populações animais e o impacto do controle reprodutivo e ações de saúde. Verificou-se que há uma alta renovação das populações canina e felina, conseqüência de elevadas taxas de mortalidade e natalidade, e que as ações de e...

  12. Evaluation of dog population in an urban area of Southeastern Brazil Avaliação da população canina da zona urbana do Município de Araçatuba, São Paulo, SP, Brasil

    Directory of Open Access Journals (Sweden)

    Cáris M. Nunes

    1997-06-01

    Full Text Available Planning control programs, for diseases such as rabies requires information on the size and structure of the dog and cat population. In order to evaluate the dog population of the urban area of Araçatuba city, S. Paulo State, Brazil, a survey was conducted using a questionnaire to interview members of households. Eighty-eight districts were visited (37,778 houses and the interview was possible at 77.93% of these. Human population size evaluated was 113,157 inhabitants. Houses that owned animals represented 55.2%, 26,926 of the animals concerned were dogs and 5,755 were cats. Of the dogs, 56.64% were 1-4 year olds and males represented 56.2% of the total population. Dog: person ratio was estimated at 2.8 dogs to every 10 persons, almost 3 times the ratio hitherto estimated and used in the planning of rabies vaccination campaigns.O planejamento de programas de controle de zoonoses urbanas como a raiva baseia-se no conhecimento do tamanho e estrutura da população canina e felina. Assim, no período de 21 de junho a 30 de agosto de 1994, foram realizadas visitas, casa a casa, com a finalidade de avaliar, mediante a aplicação de um questionário, o tamanho das populações humana, canina e felina da zona urbana de Araçatuba. A relação média cão/homem observada foi de 2,8:10, ou seja, 2,8 vezes maior que a geralmente utilizada para o planejamento de campanhas de vacinação anti-rábica, de um cão para cada 10 habitantes.

  13. 茯苓多糖对鼠和犬一般药理学实验研究%A General Pharmacological Study of Pachymaran in Mice and Canis Familiaris

    Institute of Scientific and Technical Information of China (English)

    林丽霞; 薛银萍; 梁国瑞; 刘俊霞; 孟岩; 熊晨

    2014-01-01

    after duodenal administration for 1, 2 and 4 h. Results The differences in values of central nervous system in mice and respiratory range, respiratory rhythm, blood pressure and heart rate in dogs before and after medication showed no statistically significant difference (P >0. 05). Conclusion Pachyma-ran has no obvious influence on nervous system in mice, respiratory system and cardiovascular system in canis familiaris.

  14. Aspectos epidemiológicos da leishmaniose visceral canina no município de Pedro Leopoldo, Minas Gerais, 2003 Epidemiologic aspects of canine visceral leishmaniasis in Pedro Leopoldo district, Minas Gerais, 2003

    Directory of Open Access Journals (Sweden)

    L.A.B. Naveda

    2006-12-01

    Full Text Available Determinou-se a prevalência da leishmaniose visceral canina (LVC no município de Pedro Leopoldo, MG, 2003, por meio de inquérito soro-epidemiológico. Coletaram-se amostras de sangue de 2.185 cães e aplicou-se questionário semi-estruturado em cada residência. Os animais foram divididos em quatro grupos, sendo o grupo A constituído de 1240 cães das áreas urbana e rural; o grupo B de 705 cães de áreas em torno dos focos; o grupo C, de 134 cães, cujas amostras foram coletadas durante o dia da vacinação anti-rábica oficial; e o grupo D composto de 111 cães errantes. Os dados foram armazenados em banco de dados EPIINFO 6.04b. Os 36 cães positivos foram localizados espacialmente com auxílio de GPS (Global Positioning System, e o georreferenciamento realizado por meio do programa AUTOCAD 2000. A prevalência global da LVC foi de 1,4% e variou de 1,1% na área urbana e 4,2% na rural. Estes resultados permitiram concluir que Pedro Leopoldo, de acordo com a classificação oficial do Ministério da Saúde, é área silenciosa, receptiva e vulnerável para LVC. A distribuição espacial dos casos é diferenciada e requer medidas sanitárias de acordo com cada área de risco.The prevalence of canine visceral leishmaniasis (CVL in Pedro Leopoldo district, 2003 was evaluated. A serum-epidemic inquiry was accomplished by collecting blood samples of dogs and by applying a semi structured questionnaire, according to groups, in each visited residence: group A, constituted of 1240 dogs of the urban and rural areas; group B, constituted of 705 dogs sampled around the focuses; group C, constituted of 134 dogs, wich samples were collected during the canine/feline antirabic vaccination; and group D, constituted of 111 wandering dogs. The data were stored in the EPI INFO 6.04b database. Positive dogs were spatially located using GPS (Global Positioning System and the geographycal reference was made through the AUTOCAD 2000 program. The district global

  15. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006 Dog fouling and helminth contamination in parks and sidewalks of Buenos Aires City, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.The aim of this study was to provide data on canine fecal and helminthic contamination from parks and sidewalks in Buenos Aires City, collected by the Laboratory of General Parasitology, School of Sciences, University of Buenos Aires. A census of dog feces was performed in 1-11 parks per year between 1991 and 2006, a single day each year. In the period 2000-2006, the census included feces on sidewalks surrounding the park. Thirty fresh fecal

  16. Prevalência da filariose canina causada por Dirofilaria immitis e Dipetalonema reconditum em Maceió, Alagoas, Brasil Prevalence of canine filariasis by Dirofilaria immitis and Dipetalonema reconditum in Maceió, Alagoas State, Brazil

    Directory of Open Access Journals (Sweden)

    Ana Cristina Brito

    2001-12-01

    Full Text Available A prevalência da filariose canina causada por Dirofilaria immitis e Dipetalonema reconditum, foi estimada após a realização de inquérito hemoscópico em 1.519 cães domiciliados. Foram examinados 1.097 cães nos sete distritos sanitários da cidade de Maceió, Alagoas, 204 na Ilha de Santa Rita e 218 na cidade de Paripueira. Em Maceió, foram detectados 15 (1,3% cães com microfilárias (MF de D. immitis e 15 (1,3% com MF de D. reconditum. Todos os casos positivos foram considerados autóctones. As MF de D. immitis e de D. reconditum mediram 298,1µm e 249,2µm de comprimento e 7,3µm e 4,4µm de largura, respectivamente. Além do diagnóstico parasitológico pela técnica de gota espessa (100µL, foi utilizado o teste imunológico Witness, para detecção de antígeno filarial circulante, o qual confirmou os dados parasitológicos e permitiu a detecção de casos de infecção oculta. De um total de 6.579 fêmeas examinadas, pertencentes a seis espécies de mosquitos, oito (0,1% fêmeas de Culex quinquefasciatus foram encontradas naturalmente infectadas com larvas de D. immitis. Estes resultados demonstram a presença simultânea de D. immitis e D. reconditum na mesma área geográfica.A survey on the prevalence of Dirofilaria immitis and Dipetalonema reconditum was conducted in 1,519 dogs from Maceió and two coastal areas in the State of Alagoas, Northeast Brazil, from 1995 to 1999, by testing for microfilariae in blood. All blood samples were from exclusively domiciled dogs with a known history, showing that the infections were autochthonous, confirming transmission of canine filariasis in these areas. In Greater Metropolitan Maceió, 15 (1.3% microfilaremic dogs were detected with D. immitis and 15 (1,3% with D. reconditum. In the southern coastal area there was an estimated prevalence of 12.7% for D. immitis. D. immitis and D. reconditum microfilaria were 298.1µm and 249.2µm long and 7.3µm and 4.4µm wide, respectively. A Witness

  17. Do dogs (Canis lupus familiaris) prefer family?

    Science.gov (United States)

    Hamilton, Jennifer; Vonk, Jennifer

    2015-10-01

    Kin recognition requires the ability to discriminate between one's own genetic relatives and non-relatives. There are two mechanisms that aid in kin discrimination: phenotype matching and familiarity. Dogs may be a good model for assessing these mechanisms as dogs are a promiscuous social species with a keen sense of smell. Domestic dogs of both sexes were presented with two scents (close kin, distant-kin) and preference was assessed through three measures (latency to approach, number of visits, time spent). Experiment 1 explored the possibility of phenotype matching as subjects had no contact with sires, whose scent was presented alongside a control male's scent. Experiment 2 explored recognition of siblings raised with the subjects and then separated at seven weeks of age. Whereas female dogs in this experiment did not show a statistically significant preference, male dogs showed a preference for distant-kin when presented with sire and female sibling samples.

  18. Enfermedad valvular degenerativa canina: reporte de caso

    Directory of Open Access Journals (Sweden)

    Carmenza Janneth Benavides Melo

    2014-07-01

    Full Text Available En caninos, la enfermedad valvular degenerativa o endocardiosis es la patología cardiovascular con mayor prevalencia. Se caracteriza por regurgitación de la sangre hacia las aurículas, con disminución del gasto cardiaco, lo que lleva a sobrecarga de volumen con hipertrofia excéntrica e insuficiencia cardiaca congestiva. Este reporte tiene como objetivo describir los hallazgos clínicos y de necropsia de un canino, sugestivos de una endocardiosis valvular. El paciente ingresó por consulta externa a la Clínica Veterinaria Carlos Martínez Hoyos, de la Universidad de Nariño (Pasto, Colombia. Su propietario lo reportó enfermo desde hacía dos meses, con signos de enfermedad respiratoria, pérdida de peso y decaimiento. En el examen clínico se encontraron membranas mucosas muy pálidas, disnea inspiratoria, estertores, desdoblamiento de S2, soplo de regurgitación mesosistólico grado 4 y dilatación abdominal con signo de choque de onda positivo. En la necropsia se evidenció abundante cantidad de material de aspecto acuoso traslúcido en cavidad abdominal, torácica y pericárdica, corazón severamente aumentado de tamaño, redondeado, con engrosamiento de válvulas atrioventriculares, hígado con moderada disminución de tamaño y evidencia de lobulillación, riñones severamente disminuidos de tamaño y pálidos de superficie irregular con presencia de múltiples áreas quísticas en región corticomedular. Se tomaron muestras de estos tejidos y se fijaron en formol bufferado al 10 %, para después ser procesadas para análisis histopatólogico en el Laboratorio de Patología de la Universidad de Nariño, mediante la técnica de hematoxilina y eosina de rutina. De esta manera se diagnostica como enfermedad valvular degenerativa.

  19. Prevalência da infecção canina em áreas endêmicas de leishmaniose tegumentar americana, do município de Paracambi, Estado do Rio de Janeiro, no período entre 1992 e 1993 Prevalence of canine infection from endemic areas of American cutaneous leishmaniasis in Paracambi District, Rio de Janeiro State, between 1992 and 1993

    Directory of Open Access Journals (Sweden)

    Ginelza Peres Lima dos Santos

    2005-04-01

    Full Text Available No município de Paracambi, Estado do Rio de Janeiro, foi realizado um inquérito epidemiológico sobre a leishmaniose tegumentar americana na população canina residente em áreas endêmicas rural e semiurbana. Foram cadastrados 179 cães e 138 (77,1% foram examinados, segundo seus aspectos clínicos e desenvolvimento de hipersensibilidade tardia ao antígeno Imunoleish® e respostas sorológicas à reação de imunofluorescência indireta e ao ensaio imunoenzimático. Dos 9 (6,5.% animais portadores de lesões/cicatrizes suspeitas, 66,7% foram causadas por Leishmania sp; 44,4% produziram infecção em hamsters e apresentaram crescimento em meio de cultura, compatíveis com o comportamento de Leishmania do complexo braziliensis. A caracterização molecular (análises isoenzimáticas e do perfil de restrição do KDNA identificou 2 amostras como similares à Leishmania (Viannia braziliensis. A prevalência da infecção canina observada através do teste cutâneo, RIFI e ELISA foi, respectivamente, 10,1%, 16,7% e 27,8%. A presença das formas clínica/subclínica da LTA na população canina associada à infecção humana sugere que o cão pode atuar como possível fonte de infecção, assim como na disseminação da doença.In the district of Paracambi, State of Rio de Janeiro an epidemiological survey for American tegumentary leishmaniasis in canine population was carried out in endemic localities. A total of 179 dogs was registered and 138 (77.1% examined for their clinical aspects, development of delayed hypersensitivity (DHS with Imunoleish® antigen and serological responses by indirect immunofluorescent reaction and enzyme-linked immunosorbent assay. In 9 (6.5% dogs with active cutaneous lesions or suspect scars, 66.7% were caused by Leishmania sp; 44.4% produced infection in hamsters and showed growth in culture media, which was considered to be compatible with the species of Leishmania braziliensis complex. The molecular

  20. Longevità e capacità di resilienza delle imprese familiari nella provincia di Salerno fra XX e XXI secolo = Longevity and resilience of family firms in the province of Salerno between the 20th and 21st century

    Directory of Open Access Journals (Sweden)

    Stefania Manfrellotti

    2014-06-01

    Full Text Available La provincia di Salerno ha rappresentato, nella seconda metà del Novecento, una delle realtà più rilevanti del Mezzogiorno d’Italia sotto il profilo industriale. Nel secondo dopoguerra l’industria nell’area salernitana visse un’intensa crescita, soprattutto grazie agli aiuti per il Mezzogiorno. Rispetto alle altre aree del Sud Italia, non vi furono grandissimi stabilimenti siderurgici, metalmeccanici e petrolchimici ma vi fu un movimento vivace di piccole e medie industrie soprattutto nel settore manifatturiero. Tra gli anni Settanta e Ottanta le crisi nazionali e internazionali segnarono il passo dell’economia italiana e più in generale di tutte le economie occidentali. Nella provincia di Salerno le fabbriche statali, quelle appartenenti a multinazionali estere o alle grandi imprese del settentrione furono le più colpite dalla crisi. Al contrario molte aziende locali riuscirono, sebbene con momenti di incertezza, ad avere un ciclo di sviluppo ininterrotto. Si tratta principalmente di imprese familiari, create e gestite da imprenditori salernitani, espressione del territorio, della cultura, delle tradizioni, che hanno saputo trarre dal contesto locale le energie e spesso le risorse per puntare all’eccellenza. Ancora oggi, sebbene quarant’anni di legislazione speciale per il Mezzogiorno non siano bastati a mettere in moto uno sviluppo duraturo e soprattutto autonomo delle imprese meridionali, lo sviluppo industriale meridionale è legato alle piccole e medie attività imprenditoriali operanti soprattutto nel settore manifatturiero. Tra le diverse esperienze di capitalismo locale e familiare di quest’area del Mezzogiorno si è scelto di analizzare una delle realtà imprenditoriali più longeve della provincia salernitana: il sistema di imprese della famiglia Di Mauro di Cava de’Tirreni. Dalla fine dell’Ottocento, la famiglia ha saputo affermare, espandere e reinventare la propria attività nel campo della tipografia, dell

  1. Epidemiological features and the neuropathological manifestations of canine distemper virus-induced infections in Brazil: a reviewAspectos epidemiológicos e as manifestações neuropatológicas associadas à infecção pelo vírus da cinomose canina no Brasil: uma revisão

    Directory of Open Access Journals (Sweden)

    Selwyn Arligton Headley

    2012-10-01

    Full Text Available This article provides a critical review of current epidemiological trends of canine distemper virus (CDV and syndromes related to canine distemper encephalitis (CDE with specific reference to the situation in Brazil. Epidemiological data relative to susceptible animal populations, prevalence, seasonal occurrence, and age-related patterns associated with CDV are discussed. The participation of mongrel dogs in maintaining CDV within rural and semi-urban canine populations and their importance in the epidemiology of canine distemper is highlighted. The economic impact of treating the clinical manifestations associated with CDV-induced infections in Brazil is estimated. Additionally, neurological and neuropathological manifestations of CDV in Brazil are discussed, and a novel manifestation of CDE is proposed. Esse manuscrito fornece uma revisão crítica das tendências epidemiológicas associadas ao vírus da cinomose canina (CDV e às síndromes relacionadas à encefalite por cinomose com referência específica à situação no Brasil. Os dados epidemiológicos relativos às populações de animais suscetíveis, prevalência, sazonalidade e os padrões relacionados à idade foram discutidos. Também é enfocada nessa revisão a participação de cães de rua na manutenção do CDV nas populações caninas nas áreas rurais e nas regiões semiurbanas e a sua importância na epidemiologia da cinomose. Foi ainda estimado o impacto econômico relacionado ao tratamento das manifestações clínicas associadas à cinomose no Brasil. Adicionalmente, as manifestações neurológicas e neuropatológicas da cinomose no Brasil são discutidas e uma manifestação neuropatológica inédita da infecção é sugerida.

  2. Toxoplasma gondii and Neospora caninum serological status of different canine populations from Uberlândia, Minas Gerais Reatividade sorológica para Toxoplasma gondii e Neospora caninum em diferentes populações caninas na cidade de Uberlândia, MG

    Directory of Open Access Journals (Sweden)

    T.W.P. Mineo

    2004-06-01

    Full Text Available Este trabalho teve como objetivo analisar a ocorrência de anticorpos contra Toxoplasma gondii e Neospora caninum em cães da cidade de Uberlândia, MG. As taxas de reatividade sorológica dos animais frente a esses parasitos foram comparadas em relação à sua origem e condições de vida. Um total de 369 amostras de soro canino foi obtido de três grupos de cães: (A 213 pacientes do Hospital Veterinário da Universidade Federal de Uberlândia, (B 62 pacientes de clínicas veterinárias particulares da cidade e (C 94 cães errantes da cidade. As amostras foram analisadas para a presença de anticorpos contra os parasitos por meio de ELISA. Os resultados mostraram soropositividades de 30,3% para T. gondii, 9,2% para N. caninum e 5,7% para ambos os parasitos. O grupo de cães errantes apresentou maior taxa de prevalência de anticorpos para os dois parasitos estudados. Pode-se concluir que as taxas de soropositividades para T. gondii e N. caninum nas populações caninas estudadas parecem ser fortemente influenciadas por suas origens e condições de vida.

  3. Virus isolation and molecular characterization of canine distemper virus by RT-PCR from a mature dog with multifocal encephalomyelit Isolamento e caracterização molecular do vírus da cinomose canina por RT-PCR a partir de um cão adulto com encefalomielite multifocal

    Directory of Open Access Journals (Sweden)

    Alexandre Mendes Amude

    2007-06-01

    Full Text Available A case of multifocal distemper encephalomyelitis in a mature dog is described. In the presented case the ante mortem clinical diagnosis of canine distemper virus (CDV infection could not be ideally performed due to the absence of typical signs of distemper, such as myoclonus and systemic signs accompanying the nervous signs. The definitive diagnosis of distemper encephalomyelitis was only carried out at post mortem through virus isolation in cell culture from fresh central nervous system (CNS fragments and CDV nucleoprotein gene detection in the CNS by RT-PCR.Descreve-se um caso de encefalomielite multifocal pela cinomose em um cão adulto. No caso apresentado o diagnóstico clínico da infecção pelo vírus da cinomose canina (CDV não pode ser adequadamente realizado devido à ausência de sinais típicos da enfermidade, tais como mioclonia e sinais sistêmicos. O diagnóstico definitivo somente foi possível post mortem pelo isolamento do CDV em cultivo celular a partir dos fragmentos frescos do sistema nervoso central (SNC e pela detecção do gene da nucleoproteína do CDV em fragmentos do SNC por meio da RT-PCR.

  4. Phlebotomine sand flies and canine infection in areas of human visceral leishmaniasis, Cuiabá, Mato Grosso Flebotomíneos e infecção canina em áreas de leishmaniose visceral humana, Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Gustavo Leandro da Cruz Mestre

    2011-09-01

    Full Text Available Visceral leishmaniasis is a systemic infectious disease that can cause to a severe, potentially life-threatening chronic condition in humans. Risk factors for infection in urban areas have been associated with poor living conditions, the presence of sand fly vectors and infected pets. This study aimed to describe sand fly and canine infection in the neighborhoods of human visceral leishmaniasis occurrence in the city of Cuiabá, Mato Grosso State, central-western Brazil, reported between January 2005 and December 2006. A total of 1,909 sand flies were collected. They were predominantly males and the most frequent species were Lutzomyia cruzi (81.25%, Lutzomyia whitmani (13.88% and Lutzomyia longipalpis (2.62%. The sand fly density was not significantly correlated with the variation of environmental factors. The prevalence of canine visceral leishmaniasis in the neighborhoods studied was 26.82% and it was found that areas with high density of vectors coincided with areas of high prevalence of dogs and those with the highest rates of human cases. The study of vectors and other potential hosts are essential for a good understanding of visceral leishmaniasis and the related public health concerns, aiming at the prevention and control of leishmaniasis in the city of Cuiabá, Mato Grosso State.A leishmaniose visceral é uma doença infecciosa sistêmica, de evolução crônica grave, potencialmente fatal para o homem. Os fatores de risco para a infecção em áreas urbanas têm sido associados às precárias condições de moradia, à presença de flebotomíneos vetores e de animais domésticos infectados. O presente trabalho objetivou descrever a fauna flebotomínica e infecção canina nos bairros de ocorrência da leishmaniose visceral humana no município de Cuiabá, Mato Grosso, notificados no período de janeiro de 2005 a dezembro de 2006. Foram coletados 1.909 flebotomíneos, as espécies mais frequentes foram Lutzomyia cruzi (81,25%, Lutzomyia

  5. Canine distemper virus infection in a lesser grison (Galictis cuja: first report and virus phylogeny Infecção pelo vírus da cinomose canina em um furão (Galictis cuja: primeiro relato e filogenia viral

    Directory of Open Access Journals (Sweden)

    Jane Megid

    2013-02-01

    Full Text Available Infectious diseases in wild animals have been increasing as a result of their habitat alterations and closer contact with domestic animals. Canine distemper virus (CDV has been reported in several species of wild carnivores, presenting a threat to wildlife conservation. We described the first case of canine distemper virus infection in lesser grison (Galictis cuja. A free-ranging individual, with no visible clinical sigs, presented sudden death after one day in captivity. Molecular diagnosis for CDV infection was performed using whole blood collected by postmortem intracardiac puncture, which resulted positive. The virus phylogeny indicated that domestic dogs were the probable source of infection.Doenças infecciosas em animais selvagens têm aumentado devido às alterações em seu habitat e ao maior contato com animais domésticos. A cinomose já foi descrita em diversas espécies de carnívoros selvagens, representando uma ameaça à conservação da vida selvagem. Nesse estudo é descrito o primeiro caso de infecção pelo vírus da cinomose em um furão (Galictis cuja. Um indivíduo de vida livre, sem sinais clínicos aparentes, apresentou morte súbita após um dia em cativeiro. Foi realizado o diagnóstico molecular para detecção do vírus da cinomose canina, sendo o resultado positivo. A filogenia do vírus indicou que cães domésticos foram a provável fonte de infecção.

  6. Correlation of clinical and hematological with definitive diagnosis of canine ehrlichiosis by PCRCorrelação dos achados clínicos e hematológicos com diagnóstico definitivo de erliquiose canina por meio de PCR

    Directory of Open Access Journals (Sweden)

    Carla Fredrichsen Moya-Araujo

    2012-12-01

    Full Text Available The Ehrlichiosis is a worldwide diseases of great importance in a veterinary medicine is an important infectious diseases whose prevalence has increased significant in the last year in the Brazilian states. Due to the fact that this study was designed to correlate the findings hematological clinical signs and PCR, being the most sensitive. This study evaluated twenty dogs seen at veterinary hospital UNESP – Botucatu campus during the 03 from august to September 28 2009. Animal cited 65% were positive in the PCR test. Among the most prominent clinical findings 76.92% (10/13 with anorexia, 53.84% (7/13 with hepatoesplenomegaly, 46.15% (6/13 with apathy and 38.46% (5/13 epistaxis. The thirteen animals positive PCR 92.30% (12/13 showed thrombocytopenia ( A Erliquiose é uma doença cosmopolita de grande importância na clínica médica veterinária, sendo uma importante enfermidade infecciosa, cuja prevalência tem aumentado significantemente nos últimos anos nos estados brasileiros. Devido a esse fato, o presente trabalho teve o intuito de correlacionar os achados hematológicos, sinais clínicos e PCR, sendo este último o mais sensível. No trabalho foram avaliados 20 cães com suspeita de Erliquiose que foram atendidos no setor de Moléstias Infecciosas do Hospital Veterinário da UNESP – Campus Botucatu SP, durante oito semanas. Dos animais citados, 65,00% (13/20 foram positivos em exame da PCR, nestes os achados clínicos mais evidentes foram 76,92% (10/13 anorexia, 53,84% (7/13 hepatoesplenomegalia, 46,15% (6/13 apatia e 38,46% (5/13 epistaxes. Dos treze animais positivos na PCR 92,30% (12/13 apresentaram-se trombocitopênicos (<150.000 plaquetas e 61,53% (8/13 anêmicos (<5.50 x106. Frente ao exposto, conclui-se que a técnica de PCR foi um bom método diferencial na detecção de Erliquiose canina podendo ser adotada, juntamente com os achados clínicos e hematológicos para o diagnóstico preciso da enfermidade em questão.

  7. Seroprevalencia de la infección por Borrelia burgdorgferi y Rickettsia conorii en población humana y canina de la zona básica de salud de San Andrés del Rabanedo (León, España

    Directory of Open Access Journals (Sweden)

    Rojo Vázquez Jaime

    1997-01-01

    Full Text Available FUNDAMENTOS: Se estudia la seroprevalencia de la infección por Borrelia burgdorferi y Rickettsia conorii en población humana y canina para conocer la situación de ambas en humanos, al mismo tiempo que la significación del perro, como indicador de la circulación de estos agentes entre aquéllos, en la Zona de Salud de San Andrés del Rabanedo, León. MÉTODO: Se realizó un estudio en 98 sueros humanos y 95 caninos (de diversas razas y aptitudes frente a B. burgdorferi (títulos de positividad > a 1/128 y > a 1/64 o superiores, respectivamente y 104 sueros humanos y 84 caninos frente a R. conorii (positividad a título > a 1/64 o superiores en ambas especies mediante inmunofluorescencia indirecta (IFI. RESULTADOS: Se halló positividad a las dos infecciones, tanto en personas como en perros. Frente a B. burgdorferi fue superior en humanos que en perros y frente a R. conorii fue superior en éstos que en humanos. En personas fue del 4,08% frente a B. burgdorferi y 1% frente a R. conorii; en perros fue del 2,10% frente a B. burgdorferi y del 14,28% frente a R. conorii. Los valores más altos se hallaron en los meses de primavera-verano, salvo en el caso de B. burgdorferi en perros. La seroprevalencia fue mayor en perros dedicados al cuidado de ganado (ovino que en los de caza y guarda. CONCLUSIONES: Los porcentajes de seroprevalencia hallados en nuestro trabajo, tanto en seres humanos como en caninos, considerados en el ámbito territorial de una zona geográfica semi-rural de la provincia de León, han sido iguales o inferiores a los reseñados para otras provincias, incluida la totalidad de la de León. En perros se halló mayor seroprevalencia frente a R. conorii que frente a B. burgdorferi, lo que indica que es el agente más extendido en nuestra Provincia, como han señalado otros autores. Los valores hallados en seres humanos frente a B. burgdorferi han sido más altos que en perros; la existencia de reacciones cruzadas con otros

  8. Autochthonous canine visceral leishmaniasis in a non-endemic area: Bom Sucesso, Minas Gerais State, Brazil Ocorrência de leishmaniose visceral canina autóctone em uma área não-endêmica: Bom Sucesso, Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Marcio Roberto Silva

    2008-02-01

    sintomas característicos de leishmaniose visceral canina. Os resultados desta investigação epidemiológica foram enviados às autoridades locais e estaduais de saúde pública requerendo medidas preventivas e de controle para leishmaniose visceral de forma a interromper a transmissão da doença e evitar a ocorrência de casos humanos.

  9. Transplante de membrana amniótica canina criopreservada para cicatrização de córnea com deficiência de células límbicas em coelhos Transplantation of cryopreserved canine amniotic membrane for cicatrisation in cornea with limbal stem cells deficiency in rabbits

    Directory of Open Access Journals (Sweden)

    D.N. Cremonini

    2007-12-01

    Full Text Available Avaliaram-se as alterações relacionadas à deficiência das células límbicas precursoras do epitélio corneano de coelhos e o efeito da membrana amniótica sobre sua cicatrização. A lesão, induzida com n-heptanol associado à peritomia conjuntival em 360°, foi recoberta com membrana amniótica canina, suturada à episclera perilímbica, criopreservada em meio para congelação de embrião ou em meio próprio, ambos com glicerol a 50% e mantida a -80°C. O grupo-controle não foi tratado com a membrana. As avaliações histológicas foram realizadas ao sétimo, 15º e 30º dias. Todos desenvolveram deficiência de células germinativas do limbo, denominada conjuntivalização, com presença de neovascularização, inflamação e defeitos epiteliais recorrentes, caracterizada na histopatologia pela presença de neovasos, edema, leucócitos e células caliciformes. O transplante de membrana amniótica não foi eficiente para o tratamento desta deficiência, entretanto auxiliou o processo de cicatrização da córnea.Changes related to limbal stem cells deficiency in corneal epithelium in rabbits, as well as the results of amniotic membrane transplant on the cicatrisation were evaluated. The ulcer was induced with n-heptanol associated to 360° conjunctival peritomy; the corneal surface was covered with canine amniotic membrane, sutured to perilimbal episclera, cryopreserved in embryo solution or own medium, both with 50% glycerol and stored at -80°C. The control group was not treated with membrane. Histological evaluations were performed at seven, 15, and 30 days. All of them developed limbal stem cells deficiency, named conjunctivalization, with neovascularization, inflammation and recurrent epithelial defects, observed in histopathology by the occurrence of neovascularization, edema, leukocytes and goblet cells. Thus amniotic membrane transplantation was not efficient in the treatment of limbal stem cells deficiency, however it helped in

  10. Detecção do vírus da cinomose canina por RT-PCR utilizando-se oligonucleotídeos para os genes da fosfoproteína, hemaglutinina e neuraminidase Detection of canine distemper virus by RT-PCR using oligonucleotides targeted to the phosphoprotein, hemagglutinin and neuraminidase genes

    Directory of Open Access Journals (Sweden)

    M. Pozza

    2007-10-01

    Full Text Available Empregou-se a técnica de reação em cadeia pela polimerase precedida de transcrição reversa para detecção do vírus da cinomose canina (CC. Para a padronização da técnica foram selecionados quatro pares de oligonucleotídeos (P1, P2, N1, H1, baseados em seqüências dos genes da fosfoproteína, neuraminidase e hemaglutinina, sendo utilizadas três cepas vacinais de vírus da CC como controles positivos. Foram analisadas três amostras isoladas de cães com cinomose e quatro amostras provenientes de cães com suspeita clínica de cinomose. Não houve amplificação nas amostras com suspeita clínica da doença. Os resultados obtidos com os oligonucleotídeos P1 e N1 foram superiores aos de H1. Os oligonucleotídeos P2 foram considerados inapropriados para a detecção do vírus da CC. Os amplicons obtidos com os oligonucleotídeos P1, N1 e H1 foram clivados com endonucleases de restrição, sendo os perfis das amostras virais comparados aos da amostra vacinal Lederle, utilizada como referência. Um padrão similar de restrição foi observado em todas as amostras analisadas.The reverse transcription-polymerase chain reaction was used to detect canine distemper virus (CDV. Four oligonucleotide pairs were selected (P1, P2, N1, H1, based on the sequences of the phosphoprotein, hemagglutinin and nuraminidase genes for assay standardization, and three CDV vaccine strains were used as positive controls. Three viral isolates from dogs with canine distemper and four samples from animals clinically suspected of distemper were analysed. No amplification was detected in suspected samples. Results obtained by using P1 and N1 oligonucleotides were superior to those with H1 ones. P2 oligonucleotides were considered inadequate for CDV detection. Amplicons resulting from amplification of P1, N1 and H1 oligonucleotides were submitted to cleavage by restriction endonucleases and restriction patterns of viral samples were compared to that of Lederle strain

  11. Ondas ultra-sônicas de alta freqüência causam disfunção endotelial em artérias coronárias caninas epicárdicas High-frequency ultrasonic waves cause endothelial dysfunction on canine epicardial coronary arteries

    Directory of Open Access Journals (Sweden)

    Berent Discigil

    2008-06-01

    Full Text Available OBJETIVO: Aplicação de energia por ultra-som pode facilitar a remoção da placa ateromatosa, mas o efeito desse procedimento em vasos próximos ainda é matéria de estudos experimentais. MÉTODOS: Para determinar se a energia ultra-sônica compromete a produção de óxido nítrico, segmentos de artérias coronárias caninas foram expostos a baixos (0-10 W e altos (25 W níveis de energia por 15 segundos, utilizando-se protótipo de aparelho para a realização de endarterectomia. Após exposição, segmentos das artérias coronarianas foram estudados em organ chambers. Para os ensaios farmacológicos foram utilizadas as seguintes drogas:difosfato de adenosina (ADP, acetilcolina (Ach e fluoreto de sódio (NaF para a avaliação do relaxamento dependente do endotélio. O nitroprussiato de sódio (NPS e o isoproterenol foram utilizados para a avaliação do relaxamento independente do endotélio. RESULTADOS: A aplicação de alta energia ultra-sônica comprometeu o relaxamento dependente do endotélio induzido por ADP (10-9 - 10-4 M, Ach (10-9 - 10-4 M e NaF (0,5 -9,5 mM em artérias coronarianas epicárdicas. Entretanto, baixos valores de energia ultra-sônica não alteraram o relaxamento dependente do endotélio (nem o relaxamento máximo e nem a EC50 induzido pelos mesmos agonistas. O relaxamento da musculatura lisa vascular induzido por isoproterenol (10-9 - 10-5 M ou NPS (10-9 - 10-6 M não foi comprometido, tanto por baixos, quanto por altos níveis de energia ultra-sônica. CONCLUSÃO: Os experimentos demonstram que altas energias ultra-sônicas alteram a função endotelial. Entretanto, o ultra-som não altera a habilidade de relaxamento da musculatura lisa vascular de artérias caninas epicárdicas.OBJECTIVE: Application of ultrasound energy by an endarterectomy probe can facilitate the removal of atheromatous plaque, but the effect of this procedure on surrounding vessel structure and function is still a matter of experimental

  12. Seroprevalence of Cutaneous Leishmaniasis (LC in dogs and identification of vectors (Diptera:Psychodidae in Bela Vista do Paraíso, Parana stateSoroprevalência da Leishmaniose Tegumentar Americana (LTA canina e fauna de Flebotomíneos (Diptera: Psychodidae em Bela Vista do Paraíso, Paraná

    Directory of Open Access Journals (Sweden)

    Bruno Bergamo Ruffolo

    2011-08-01

    Full Text Available The aim of this study was to determine the seroprevalence of Cutaneous Leishmaniasis (CL in dogs of Bela Vista do Paraiso, Parana state, compare the IFA and ELISA techniques and identify the vectors possibly involved in the cycle of the parasite. Were collected blood samples from 489 dogs that were subjected to detection of anti-Leishmania sp. by IFA and by ELISA. Were considered positive samples ³40 titers in IFA and for ELISA ³ 0.174 optical density. Among the samples analyzed, 222 (45.4% were positive by IFA and 189 (38.7% by ELISA. Comparing the tests were found 176 positive samples (36.0% and 254 negative (51.9% for both techniques. The sensitivity of ELISA was 79.3% and specificity was 95.1%. The global coefficient of the test was 87.0% with kappa coefficient of 0.75. Analysis of variables for dogs with positive serology by IFA showed significant differences regarding the absence of forests and lack of contact with other animal species. Positive sera by ELISA in dogs variables that showed significant differences were the type of riparian vegetation existing in the environment, the lack of garbage, open sewers and released directly into rivers or streams and garbage thrown on wasteland, burned or buried. The result obtained with the capture of sandflies was the predominance of Lutzomyia whitmani with 79.9% of the species collected. The result obtained with the capture of sandflies was the predominance of Lutzomyia whitmani with 79.9% of the species collected. The results showed that the LTA is widespread in the canine population of Bela Vista do Paraiso, and both the IFI and ELISA can be used for diagnosis. So the dog appears as a link between wild and peridomestic cycle of CL may become an amplifier of disease in this ecosystem.O trabalho teve como objetivo determinar a soroprevalência da Leishmaniose Tegumentar Americana (LTA canina no município de Bela Vista do Paraíso, Paraná, comparar as técnicas de imunofluorescência indireta

  13. Sensitivity evaluation of a single-step PCR assay using Ehrlichia canis p28 gene as a target and its application in diagnosis of canine ehrlichiosis Avaliação da sensibilidade da PCR em uma etapa com base no gene p28 de Ehrlichia canis e sua aplicação no diagnóstico da erliquiose canina

    Directory of Open Access Journals (Sweden)

    Andrea Cristina Higa Nakaghi

    2010-06-01

    alternativa no diagnóstico da erliquiose canina.

  14. Lesões histológicas no sistema nervoso central de cães com encefalite e diagnóstico molecular da infecção pelo vírus da cinomose canina Histopathological lesions in the central nervous system of dogs with encephalitis and molecular diagnosis of canine distemper virus infection

    Directory of Open Access Journals (Sweden)

    C.M.S. Gebara

    2004-04-01

    Full Text Available Dez amostras de urina de cães que apresentavam sinais clínicos sistêmicos e neurológicos indicativos da infecção pelo vírus da cinomose canina (CDV foram analisadas pela técnica da reação em cadeia pela polimerase precedida de transcrição reversa (RT-PCR para a detecção do RNA do CDV. O exame histopatológico foi realizado em fragmentos de cérebro, cerebelo e bexiga. Como controle negativo foram colhidos fragmentos de órgãos e urina de quatro cães sem sinais clínicos de doença infecciosa e que morreram por outras causas. Todos os cães (9/10 positivos em RT-PCR apresentaram alterações histológicas no cérebro e cerebelo, características de encefalite aguda (5/9 ou crônica (4/9 compatíveis com as causadas pelo CDV. Um dos cães com alterações clínicas neurológicas semelhantes às observadas em cinomose foi negativo na RT-PCR e apresentou alterações histopatológicas inespecíficas. Nas amostras de bexiga não foram observadas lesões histológicas. Todas as amostras biológicas provenientes dos cães-controle foram negativas na RT-PCR (urina e não apresentaram alterações histológicas (fragmentos de órgãos. O trabalho evidenciou a especificidade da RT-PCR no diagnóstico precoce e ante mortem na infecção pelo CDV.The reverse transcription-polymerase chain reaction (RT-PCR was used to detect canine distemper virus (CDV RNA in 10 urine samples from dogs that had died with clinical systemic and neurological signs indicative of CDV infection. Brain, cerebellum and urinary bladder fragments were collected for histopathological examination. For the negative control, urine and organ fragments were collected at necropsy from four dogs without clinical symptoms of infectious diseases that had died from other causes. The dogs positives in RT-PCR (9/10 presented histological lesions in the brain and cerebellum characteristic of acute (5/9 or chronic (4/9 encephalitis compatible with those caused by CDV. One of the dogs

  15. Frequency of canine heartworm disease (D. immitis in some regions of São Paulo State using a circulating antigen indicator test Freqüência de dirofilariose canina (D. immitis em algumas regiões do Estado de São Paulo por meio da detecção de antígenos circulantes

    Directory of Open Access Journals (Sweden)

    N.F. Souza

    2001-06-01

    Full Text Available The frequency of canine heartworm disease was determined in 310 dogs (158 males and 152 females from São Paulo city (154 and several towns along the São Paulo state coast (156. The survey was carried out through the Knott's technique (direct presence of microfilariae in the blood and ELISA for soluble circulating antigen detection. Twenty five (8.0% samples were positive to D. immitis using both methods being 6 dogs (3.9% from the city and 19 (12.2% from the coastal area. Nineteen dogs (6.1% were positive to the Knott's technique (4 from the city and 15 from the coastal area and 12 dogs (3.9% to the ELISA (4 from the city and 8 from the coastal area; six dogs (1.9% were positive for both methods being two from the city and four from the coastal area. The frequency of positive dogs by the Knott's technique in the coastal area was higher than that in São Paulo city (PDeterminou-se a freqüência da dirofilariose canina em 310 (158 machos e 152 fêmeas cães oriundos da cidade de São Paulo (154 e do litoral paulista (156. O levantamento foi realizado por meio da técnica de Knott (pesquisa de microfilárias e do teste de ELISA para detecção de antígenos circulantes solúveis. Vinte e cinco (8,0% amostras apresentaram-se positivas utilizando-se os dois métodos para D. immitis, seis (3,9% da cidade e 19 (12,2% da área litorânea. Detectou-se positividade ao Knott em 19 (6,1% amostras, quatro de São Paulo e 15 do litoral, e 12 (3,9% reagentes ao ELISA, quatro de São Paulo e oito do litoral; seis (1,9% amostras foram positivas pelos dois métodos, duas em São Paulo e quatro no litoral. A percentagem de cães positivos pelo método de Knott no litoral foi maior do que em São Paulo (P<0,05, porém ao teste de ELISA os casos positivos foram eqüivalentes. A infecção patente (microfilarêmica prevaleceu sobre a infecção oculta (amicrofilarêmica, portanto não houve grande freqüência de cães infectados provavelmente por não se tratar

  16. Detecção do gene da nucleoproteína do vírus da cinomose canina por RT-PCR em urina de cães com sinais clínicos de cinomose Detection of canine distemper virus nucleoprotein gene by RT-PCR in urine of dogs with distemper clinical signs

    Directory of Open Access Journals (Sweden)

    C.M.S. Gebara

    2004-08-01

    Full Text Available A presença do vírus da cinomose canina (CDV foi avaliada pela reação em cadeia da polimerase, precedida de transcrição reversa (RT-PCR, em 87 amostras de urina de cães que apresentavam sinais clínicos sugestivos de cinomose. Os animais foram distribuídos em três grupos. No grupo A foram incluídos 41 cães com alterações sistêmicas; no grupo B, 37 cães com alterações neurológicas; e no grupo C, nove cães com alterações sistêmicas e neurológicas simultâneas. O grupo D (controle foi composto por 20 cães assintomáticos. Os resultados da RT-PCR foram correlacionados com a forma clínica da infecção e com as alterações hematológicas encontradas. Foi possível a amplificação parcial do gene da nucleoproteína do CDV em 41 (47,1% das 87 amostras de urina provenientes de cães com sinais clínicos sugestivos de cinomose. Todas as amostras obtidas de animais assintomáticos foram negativas na RT-PCR. Amostras positivas foram encontradas nos três grupos de animais com sinais clínicos na proporção de 51,2% (24/41, 29% (11/37 e 100% (9/9 para os grupos A, B e C, respectivamente. A leucocitose foi a alteração hematológica mais freqüente nos três grupos de cães com sinais clínicos porém, não foi possível estabelecer correlação entre o resultado da RT-PCR e as alterações hematológicas. Os resultados demonstraram que, independente da forma de apresentação clínica, a técnica da RT-PCR realizada em urina pode ser utilizada no diagnóstico ante mortem da infecção pelo CDV.The urine of 87 dogs with clinical signs suggestive of canine distemper was analyzed by RT-PCR for detection of canine distemper virus (CDV nucleoprotein gene. The samples were allotted to the following groups: group A- with 41 dogs with systemic symptoms, group B- with 37 dogs with neurological signs, and group C- with 9 dogs with simultaneous systemic and neurological clinical signs. Group D (control included 20 assymptomatic dogs. A chi2

  17. Evaluación del efecto analgésico postoperatorio de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía Evaluation of postoperative analgesic effect of intraoperative infusions of tramadol and tramadol/lidocaine/ketamine compared with morphine/lidocaine/ketamine in female dogs undergoing ovariohysterectomy

    Directory of Open Access Journals (Sweden)

    MA Fajardo

    2012-01-01

    Full Text Available El objetivo de este estudio fue evaluar y comparar la eficacia analgésica postoperatoria de infusiones intraoperatorias de tramadol y tramadol/lidocaína/ketamina en comparación con morfina/lidocaína/ketamina en hembras caninas sometidas a ovariohisterectomía. Se usaron 30 hembras caninas sin distinción de raza con una edad entre 1 y 10 años y un peso entre 2,5 y 37 kilogramos, conformando tres grupos aleatorios de 10 animales cada uno: grupo tramadol, grupo tramadol/lidocaína/ ketamina y grupo morfina/lidocaína/ketamina, bajo anestesia general inhalada y ovariohisterectomía realizada por un mismo cirujano para todos los pacientes. El efecto analgésico postoperatorio se determinó mediante la escala de dolor de la Universidad de Melbourne, iniciando 30 minutos posteriores a la extubación endotraqueal del paciente, para luego tomar datos cada 30 minutos hasta completar un período de seis horas. El análisis estadístico se realizó con un test de Kruskal-Wallis para los datos no paramétricos. Los resultados obtenidos mostraron que los puntajes en el grupo tramadol presentaron diferencias estadísticamente significativas (P The goal of this study was to evaluate and compare the post-operative analgesic efficacy of intra operative infusions of tramadol and tramadol/lidocaine/ketamine compared to morphine/lidocaine/ketamine in female canines undergoing ovariohysterectomy. 30 female canines were used, without breed distinction with an average age between 1 and 10 years and weight between 2.5 y 37 kgs, creating 3 randomly allocated groups of 10 animals each: tramadol group, tramadol/lidocaine/ketamine group and morphine/lidocaine/ketamine group. All the animals were anesthetized using a standard technique and maintained with inhaled anesthetics, the surgical procedure was performed by the same trained surgeon. The postoperative analgesic effect was determined using the Melbourne Pain Scale, starting 30 minutes after endotracheal

  18. Do domestic dogs (Canis lupus familiaris) perceive the Delboeuf illusion?

    Science.gov (United States)

    Miletto Petrazzini, Maria Elena; Bisazza, Angelo; Agrillo, Christian

    2016-12-20

    In the last decade, visual illusions have been repeatedly used as a tool to compare visual perception among species. Several studies have investigated whether non-human primates perceive visual illusions in a human-like fashion, but little attention has been paid to other mammals, and sensitivity to visual illusions has been never investigated in the dog. Here, we studied whether domestic dogs perceive the Delboeuf illusion. In human and non-human primates, this illusion creates a misperception of item size as a function of its surrounding context. To examine this effect in dogs, we adapted the spontaneous preference paradigm recently used with chimpanzees. Subjects were presented with two plates containing food. In control trials, two different amounts of food were presented in two identical plates. In this circumstance, dogs were expected to select the larger amount. In test trials, equal food portion sizes were presented in two plates differing in size: if dogs perceived the illusion as primates do, they were expected to select the amount of food presented in the smaller plate. Dogs significantly discriminated the two alternatives in control trials, whereas their performance did not differ from chance in test trials with the illusory pattern. The fact that dogs do not seem to be susceptible to the Delboeuf illusion suggests a potential discontinuity in the perceptual biases affecting size judgments between primates and dogs.

  19. Word generalization by a dog (Canis familiaris: is shape important?

    Directory of Open Access Journals (Sweden)

    Emile van der Zee

    Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.

  20. How dogs lap: ingestion and intraoral transport in Canis familiaris

    OpenAIRE

    Crompton, A. W.; Musinsky, Catherine

    2011-01-01

    It has recently been suggested that the mechanism for lifting liquid from a bowl into the oral cavity during lapping is fundamentally different in cats and dogs: cats use adhesion of liquid to the tongue tip while dogs ‘scoop’ with their backwardly curled tongue. High-speed light videos and X-ray videos show that on the contrary, both cats and dogs use the mechanism of adhesion. Liquid is transported through the oral cavity to the oesophagus, against gravity, on the surface of the tongue as i...

  1. How dogs lap: ingestion and intraoral transport in Canis familiaris.

    Science.gov (United States)

    Crompton, A W; Musinsky, Catherine

    2011-12-23

    It has recently been suggested that the mechanism for lifting liquid from a bowl into the oral cavity during lapping is fundamentally different in cats and dogs: cats use adhesion of liquid to the tongue tip while dogs 'scoop' with their backwardly curled tongue. High-speed light videos and X-ray videos show that on the contrary, both cats and dogs use the mechanism of adhesion. Liquid is transported through the oral cavity to the oesophagus, against gravity, on the surface of the tongue as it is drawn upwards, then a tight contact between the tongue surface and palatal rugae traps liquid and prevents its falling out as the tongue is protruded. At least three cycles are needed for intraoral transport of liquid in the dog.

  2. Cetoacidose diabética canina Canine ketoacidosis

    Directory of Open Access Journals (Sweden)

    Leandro Zuccolotto Crivelenti

    2010-02-01

    Full Text Available A cetoacidose diabética (CAD, uma das complicações metabólicas em pacientes com diabetes mellitus (DM, caracteriza-se por hipercetonemia e alterações do equilíbrio ácido-base, juntamente com as alterações clínicas e laboratoriais compatíveis. Este trabalho objetiva apresentar uma revisão crítica dos principais pontos da etiopatogenia, dos sinais clínicos e das alterações laboratoriais da CAD, bem como discorrer sobre prognóstico e modalidades terapêuticas mais recentes, visando a fornecer subsídios ao clínico de pequenos animais.The diabetic ketoacidosis (DKA, one of the metabolic complications in patients with diabetes mellitus (DM, is characterized by hiperketonemia and acid-basic disturbances, in association with suitable clinic and laboratorial changes. This research aims to present a critical review on the main aspects of ethiopathogenesis, clinical sings and laboratorial changes of DKA, as well as the prognosis and the most recent therapeutic manners, in order to provide assistance to the small animal clinic.

  3. USO DE FIPRONIL SPRAY NO TRATAMENTO DA ESCABIOSE CANINA

    Directory of Open Access Journals (Sweden)

    Silvia Franco Andrade

    2005-06-01

    Full Text Available The objective of this work was to prove the effectiveness of the fipronil spray (FRONTLINE, a new synthetic molecule, as a safe acaricide in dogs. Were analyzed 10 dogs from the attendance of the service of Dermatology of the Veterinary Hospital and of the kennel of UNOESTE, Presidente Prudente, SP, with symptomatic and tested positive for scabies by scrapings, and used the fipronil spray in the whole body of the animal, besides external ear conduct, weekly until the disappearance of the symptoms and scrapings from the skin tested negative for scabies. The remission of the symptoms jointly with scraped of skin negative it happened on average from 4 to 6 weeks, demonstrating to be the fipronil spray effective and practical could be a safe alternative in the treatment of the canine scabies.

  4. Nutrient composition of rose (Rosa canina L.) seed and oils.

    Science.gov (United States)

    Ozcan, Musa

    2002-01-01

    Rose seeds were evaluated for weight of 100 seeds, moisture, crude protein, ash, crude oil, energy, and mineral content. Also, fatty acid composition was determined in the seed oils. The weight of 100 seeds, moisture, crude oil, energy, and iron (Fe) content of Ermenek rose seeds were found to be higher than those of other regions. The major fatty acids identified by gas chromatography of rose seed oils growing wild in the Hadim, Taskent, and Ermenek regions in Turkey were, respectively, as follows: palmitic (3.17%, 1.71%, and 2.14%), stearic (2.47%, 2.14%, and 1.69%), oleic (16.73%, 18.42%, and 14.71%), linoleic (54.41%, 51.71%, and 48,64%), linolenic (17.14%, 16.42%, and 18.41%), and arachidic (2.11%, 1.87%, and 2.61%). The seeds were rich in oil and minerals. The oil may be valuable for food and other uses because of its high unsaturated content.

  5. Esporotricose canina: relato de caso Canine sporotrichosis: case report

    Directory of Open Access Journals (Sweden)

    N.T. Souza

    2009-06-01

    Full Text Available Relata-se um caso de esporotricose em um cão da raça Boxer, macho, com seis anos, encaminhado para uma consulta por causa de massa na região nasal e de dispneia. Após o exame físico, o animal foi internado para a realização de citologia, histologia e radiografia. Nos exames citológico e radiográfico, não foram constatadas alterações que justificassem a massa e a dispneia. Na histologia, observou-se a presença de um granuloma contendo dois esporos de Sporothrix schenckii. Foi realizado tratamento com itraconazol 5mg/kg BID por 60 dias. Após esse período, a massa desapareceu e a respiração do animal melhorou, tendo sido recomendada a manutenção da terapia por mais 30 dias, para evitar recidiva.A case of canine sporotrichosis was reported in a six-year-old male Boxer, referred to a veterinary hospital because of a mass in the region of the nose and dyspnea. After physical examination, the animal was submitted to cytological, histological, and radiographic exams. The cytological and radiographic exams showed no alterations that could justify the mass and the dyspnea. The histological exam showed the presence of a granuloma with two Sporothrix schenckii spores. The dog was treated with itraconazol 5mg/kg BID during 60 days. After this period, the mass disappeared and breathing improved. The therapy was maintained for 30 other days to avoid relapse.

  6. Canny edge detection based on OpenCV in Ubuntu%Ubuntu下基于OpenCV的Canny边缘检测

    Institute of Scientific and Technical Information of China (English)

    许才敬

    2011-01-01

    详细地介绍了用于数字图像处理的开放源代码的计算机视觉类岸-OpenCV.利用OpenCV中的数字图像处理函数使复杂的问题变得简单化.介绍了OpenCV的特点和功能,讨论了在Ubuntu环境下如何配置OpenCV,最后在此基础上给出了一个CAnny边缘检测应用实例,其对数字图像处理的研究具有一定的实用价值.

  7. Seroprevalencia de leptospirosis canina en perros atendidos en clínicas veterinarias, mediante aglutinación microscópica y comparación con las técnicas de aislamiento e inmunofluorescencia indirecta Frequency of canine leptospirosis in dogs attending veterinary practices determined through microscopic agglutination test and comparison with isolation and immunofluorescence techniques

    Directory of Open Access Journals (Sweden)

    R F Silva

    2007-01-01

    Full Text Available La leptospirosis es considerada una de las zoonosis más difundidas y un serio problema de salud pública en el mundo entero. El perro actúa como un potencial diseminador de esta enfermedad ya que mantiene una estrecha relación con el hombre, y al mismo tiempo con otros animales tanto domésticos como salvajes. A pesar de su importancia, la leptospirosis canina frecuentemente es subdiagnosticada. En el presente estudio se determinó la frecuencia de leptospirosis en 400 perros, tanto de la zona urbana como rural, atendidos en clínicas de la ciudad de Valdivia (Chile; tal determinación se realizó mediante el test de aglutinación microscópica (MAT. Cada suero se enfrentó a ocho serovares de leptospira, encontrándose un 14,8% de caninos positivos, de los cuales el mayor porcentaje reaccionó a los serovares carneóla, icterohaemorrhagiae y ballum. La mayoría de estos sueros lo hizo a títulos entre 1/400 y > 1/1.600. Los resultados obtenidos en el presente trabajo no muestran diferencias significativas en relación al sexo, procedencia (rural/urbano, raza, animales vacunados y no vacunados. Sí se presentó relación entre el estado de perro vago y la probabilidad de contraer la enfermedad, y entre los valores obtenidos para los perros vacunados con respecto a la infección por el serovar ballum, que sugerirían una mayor probabilidad de contraer la infección por este serovar en los perros vacunados relativo a los perros no vacunados. Se compararon, además, las técnicas MAT, aislamiento e inmunofluorescencia indirecta (IFI, a partir de tejido renal. Para realizar la IFI, se obtuvo suero hiperinmune inoculando ratas con los serovares canicola e icterohaemorrhagiae. Se encontró un 14% de caninos positivos a MAT, frente a los serovares canicola, icterohaemorrhagiae y ballum. La mayoría de estos sueros lo hizo a títulos entre 1/400 y > 1/1.600. No se pudo obtener ningún aislamiento a partir de tejido renal, a pesar de que algunos de

  8. Estudio de valores referenciales para bioquímica sérica en población canina de la Parroquia San José, Distrito Valencia, Estado Carabobo - Reference values study of serum biochemistry in canine population of the Parroquia San José, Valencia Municipality, Carabobo State

    Directory of Open Access Journals (Sweden)

    Castellano, Aylet

    2010-05-01

    Full Text Available ResumenEstudio de valores referenciales para bioquímica sérica en población canina de la Parroquia San José, Distrito Valencia, Estado Carabobohttp://www.veterinaria.org/revistas/redvet/n050510/51012.pdf1 Los valores de referencia se utilizan para diferenciar pacientes sanos de enfermos, para el pronóstico y evaluación de los factores de riesgo, así como para monitorear la efectividad de un tratamiento; sin embargo su uso puede ser limitado cuando proceden de animales de otros países, ya que han sido determinados en diferentes condiciones climáticas y ambientales. El propósito de este estudio fue establecer intervalos bioquímicos de referencia para caninos de la Parroquia San José, Distrito Valencia, Estado Carabobo, Venezuela. Se tomaron muestras séricas de 937 perros clínicamente sanos (449 machos y 488 hembras pertenecientes a 48 razas diferentes, entre septiembre de 2006 y diciembre de 2008, a los cuales se les practicó pruebas bioquímicas de laboratorio. Los resultados obtenidos fueron: Glicemia: 79,3 ± 16,5 mg/dL; Urea: 31,8 ± 14,0 mg/dL; Nitrógenoureico: 15,3 ± 6,7 mg/dL; Creatinina: 0,94 ± 0,33 mg/dL; Proteínastotales: 6,1 ± 0,73 g/dL; Albúmina: 2,9 ± 0,83 g/dL; Globulinas: 3,2 ± 1,1 g/dL; Bilirrubina total: 0,46 ± 0,17 mg/dL; Bilirrubina directa: 0,15 ± 0,07 mg/dL; Bilirrubina indirecta: 0,31 ± 0,15 mg/dL; Aspartatoaminotransferasa: 51,1 ± 16,0 U/L; Alanino-aminotransferasa: 47,6 ± 17,0 U/L; Fosfatasa Alcalina: 53,3 ± 40,8 U/L. No se obtuvieron diferencias estadísticamente significativas de las variables bioquímicas estudiadas en función de la raza y el sexo (P0,05, mientras que los caninos menores de un año presentaron valores superiores de Fosfatasa Alcalina e inferiores de Proteínas totales y Globulinas (P0,05. Los intervalos bioquímicos fueronestablecidos usando los P2,5 y P97,5. Los resultados obtenidos pueden usarse en laboratorios de diagnóstico veterinario.SummaryThe reference values are

  9. LEISHMANIOSE VISCERAL CANINA (LVC: SOROPREVALÊNCIA, ASPECTOS CLÍNICOS, HEMATOLÓGICOS E BIOQUÍMICOS DE CÃES NATURALMENTE INFECTADOS EM UMA ÁREA ENDÊMICA NO MUNICÍPIO DE SÃO LUIS, ESTADO DO MARANHÃO, BRASIL CANINE VISCERAL LEISHMANIASIS (CVL: SEROPREVALENCE, CLINICAL, HEMATOLOGICAL AND BIOCHEMICAL FINDINGS OF DOGS NATURALLY INFECTED IN AN ENDEMIC AREA OF SÃO JOSÉ DE RIBAMAR MUNICIPALITY, MARANHÃO STATE, BRAZIL

    Directory of Open Access Journals (Sweden)

    Tiago Barbalho Lima

    2008-10-01

    Full Text Available

    Objetivou-se verificar a soroprevalência e os parâmetros clínicos, hematológicos e bioquímicos de cães naturalmente infectados por Leishmania em uma área endêmica. Realizou-se a sorologia pela reação de imunofluorescência indireta (RIFI em 76 cães sem raça definida. Os resultados demonstraram que 28 (36,84% foram positivos, enquanto 15 (53,57% eram assintomáticos e 13 (46,43% sintomáticos. Os sinais clínicos mais freqüentes foram onicogrifose, lesões de pele (alopecia, úlceras, descamação furfurácea e linfoadenopatia localizada. Em 6 de 22 animais (27,27% observou-se anemia. As análises bioquímicas indicaram que a infecção causada por Leishmania pode levar a alterações hepáticas. Não se observaram alterações renais. Conclui-se que os parâmetros bioquímicos podem ser úteis para acompanhar os estágios clínicos da doença.

    PALAVAS-CHAVES: Análises bioquímicas, hematologia, Leishmaniose visceral canina.

    This study aims at verifying the seroprevalence of dogs naturally infected with Leishmania in an endemic area together with clinical, hematological and biochemical parameters. A seroprevalence survey was conducted in 76 household mongrel dogs by an Indirect Antibody Test (IFAT. The results showed that 28 (36.84% were positive; 15 (53.57% were asymptomatic and 13 (46.43% were symptomatic. The most frequent clinical signs were onychogryphosis, skin lesions (alopecia, ulcers, dry desquamation and localized lymphadenopathy. In 6 out 22 dogs (27.27% anemia was observed. The biochemical analyses indicated that infection caused by Leishmania can lead to hepatic changes. Kidney changes were not observed. In conclusion, the hematological and biochemical parameters would probably help to follow up the clinical stage of the disease.

    KEY WORDS:

  10. Disfunção endotelial após isquemia global e reperfusão em cirurgia cardíaca com circulação extracorpórea: estudo do papel do magnésio em artérias coronarianas caninas

    Directory of Open Access Journals (Sweden)

    Marco A. VOLPE

    2002-09-01

    Full Text Available OBJETIVO: Estudar a disfunção endotelial conseqüente à lesão provocada por isquemia global seguida de reperfusão e a potencial influência protetora do magnésio sobre a integridade funcional do endotélio em coronárias isoladas de cães. MÉTODO: Segmentos de artérias coronárias caninas foram suspensos em banhos orgânicos para medida de força isométrica. A disfunção endotelial foi avaliada pela capacidade destes segmentos produzirem óxido nítrico, alterando a força isométrica inicial. Foram selecionados quatro grupos com seis cães em cada um: SEM CEC (controle, CEC (110 minutos de perfusão sem isquemia, ISQ (45 minutos de isquemia, ISQ/REP (45 minutos de isquemia seguidos de 60 minutos de reperfusão. A ação do magnésio foi avaliada em três fases: I (banho orgânico com magnésio, II (banho orgânico sem magnésio e III (banho orgânico com magnésio restaurado. Foram utilizados três agonistas farmacológicos que representam os principais passos da via de produção do óxido nítrico: receptor de membrana da célula endotelial - acetilcolina (ACh; transdução do sinal entre o receptor e os processos intracelulares através da G-proteína - fluoreto de sódio (NaF; liberação dos estoques intracelulares de cálcio - cálcio ionóforo (A23187. Ao estudo da função endotelial associou-se a avaliação da atividade da musculatura lisa dependente de GMPc - nitroprussiato de sódio (NPS. RESULTADOS: Os principais achados desta investigação foram: 1 a presença de magnésio no perfusato pareceu atenuar a disfunção endotelial causada por isquemia global seguida de reperfusão; 2 a presença de magnésio no banho orgânico (fase I associou-se a maior relaxamento em resposta aos agonistas da produção de óxido nítrico; 3 a remoção de magnésio do banho orgânico (fase II esteve associada à redução na intensidade do relaxamento em resposta aos agonistas da produção de óxido nítrico; 4 a restauração de magn

  11. Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

    Energy Technology Data Exchange (ETDEWEB)

    Ramadinha, L.S.

    1988-12-31

    The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.

  12. Canny边缘检测算法在机器人视觉中的应用%Application of Canny Edge Detection Algorithm in Robot Version

    Institute of Scientific and Technical Information of China (English)

    陈宏申; 李环

    2011-01-01

    OpenCV是一个以C函数为主,提供多语言接口,轻量并高效的计算机视觉库.实现了图像处理和计算机视觉方面的多种通用算法。利用其Canny边缘检测算法.实现模糊图像的边缘检测,参照L2BOT视觉机器人实例,对单一背景模式下基于OpenCV的条形码与障碍物识别进行研究,并对机器人移动路线最优选择提供一种参考模型。%OpenCV is a lightweight and efficient library of programming functions, mainly aim at real time computer vision, which realizes a series of general algorithm in the field of image processing and computer vision, it consists of C function mainly and prov

  13. What or where? The meaning of referential human pointing for dogs (Canis familiaris).

    Science.gov (United States)

    Tauzin, Tibor; Csík, Andor; Kis, Anna; Topál, József

    2015-11-01

    Dogs have a unique capacity to follow human pointing, and thus it is often assumed that they can comprehend the referential meaning of such signals. However, it is still unclear whether dogs perceive human directional gestures as signals referring to a target object (indicating what to manipulate) or a spatial cue (indicating where to do something). In the present study, we investigated which of these alternative interpretations may explain dogs' responses to human pointing gestures in ostensive communicative and nonostensive cuing contexts. To test whether dogs select the cued object or the cued location, subjects were presented with 2 alternative object-choice trials. An experimenter first attracted the attention of the dog either by calling the dog's name and looking at it (ostensive condition, n = 24) or by clapping the hands (nonostensive condition, n = 24) then pointed at 1 of 2 different toy objects. Subsequently, the experimenter switched the location of the 2 target objects in full view of the dogs by grasping the objects and making a 180° turn. Dogs were then allowed to choose between the 2 objects. In the ostensive condition, dogs showed a significant bias toward the cued location compared with the nonostensive condition in which they performed at chance. These results suggest that pointing refers to a direction or location for dogs, but only if they are addressed with ostensive cues that indicate the communicative intention of the signaler.

  14. Live Births from Domestic Dog (Canis familiaris Embryos Produced by In Vitro Fertilization.

    Directory of Open Access Journals (Sweden)

    Jennifer B Nagashima

    Full Text Available Development of assisted reproductive technologies (ART in the dog has resisted progress for decades, due to their unique reproductive physiology. This lack of progress is remarkable given the critical role ART could play in conserving endangered canid species or eradicating heritable disease through gene-editing technologies-an approach that would also advance the dog as a biomedical model. Over 350 heritable disorders/traits in dogs are homologous with human conditions, almost twice the number of any other species. Here we report the first live births from in vitro fertilized embryos in the dog. Adding to the practical significance, these embryos had also been cryopreserved. Changes in handling of both gametes enabled this progress. The medium previously used to capacitate sperm excluded magnesium because it delayed spontaneous acrosome exocytosis. We found that magnesium significantly enhanced sperm hyperactivation and ability to undergo physiologically-induced acrosome exocytosis, two functions essential to fertilize an egg. Unlike other mammals, dogs ovulate a primary oocyte, which reaches metaphase II on Days 4-5 after the luteinizing hormone (LH surge. We found that only on Day 6 are oocytes consistently able to be fertilized. In vitro fertilization of Day 6 oocytes with sperm capacitated in medium supplemented with magnesium resulted in high rates of embryo development (78.8%, n = 146. Intra-oviductal transfer of nineteen cryopreserved, in vitro fertilization (IVF-derived embryos resulted in seven live, healthy puppies. Development of IVF enables modern genetic approaches to be applied more efficiently in dogs, and for gamete rescue to conserve endangered canid species.

  15. The interrelated effect of sleep and learning in dogs (Canis familiaris); an EEG and behavioural study

    Science.gov (United States)

    Kis, Anna; Szakadát, Sára; Gácsi, Márta; Kovács, Enikő; Simor, Péter; Török, Csenge; Gombos, Ferenc; Bódizs, Róbert; Topál, József

    2017-01-01

    The active role of sleep in memory consolidation is still debated, and due to a large between-species variation, the investigation of a wide range of different animal species (besides humans and laboratory rodents) is necessary. The present study applied a fully non-invasive methodology to study sleep and memory in domestic dogs, a species proven to be a good model of human awake behaviours. Polysomnography recordings performed following a command learning task provide evidence that learning has an effect on dogs’ sleep EEG spectrum. Furthermore, spectral features of the EEG were related to post-sleep performance improvement. Testing an additional group of dogs in the command learning task revealed that sleep or awake activity during the retention interval has both short- and long-term effects. This is the first evidence to show that dogs’ human-analogue social learning skills might be related to sleep-dependent memory consolidation. PMID:28165489

  16. Comparative functional anatomy of the epaxial musculature of dogs (Canis familiaris) bred for sprinting vs. fighting.

    Science.gov (United States)

    Webster, Emma L; Hudson, Penny E; Channon, Sarah B

    2014-09-01

    The axial musculoskeletal system of quadrupedal mammals is not currently well understood despite its functional importance in terms of facilitating postural stability and locomotion. Here we examined the detailed architecture of the muscles of the vertebral column of two breeds of dog, the Staffordshire bull terrier (SBT) and the racing greyhound, which have been selectively bred for physical combat and high speed sprint performance, respectively. Dissections of the epaxial musculature of nine racing greyhounds and six SBTs were carried out; muscle mass, length, and fascicle lengths were measured and used to calculate muscle physiological cross-sectional area (PCSA), and to estimate maximum muscle potential for force, work and power production. The longissimus dorsi muscle was found to have a high propensity for force production in both breeds of dog; however, when considered in combination with the iliocostalis lumborum muscle it showed enhanced potential for production of power and facilitating spinal extension during galloping gaits. This was particularly the case in the greyhound, where the m. longissimus dorsi and the m. iliocostalis lumborum were estimated to have the potential to augment hindlimb muscle power by ca. 12%. Breed differences were found within various other muscles of the axial musculoskeletal system, particularly in the cranial cervical muscles and also the deep muscles of the thorax which insert on the ribs. These may also highlight key functional adaptations between the two breeds of dog, which have been selectively bred for particular purposes. Additionally, in both breeds of dog, we illustrate specialisation of muscle function by spinal region, with differences in both mass and PCSA found between muscles at varying levels of the axial musculoskeletal system, and between muscle functional groups.

  17. The Effect of Pet Remedy on the Behaviour of the Domestic Dog (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Sienna Taylor

    2016-10-01

    Full Text Available Stress-affected behaviour in companion animals can have an adverse effect on animal health and welfare and their relationships with humans. This stress can be addressed using chemical treatments, often in conjunction with behavioural therapies. Here, we investigated the efficacy of one commercial pharmacological intervention, Pet Remedy, advertised as a natural stress relief product for mammals. We aimed to see whether the product lowered stress-affected behaviour in dogs placed in a non-familiar environment. Behavioural responses of 28 dogs were video recorded using a double-blind, placebo-controlled, and counterbalanced repeated measures design. Dogs were exposed to both a placebo and Pet Remedy plug-in diffuser for 30 min with an intervening period of approximately 7 days between conditions. Multivariate regression analysis identified no significant differences in behaviour in either the Pet Remedy or placebo condition. In conclusion, in the current study, Pet Remedy did not reduce behavioural indicators indicative of a stress response. To determine the effects of Pet Remedy, future research using a larger sample size and controlling for breed would be beneficial.

  18. Change of Diurnal Heart Rate Patterns During Pregnancy and Lactation in Dogs (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Häggström J

    2003-09-01

    Full Text Available Pregnancy and lactation involve great demands on the cardiovascular system. The purpose of this study was to investigate how the heart rate and diurnal heart rate pattern change when dogs become pregnant or lactate. Five clinically healthy female beagle dogs were mated, and delivered three to seven healthy puppies. The heart rate was investigated with 24-h ECG (Holter once during anoestrus, at 3, 5, 7 and 9 weeks of pregnancy, and at week 4 postpartum (lactation. However, at 9 weeks, the ECG could not be recorded for the fully 24 h in 4 of 5 dogs, because labour started and the dogs then appeared disturbed by the recordings. The results at this date are not included in the statistical comparison. The heart rate increased progressively during pregnancy and was still elevated at 4 weeks of lactation. During late pregnancy the difference in heart rates between daytime and nighttime became smaller, but the heart rate was significantly higher in daytime in all periods. In conclusion, the increased heart rates during pregnancy and lactation reflect increased demands on the cardiovascular system and may be important to consider in clinical practice.

  19. Influence of owners' attachment style and personality on their dogs' (Canis familiaris separation-related disorder.

    Directory of Open Access Journals (Sweden)

    Veronika Konok

    Full Text Available Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD, Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  20. Influence of Owners' Attachment Style and Personality on Their Dogs' (Canis familiaris) Separation-Related Disorder

    OpenAIRE

    Veronika Konok; András Kosztolányi; Wohlfarth Rainer; Bettina Mutschler; Ulrike Halsband; Ádám Miklósi

    2015-01-01

    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence ...

  1. Influence of owners' attachment style and personality on their dogs' (Canis familiaris) separation-related disorder.

    Science.gov (United States)

    Konok, Veronika; Kosztolányi, András; Rainer, Wohlfarth; Mutschler, Bettina; Halsband, Ulrike; Miklósi, Ádám

    2015-01-01

    Previous research has suggested that owners' attitude to their family dogs may contribute to a variety of behaviour problems in the dog, and authors assume that dogs with separation-related disorder (SRD) attach differently to the owner than typical dogs do. Our previous research suggested that these dogs may have an insecure attachment style. In the present study we have investigated whether owners' attachment style, personality traits and the personality of the dog influence the occurrence of SRD in the dog. In an internet-based survey 1508 (1185 German and 323 Hungarian) dog-owners filled in five questionnaires: Demographic questions, Separation Behaviour Questionnaire (to determine SRD), Human and Dog Big Five Inventory and Adult Attachment Scale. We found that with owners' higher score on attachment avoidance the occurrence of SRD in the dog increases. Dogs scoring higher on the neuroticism scale were more prone to develop SRD. Our results suggest that owners' attachment avoidance may facilitate the development of SRD in dogs. We assume that avoidant owners are less responsive to the dog's needs and do not provide a secure base for the dog when needed. As a result dogs form an insecure attachment and may develop SRD. However, there may be alternative explanations of our findings that we also discuss.

  2. Discrimination of human and dog faces and inversion responses in domestic dogs (Canis familiaris).

    Science.gov (United States)

    Racca, Anaïs; Amadei, Eleonora; Ligout, Séverine; Guo, Kun; Meints, Kerstin; Mills, Daniel

    2010-05-01

    Although domestic dogs can respond to many facial cues displayed by other dogs and humans, it remains unclear whether they can differentiate individual dogs or humans based on facial cues alone and, if so, whether they would demonstrate the face inversion effect, a behavioural hallmark commonly used in primates to differentiate face processing from object processing. In this study, we first established the applicability of the visual paired comparison (VPC or preferential looking) procedure for dogs using a simple object discrimination task with 2D pictures. The animals demonstrated a clear looking preference for novel objects when simultaneously presented with prior-exposed familiar objects. We then adopted this VPC procedure to assess their face discrimination and inversion responses. Dogs showed a deviation from random behaviour, indicating discrimination capability when inspecting upright dog faces, human faces and object images; but the pattern of viewing preference was dependent upon image category. They directed longer viewing time at novel (vs. familiar) human faces and objects, but not at dog faces, instead, a longer viewing time at familiar (vs. novel) dog faces was observed. No significant looking preference was detected for inverted images regardless of image category. Our results indicate that domestic dogs can use facial cues alone to differentiate individual dogs and humans and that they exhibit a non-specific inversion response. In addition, the discrimination response by dogs of human and dog faces appears to differ with the type of face involved.

  3. Dogs (Canis familiaris) adjust their social behaviour to the differential role of inanimate interactive agents.

    Science.gov (United States)

    Petró, Eszter; Abdai, Judit; Gergely, Anna; Topál, József; Miklósi, Ádám

    2016-03-01

    Dogs are able to flexibly adjust their social behaviour to situation-specific characteristics of their human partner's behaviour in problem situations. However, dogs do not necessarily detect the specific role played by the human in a particular situation: they may form expectations about their partners' behaviour based on previous experiences with them. Utilising inanimate objects (UMO-unidentified moving object) as interacting agents offers new possibilities for investigating social behaviour, because in this way we can remove or control the influence of previous experience with the partner. The aim of the present study was to investigate whether dogs are able to recognise the different roles of two UMOs and are able to adjust their communicative behaviour towards them. In the learning phase of the experiment, dogs were presented with a two-way food-retrieval problem in which two UMOs, which differed in their physical appearance and abilities, helped the dog obtain a piece of food in their own particular manner. After a short experience with both UMOs, dogs in the test phase faced one of the problems in the presence of both inanimate agents. Overall, dogs displayed similar levels of gazing behaviour towards the UMOs, but in the first test they looked, approached and touched the relevant partner first. This rapid adjustment of social behaviour towards UMOs suggests that dogs may generalise their experiences with humans to unfamiliar agents and are able to select the appropriate partner when facing a problem situation.

  4. Concomitant administration of GonaCon™ and rabies vaccine in female dogs (Canis familiaris) in Mexico.

    Science.gov (United States)

    Vargas-Pino, Fernando; Gutiérrez-Cedillo, Verónica; Canales-Vargas, Erick J; Gress-Ortega, Luis R; Miller, Lowell A; Rupprecht, Charles E; Bender, Scott C; García-Reyna, Patricia; Ocampo-López, Juan; Slate, Dennis

    2013-09-13

    Mexico serves as a global model for advances in rabies prevention and control in dogs. The Mexican Ministry of Health (MMH) annual application of approximately 16 million doses of parenteral rabies vaccine has resulted in significant reductions in canine rabies during the past 20 years. One collateral parameter of rabies programs is dog population management. Enhanced public awareness is critical to reinforce responsible pet ownership. Surgical spaying and neutering remain important to prevent reproduction, but are impractical for achieving dog population management goals. GonaCon™, an anti-gonadotropin releasing hormone (GnRH) vaccine, was initially tested in captive female dogs on the Navajo Nation, 2008. The MMH led this international collaborative study on an improved formulation of GonaCon™ in captive dogs with local representatives in Hidalgo, Mexico in 2011. This study contained 20 bitches assigned to Group A (6 control), Group B (7 GonaCon™), and Group C (7 GonaCon™ and rabies vaccine). Vaccines were delivered IM. Animals were placed under observation and evaluated during the 61-day trial. Clinically, all dogs behaved normally. No limping or prostration was observed, in spite of minor muscle atrophy post-mortem in the left hind leg of dogs that received GonaCon™. Two dogs that began the study pregnant give birth to healthy pups. Dogs that received a GonaCon™ injection had macro and microscopic lesions consistent with prior findings, but the adverse injection effects were less frequent and lower in intensity. Both vaccines were immunogenic based on significant increases in rabies virus neutralizing antibodies and anti-GnRH antibodies in treatment Groups B and C. Simultaneous administration of GonaCon™ and rabies vaccine in Group C did not affect immunogenicity. Progesterone was suppressed significantly in comparison to controls. Future studies that monitor fertility through multiple breeding cycles represent a research need to determine the value of integrating this vaccine into dog rabies management.

  5. ENTEROPARÁSITOS EN PERROS (Canis familiaris) Y GATOS (Felis catus) DE LA PROVINCIA DE PUNO

    OpenAIRE

    VILCA DE DIAZ, FELICIANA; Universidad Nacional del Altiplano; MELO ANCCASI, MAXIMO; Universidad Nacional del Altiplano

    2013-01-01

    ResumenLas mascotas que conviven con el hombre, el  perro y el gato ocupan un lugar muy especial, como amigos fieles, especialmente de los niños; sin embargo esta relación se interrumpe por la presencia de parásitos ciclozoonóticos, ocasionando múltiples enfermedades, incluso en algunos casos podrían ocasionar  la muerte, con repercusiones socioeconómicas de impacto. Por ello la necesidad de realizar esta investigación para determinar la prevalencia de entero parásitos  en estas especies, eva...

  6. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    LUIS E. PATERNINA

    2009-01-01

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfoló- gicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se reco- lectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fue- ron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

  7. Cross modal perception of body size in domestic dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna M Taylor

    Full Text Available While the perception of size-related acoustic variation in animal vocalisations is well documented, little attention has been given to how this information might be integrated with corresponding visual information. Using a cross-modal design, we tested the ability of domestic dogs to match growls resynthesized to be typical of either a large or a small dog to size-matched models. Subjects looked at the size-matched model significantly more often and for a significantly longer duration than at the incorrect model, showing that they have the ability to relate information about body size from the acoustic domain to the appropriate visual category. Our study suggests that the perceptual and cognitive mechanisms at the basis of size assessment in mammals have a multisensory nature, and calls for further investigations of the multimodal processing of size information across animal species.

  8. Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris)

    OpenAIRE

    Héctor Rubén Ávila Adarme; Luis Rafael Neira Rairán

    2016-01-01

    La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores rep...

  9. Effect of reinforcement, reinforcer omission and extinction on a communicative response in domestic dogs (Canis familiaris).

    Science.gov (United States)

    Bentosela, Mariana; Barrera, Gabriela; Jakovcevic, Adriana; Elgier, Angel M; Mustaca, Alba E

    2008-07-01

    There is a controversy about the mechanisms involved in the interspecific communicative behaviour in domestic dogs. The main question is whether this behaviour is a result of instrumental learning or higher cognitive skills are required. The present investigations were undertaken to study the effect of learning processes upon the gaze towards the human's face as a communicative response. To such purpose, in Study 1, gaze response was subjected to three types of reinforcement schedules: differential reinforcement, reinforcer omission, and extinction in a situation of "asking for food". Results showed a significant increase in gaze duration in the differential reinforcement phase and a significant decrease in both the omission and extinction phases. These changes were quite rapid, since they occurred only after three training trials in each phase. Furthermore, extinction resulted in animal behaviour changes, such as an increase in the distance from the experimenter, the back position and lying behaviour. This is the first systematic evaluation of the behavioural changes caused by reward withdrawal (frustration) in dogs. In Study 2, the gaze response was studied in a situation where dogs walked along with their owners/trainers. These results show that learning plays an important role in this communicative response. The possible implications of these results for service dogs are discussed.

  10. RASGOS DEL TEMPERAMENTO DE LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2009-08-01

    Full Text Available

    Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato fisiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos fisiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  11. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave: garrapatas, perros, Ornithodoros puertoricensis, Ixodida, Colombia.


    ABSTRACT

    Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

    Key words: Ticks, dogs, Ornithodoros puertoricensis, Ixodida, Colombia

  12. What counts for dogs (Canis lupus familiaris) in a quantity discrimination task?

    Science.gov (United States)

    Miletto Petrazzini, Maria Elena; Wynne, Clive D L

    2016-01-01

    Numerous studies have reported that animals reliably discriminate quantities of more or less food. However, little attention has been given to the relative salience of numerosity compared to the total amount of food when animals are making their choices. Here we investigated this issue in dogs. Dogs were given choices between two quantities of food items in three different conditions. In the Congruent condition, the total amount of food co-varied with the number of food items; in the Incongruent condition the total amount was pitted against the numerosity; and in the Controlled condition the total amount between the sets was equal. Results show that dogs based their choice on the total amount of edible food rather than on the number of food items, suggesting that, in food choice tasks, amount counts more than number. The presence of the largest individual item in a set did not bias dogs' choices. A control test excluded the possibility that dogs based their choices on olfactory cues alone.

  13. Identification of behaviour in freely moving dogs (Canis familiaris using inertial sensors.

    Directory of Open Access Journals (Sweden)

    Linda Gerencsér

    Full Text Available Monitoring and describing the physical movements and body postures of animals is one of the most fundamental tasks of ethology. The more precise the observations are the more sophisticated the interpretations can be about the biology of a certain individual or species. Animal-borne data loggers have recently contributed much to the collection of motion-data from individuals, however, the problem of translating these measurements to distinct behavioural categories to create an ethogram is not overcome yet. The objective of the present study was to develop a "behaviour tracker": a system composed of a multiple sensor data-logger device (with a tri-axial accelerometer and a tri-axial gyroscope and a supervised learning algorithm as means of automated identification of the behaviour of freely moving dogs. We collected parallel sensor measurements and video recordings of each of our subjects (Belgian Malinois, N=12; Labrador Retrievers, N=12 that were guided through a predetermined series of standard activities. Seven behavioural categories (lay, sit, stand, walk, trot, gallop, canter were pre-defined and each video recording was tagged accordingly. Evaluation of the measurements was performed by support vector machine (SVM classification. During the analysis we used different combinations of independent measurements for training and validation (belonging to the same or different individuals or using different training data size to determine the robustness of the application. We reached an overall accuracy of above 90% perfect identification of all the defined seven categories of behaviour when both training and validation data belonged to the same individual, and over 80% perfect recognition rate using a generalized training data set of multiple subjects. Our results indicate that the present method provides a good model for an easily applicable, fast, automatic behaviour classification system that can be trained with arbitrary motion patterns and potentially be applied to a wide range of species and situations.

  14. Identification of behaviour in freely moving dogs (Canis familiaris) using inertial sensors.

    Science.gov (United States)

    Gerencsér, Linda; Vásárhelyi, Gábor; Nagy, Máté; Vicsek, Tamas; Miklósi, Adam

    2013-01-01

    Monitoring and describing the physical movements and body postures of animals is one of the most fundamental tasks of ethology. The more precise the observations are the more sophisticated the interpretations can be about the biology of a certain individual or species. Animal-borne data loggers have recently contributed much to the collection of motion-data from individuals, however, the problem of translating these measurements to distinct behavioural categories to create an ethogram is not overcome yet. The objective of the present study was to develop a "behaviour tracker": a system composed of a multiple sensor data-logger device (with a tri-axial accelerometer and a tri-axial gyroscope) and a supervised learning algorithm as means of automated identification of the behaviour of freely moving dogs. We collected parallel sensor measurements and video recordings of each of our subjects (Belgian Malinois, N=12; Labrador Retrievers, N=12) that were guided through a predetermined series of standard activities. Seven behavioural categories (lay, sit, stand, walk, trot, gallop, canter) were pre-defined and each video recording was tagged accordingly. Evaluation of the measurements was performed by support vector machine (SVM) classification. During the analysis we used different combinations of independent measurements for training and validation (belonging to the same or different individuals or using different training data size) to determine the robustness of the application. We reached an overall accuracy of above 90% perfect identification of all the defined seven categories of behaviour when both training and validation data belonged to the same individual, and over 80% perfect recognition rate using a generalized training data set of multiple subjects. Our results indicate that the present method provides a good model for an easily applicable, fast, automatic behaviour classification system that can be trained with arbitrary motion patterns and potentially be applied to a wide range of species and situations.

  15. Algorithm-supported visual error correction (AVEC) of heart rate measurements in dogs, Canis lupus familiaris.

    Science.gov (United States)

    Schöberl, Iris; Kortekaas, Kim; Schöberl, Franz F; Kotrschal, Kurt

    2015-12-01

    Dog heart rate (HR) is characterized by a respiratory sinus arrhythmia, and therefore makes an automatic algorithm for error correction of HR measurements hard to apply. Here, we present a new method of error correction for HR data collected with the Polar system, including (1) visual inspection of the data, (2) a standardized way to decide with the aid of an algorithm whether or not a value is an outlier (i.e., "error"), and (3) the subsequent removal of this error from the data set. We applied our new error correction method to the HR data of 24 dogs and compared the uncorrected and corrected data, as well as the algorithm-supported visual error correction (AVEC) with the Polar error correction. The results showed that fewer values were identified as errors after AVEC than after the Polar error correction (p error correction is more suitable for dog HR and HR variability than is the customized Polar error correction, especially because AVEC decreases the likelihood of Type I errors, preserves the natural variability in HR, and does not lead to a time shift in the data.

  16. Conservation of the Sapsaree (Canis familiaris), a Korean Natural Monument, using somatic cell nuclear transfer.

    Science.gov (United States)

    Jang, Goo; Hong, SoGun; Kang, JungTaek; Park, JungEun; Oh, HyunJu; Park, ChanKyu; Ha, JiHong; Kim, DaeYong; Kim, MinKyu; Lee, ByeongChun

    2009-09-01

    A recent emerging technology, somatic cell nuclear transfer (SCNT), has been considered for conserving threatened or endangered species. Sapsaree is a native breed in Korea and has been designated as a Natural Monument. The aim of this study was to produce a Sapsaree by SCNT for breed conservation. Donor fibroblasts from a 9-year-old male Sapsaree were placed into the perivitelline spaces of enucleated in vivo matured oocytes and fused electrically. A total of 309 cloned embryos were transferred into the oviducts of 15 naturally synchronized recipients. Two recipients were diagnosed as pregnant, and each delivered one cloned puppy, both of which weighed 530 g. Overall, this study demonstrated that an endangered canine breed can be conserved by SCNT.

  17. Experimental infection of dogs (Canis familiaris) with sporulated oocysts of Neospora caninum.

    Science.gov (United States)

    Bandini, Luciana A; Neto, Aldo F A; Pena, Hilda F J; Cavalcante, Guacyara T; Schares, Gereon; Nishi, Sandra M; Gennari, Solange M

    2011-03-10

    Neospora caninum is widely distributed in the world and this parasite is one of the major causes of abortion in cattle. Dogs and coyotes are definitive hosts of N. caninum and several species of domestic and wild animals are intermediate hosts. Dogs can become infected by the ingestion of tissues containing cysts and then excrete oocysts. It is not yet known whether sporulated oocysts are able to induce a patent infection in dogs, i.e. a shedding of N. caninum oocysts in feces. The objective of this study was to experimentally examine the infection of dogs by sporulated oocysts. The oocysts used in the experiment were obtained by feeding dogs with brain of buffaloes (Bubalus bubalis) positive for anti-N. caninum antibodies by indirect fluorescent antibody test (IFAT ≥200). Oocysts shed by these dogs were confirmed to be N. caninum by molecular methods and by bioassay in gerbils, and sporulated N. caninum oocysts were used for the oral infection of four dogs. The dogs were 8 weeks old and negative for antibodies to N. caninum and Toxoplasma gondii. Dogs 1 and 4 received an inoculum of 10,000 sporulated oocysts each; dog 2 an inoculum of 5000 sporulated oocysts and dog 3 received 1000 sporulated oocysts of N. caninum. The total feces excreted by these dogs were collected and examined daily for a period of 30 days. No oocysts were found in their feces. The dogs were monitored monthly for a 6-month period to observe a possible seroconversion and when this occurred the animals were eliminated from the experiment. Dogs 1 and 4 seroconverted 1 month after the infection with titer, in the IFAT, of 1600 and 800, respectively; the other two dogs presented no seroconvertion during the 6-month period. Dogs 1 and 2 were euthanized 180 days after infection and were examined for the detection of N. caninum in tissues (brain, muscle, lymph node, liver, lung, heart and bone marrow) by immunohistochemistry and PCR with negative results in both techniques. Bioassay in gerbils with brain of these dogs was also performed and again the results were negative. In conclusion, dogs infected with sporulated oocysts of N. caninum were not able to shed oocysts in feces. However, a higher dose of infection stimulated the production of antibodies against N. caninum in the dogs.

  18. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris).

    Science.gov (United States)

    Kis, Anna; Bence, Melinda; Lakatos, Gabriella; Pergel, Enikő; Turcsán, Borbála; Pluijmakers, Jolanda; Vas, Judit; Elek, Zsuzsanna; Brúder, Ildikó; Földi, Levente; Sasvári-Székely, Mária; Miklósi, Adám; Rónai, Zsolt; Kubinyi, Enikő

    2014-01-01

    The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG) and one known (rs8679684) single nucleotide polymorphisms (SNPs) in the regulatory regions (5' and 3' UTR) of the oxytocin receptor gene in German Shepherd (N = 104) and Border Collie (N = 103) dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  19. Rasgos del temperamento de los perros domésticos (Canis familiaris: evaluaciones conductuales

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2009-01-01

    Full Text Available Los rasgos del temperamento se definen como tendencias conductuales estables entre situaciones similares y a lo largo del tiempo. En el presente trabajo se revisan las pruebas conductuales diseñadas para la evaluación de rasgos aislados del temperamento en los perros domésticos. Para cada dimensión se describen los estímulos empleados, las respuestas evaluadas y el correlato psiológico de las mismas. Los rasgos más estudiados fueron la temerosidad, la agresividad y la sociabilidad. Sin embargo, sólo la primera cuenta con correlatos psiológicos bien establecidos. Finalmente, las evaluaciones conductuales resultan de suma importancia para la selección de los perros para las distintas funciones que cumplen en la sociedad humana: detección de drogas, compañía, guardia, rescate de personas, etc.

  20. Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris.

    Directory of Open Access Journals (Sweden)

    Anna Kis

    Full Text Available The oxytocin system has a crucial role in human sociality; several results prove that polymorphisms of the oxytocin receptor gene are related to complex social behaviors in humans. Dogs' parallel evolution with humans and their adaptation to the human environment has made them a useful species to model human social interactions. Previous research indicates that dogs are eligible models for behavioral genetic research, as well. Based on these previous findings, our research investigated associations between human directed social behaviors and two newly described (-212AG, 19131AG and one known (rs8679684 single nucleotide polymorphisms (SNPs in the regulatory regions (5' and 3' UTR of the oxytocin receptor gene in German Shepherd (N = 104 and Border Collie (N = 103 dogs. Dogs' behavior traits have been estimated in a newly developed test series consisting of five episodes: Greeting by a stranger, Separation from the owner, Problem solving, Threatening approach, Hiding of the owner. Buccal samples were collected and DNA was isolated using standard protocols. SNPs in the 3' and 5' UTR regions were analyzed by polymerase chain reaction based techniques followed by subsequent electrophoresis analysis. The gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i proximity seeking towards an unfamiliar person, as well as their owner, and on (ii how friendly dogs behave towards strangers, although the mediating molecular regulatory mechanisms are yet unknown. Based on these results, we conclude that similarly to humans, the social behavior of dogs towards humans is influenced by the oxytocin system.

  1. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae from Panama

    Directory of Open Access Journals (Sweden)

    Roberto Miranda C

    2011-04-01

    Full Text Available Objetive. To determine the distribution of ectoparasites in dogs in Panama. Materials and methods. There were surveyed 720 canines belonging to 57 communities. Results. The results showed that 84% of the dogs were infested with at least one species of ectoparasite. Dogs from lowlands showed a higher percentage of parasitism and a greater biodiversity of parasites than dogs from highlands. There were found seven species of ticks, four species of fleas, two species of lice, and one specie of botfly. The ticks Rhipicephalus sanguineus, Amblyomma cajennense, A. ovale and the flea Ctenocephalides felis were widespread; however Ixodes boliviensis and Pulex simulans showed a much narrower geographic distribution and they were found only in dogs from highlands. The flea species Rhopalopsyllus cacicus and the tick Haemaphysalis juxtakochi were found for the first time in panamanian dogs. Conclusions. The environmental situation in Panama, can encourage that wildlife ectoparasites parasitized dogs in absence of their native hosts. This condition may increase transmission risk of some diseases where the ticks and fleas are vectors.

  2. Influence of different artificial lighting regimes on intraocular pressure circadian profile in the dog (Canis familiaris).

    Science.gov (United States)

    Piccione, Giuseppe; Giannetto, Claudia; Fazio, Francesco; Giudice, Elisabetta

    2010-01-01

    The present study was undertaken to determine the temporal variation in intraocular pressure (IOP) and if this variation is under circadian clock control. The authors exposed five female and five male Beagles to four different artificial lighting regimes: 12/12 light/dark (L/D) period, 12/12 D/L period, constant light, and constant darkness. IOP was measured at 3 h intervals over a 48-h period. Statistical analysis of the data was performed by multivariate ANOVA, one-way repeated measure ANOVA and by the single cosinor method. Results showed no statistical effect of gender, eye and photoperiod on IOP values. A significant effect of time for each gender and each eye during all lighting regimes was seen, except during constant light, and also robust daily rhythmicity of IOP values in all L/D periods, except during constant light. In conclusion IOP values in the dog show a circadian rhythm and this rhythm is driven by a central pacemaker.

  3. AVALIAÇÕES CITOLÓGICAS EM OTITES CANINAS POR MALASSEZIA SPP.: ESTUDO RETROSPECTIVO

    Directory of Open Access Journals (Sweden)

    Alessandra Melchert

    2011-12-01

    Full Text Available Otitis externa is a condition frequently observed in dogs at the small animal clinics. Malassezia spp. is the most frequently isolated microorganism in the ears of dogs, which is one of the major etiologic agents of ear infections. Identification of this agent may be based on fungal culture or cytology, and the first method is longer and more expensive. The aim of this study was to conduct a retrospective study of the incidence of Malassezia spp. in cases of canine otitis by cytology, in a period of five years. Ear cytology samples from 249 dogs with suspected otitis were evaluated, and were observed positive samples for Malassezia spp. in 44 cases (17.67%, among these 35 dogs (79.5% with positive cytology in both ears, and 9 dogs (20.5% were positive for Malassezia in only one ear. In conclusion, dogs with suspected otitis present high incidence of positive Malassezia spp. cytology counts. Cytology revealed to be a useful tool for diagnosis of canine ear infections involving this pathogen, representing diagnostic alternative in cases where the culture is not feasible. However, one must consider that there is no national standard cytological counting yeast cells/field set for cases of canine otitis, which may represent possible misdiagnosis.

  4. Sobrepoblación canina y felina: tendencias y nuevas perspectivas

    OpenAIRE

    C. A. Salamanca; Polo, L. J.; Vargas, J

    2012-01-01

    A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, se consultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink y Medline, para la búsqueda de la información. Como palabras clave se utilizaron: perros de libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblación y control de población. Además se consultó el banco de publicaciones de la Sociedad Mundial para la Protección Animal (WSPA) y la Organización Internaci...

  5. Tratamento da papilomatose canina com Propionibacterium acnes Treatment of canine papillomatosis using Propionibacterium acnes

    Directory of Open Access Journals (Sweden)

    J. Megid

    2001-10-01

    Full Text Available Propionibacterium acnes as immunostimulant in oral canine papillomatosis treatment in 16 animals was studied. Regression of the pappiloma started being observed after the second aplication, with complete resolution in all dogs after the sixth aplication. These results suggest the use of P. acnes as an alternative in oral canine papillomatosis therapy.

  6. Estudo comparativo entre citopatologia e histopatologia no diagnóstico de neoplasias caninas

    Directory of Open Access Journals (Sweden)

    Magalhães Adelaide M.

    2001-01-01

    Full Text Available Foi realizado um estudo comparativo entre os diagnósticos citológico e histopatológico em diversas neoplasias de 150 cães, pelas colorações de Wright, May-Grünwald-Giemsa, Novo Azul de Metileno e Papanicolau. Colorações histológicas como Hematoxilina-Eosina, van Gieson, Sudan, Azul de Toluidina e Ácido Periódico de Schiff também foram empregadas. Os dados revelaram uma eficácia de ordem de 85,3% no diagnóstico citopatológico, considerando-se os resultados histopatológicos como corretos. Em 4,0% dos casos somente a origem embrionária das neoplasias foi estabelecida. Em 1,3% das neoplasias apenas o prognóstico foi determinado; o diagnóstico citológico diferiu da histopatologia em 8,1% dos casos. Em dois casos (1,3% o diagnóstico citológico diferiu do histológico, mas um reexame determinou que o primeiro estava correto, o que elevou a sua eficácia para 86,6%. Entre as técnicas utilizadas, a punção aspirativa por agulha fina foi o melhor método para obter amostras. A citologia não foi adequada para o diagnóstico de neoplasias mamárias, dadas às variações morfológicas em diferentes áreas. A impressão em lâmina não é recomendada para análise de tumores mesenquimais e deve ser substituída pela citologia esfoliativa. O Wright revelou-se o método de coloração mais eficiente. As colorações adaptadas da histopatologia, van Gieson em leiomiomas e leiomiossarcomas, Sudan em lipomas e lipossarcomas, e Ácido Periódico de Schiff e Azul de Toluidina em mastocitomas, foram empregadas com sucesso fornecendo assim maior clareza de detalhes para as diversas neoformações de origem epitelial e mesenquimal.

  7. Detecção de glicoconjugados de lecitinas em neoplasias mamárias caninas

    OpenAIRE

    Bezerril, Juliana Evangelista

    2013-01-01

    Os tumores mamários representam aproximadamente 52%, de todas as neoplasias observadas em cadelas. Lecitinas são proteínas naturais de origem não imune, que se ligam a carboidratos. Por existir um grande número de lecitinas com capacidade de ligação com diferentes carboidratos, esta versátil molécula tem sido utilizada em diversos segmentos da pesquisa biológica. O presente trabalho tem por objetivo investigar, em tecido mamário canino, receptores das lecitinas UEA - Ulex europaeus (carqueja)...

  8. Poliartritis asociada a hepatozoonosis canina: descripción de un caso

    OpenAIRE

    Iveli, Sebastián; Casas, Luciano; Machuca, Mariana; Eiras, Diego Fernando; del Amo, Alicia

    2015-01-01

    El objetivo de este trabajo fue describir un caso de poliartritis asociada a Hepatozoon canis en un canino, mestizo, macho, de 5 meses de edad. El paciente presentaba fiebre (40,1 ºC), mucosas pálidas, linfonódulos superficiales ligeramente aumentados de tamaño, dolor lumbar, aumento de tamaño de varias articulaciones y abundantes garrapatas (Rhipicephalus sanguineous). En los extendidos sanguíneos se constató la presencia de gamontes de Hepatozoon sp. en el citoplasma de los neutrófilos. El ...

  9. Sobrepoblación canina y felina: tendencias y nuevas perspectivas

    Directory of Open Access Journals (Sweden)

    C. A. Salamanca

    2011-01-01

    Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, se consultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink y Medline, para la búsqueda de la información. Como palabras clave se utilizaron: perros de libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblación y control de población. Además se consultó el banco de publicaciones de la Sociedad Mundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias (OIE. El objetivo de esta revisión fue presentar una posición crítica sobre la problemática de la sobrepoblación de mascotas, su percepción cultural y la relación hombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posibles soluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséis referencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos que cumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión. A medida que aumente nuestro conocimiento acerca de la tenencia responsable de las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de la educación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos con respecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental que ejerce el médico veterinario en la comunidad.

  10. ABORDAGEM ATUAL DA INSUFICIÊNCIA RENAL CRÔNICA CANINA

    Directory of Open Access Journals (Sweden)

    BRUM, Alexandre Martini de

    2009-05-01

    Full Text Available Nucleus Animalium, v.1, n.1, maio 2009The chronic renal failure is a consequence of a lack of renal diseases, that culminates in loss ofthe kidney excretory and concentrator functions. It’s considered the main renal dog affection and it’s marked for itsprogression, in such a way that independently of the cause, leads to the gradual and irreversible destruction of thenefrons. Much discussion is made on therapies for delaying the disease advance, although the survival of animalswith renal failure does not depend on only the choice of the ideal therapeutics but on the conscious of their ownersand veterinarians in relation to the importance of the early diagnostic, identification of the original renal disease,the nutrition of this patient and clinic – laboratory aspects in its several phases. This article proposes to reviewthe main changes caused by chronic renal failure, marking the principal points on physiopathology, diagnosticmethods, therapeutic and clinic management of the chronic renal patient, in order to retard the disease progression and providing best life quality.A insuficiência renal crônica (IRC é a consequência de uma gama de doenças renais, culminado naperda das funções excretora e concentradora dos rins. Considerada a principal afecção renal dos cães, destaca-sepor sua progressão, e que independentemente da causa, leva à destruição lenta e irreversível dos néfrons. Muito sediscute sobre terapias que retardem o avanço do quadro, porém a sobrevida dos animais insuficientes renais nãodepende somente da escolha da terapêutica medicamentosa ideal, mas da conscientização de proprietários e médicosveterinários em relação à importância do diagnóstico precoce, da identificação da doença renal desencadeadorado processo, da nutrição deste paciente e das manifestações clínico–laboratoriais apresentadas em suas diversasfases. Propõe-se com este artigo revisar as principais alterações decorrentes da IRC, enfocando pontos chaves dafisiopatologia, meios diagnósticos, terapêutica e manejo clínico do paciente renal crônico, visando ao retardamento da progressão da doença e propiciando maior qualidade de vida ao paciente.

  11. Parásitos zoonóticos en mascotas caninas y felinas de escolares suburbanos

    OpenAIRE

    Piacenza, G.; Jorge, S; Zubiri, Karina; Ceccarelli, Soledad; Ciarmela, María Laura; Pezzani, Betina Cecilia; Minvielle, Marta Cecilia

    2016-01-01

    Los animales que con mayor frecuencia se encuentran en hogares son los perros y los gatos. El contacto con estos animales produce un vínculo afectivo y ayuda a los niños en su desarrollo emocional. Sin embargo, esta convivencia puede poner a los integrantes de la familia en riesgo de contraer alguna infección zoonótica; como las causadas por parásitos intestinales como Toxocara sp., Ancylostoma caninum y Giardia sp., entre otras. Objetivo: identificar las especies de parásitos que presenta...

  12. Sobrepoblación canina y felina: tendencias y nuevas perspectivas

    Directory of Open Access Journals (Sweden)

    C. A. Salamanca

    2011-06-01

    Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, seconsultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink yMedline, para la búsqueda de la información. Como palabras clave se utilizaron: perrosde libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblacióny control de población. Además se consultó el banco de publicaciones de la SociedadMundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias(OIE. El objetivo de esta revisión fue presentar una posición crítica sobre laproblemática de la sobrepoblación de mascotas, su percepción cultural y la relaciónhombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posiblessoluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséisreferencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos quecumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión.A medida que aumente nuestro conocimiento acerca de la tenencia responsablede las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de laeducación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos conrespecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental queejerce el médico veterinario en la comunidad.

  13. Clinical approach to canine vaginitisAbordagem clínica da vaginite canina

    Directory of Open Access Journals (Sweden)

    Maria Isabel Mello Martins

    2012-08-01

    Full Text Available Vaginitis is a rare disease in adult female dogs. However, knowledge regarding this illness is important because, if secondary to reproductive tract anomalies that go uncorrected, it can cause ascending uterine infections and, consequently, subfertility or even infertility. Usually, these infections are caused by Enterobacter or microorganisms from the urogenital inferior system, such as Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, etc. In some cases, vaginitis may be caused by primary infections with Brucella canis, which is zoonotic, or by canine herpesvirus; both of these agents have the potential to cause reproductive failure. The disease can occur in any age, breed or ovarian condition and can be identified by vaginal cytology, vaginoscopy and culture of vaginal secretions. The most common clinical signs are erythema of the vaginal mucous, vaginal discharge, pollakiuria, licking of the vulva and attraction of male dogs, independent of the phase of the estrous cycle. This disease is generally self-limiting, and the treatment, when necessary, consists of antibiotic therapy, vaginal cleaning with antiseptic and, eventually, surgical correction of predisposing abnormalities. A vaginite é uma afecção rara em cadelas adultas. É uma causa importante de subfertilidade ou infertilidade, quando secundária à anomalias do trato reprodutivo. Normalmente, são causadas por enterobactérias ou pela microbiota do sistema urogenital inferior, tais como Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, entre outras. Em alguns casos, pode ser primária como infecções por Brucella canis, a qual é uma zoonose ou herpesvírus canino, importante causa de falhas reprodutivas. A afecção acomete fêmeas de qualquer idade, raça ou condição ovariana. Os sinais clínicos envolvem mucosa vaginal hiperêmica, corrimento vulvar, polaquiúria, lambedura vulvar, e atração de machos independente da fase do ciclo estral. Pode ser diagnosticada por citologia vaginal, vaginoscopia e cultura da secreção. A enfermidade, muitas vezes, é autolimitante e o tratamento, quando necessário, e’ realizado com infusão vaginal de antissépticos ou antibióticos e, eventualmente, correção cirúrgica de anormalidades predisponentes.

  14. Isolation and structure elucidation of pectic polysaccharide from rose hip fruits (Rosa canina L.)

    NARCIS (Netherlands)

    Ognyanov, Manol; Remoroza, Connie; Schols, Henk A.; Georgiev, Yordan; Kratchanova, Maria; Kratchanov, Christo

    2016-01-01

    A pectic polysaccharide from rose hip (RH) fruits has been obtained by extraction with 1% aqueous citric acid. It was found that the polysaccharide fraction mainly consisted of galacturonic acid (45.5%) next to galactose (5.5%) and arabinose (4.7%). RH pectin is having a relatively high degree of

  15. Aspectos epidemiológicos de las mordeduras caninas Epidemiological aspects of dog bites

    Directory of Open Access Journals (Sweden)

    Jorge Palacio

    2005-02-01

    Full Text Available Las mordeduras de animales a personas suponen un importante problema de salud pública. Dentro de éstas, las más frecuentes son las producidas por perros. Un primer paso necesario en la prevención de este tipo de accidentes es conocer los factores de riesgo implicados. El presente trabajo revisa la bibliografía más relevante en cuanto a la incidencia, los factores de riesgo y la prevención de las mordeduras de perros en personas. Así, según las características de las víctimas, se revisan determinados aspectos, como la edad, el sexo, la localización y la gravedad de las lesiones. En relación con los perros agresores, se describen las razas implicadas y el historial previo del animal. Igualmente, se describen los contextos en que se producen las mordeduras, en relación con la fecha, el número de perros, los lugares más frecuentes, la relación e interacción víctima-perro y la participación de las distintas categorías de agresividad del etograma canino. En el último apartado se recogen las recomendaciones más habituales halladas en la bibliografía para prevenir y reducir la incidencia de mordeduras sobre la población general.Animal bites in humans are an important public health problem. Most of these bites are dog bites. The first step in preventing this kind of accident is to identify the associated risk factors. The present article reviews the most important published articles on the incidence of dog bites, their risk factors, and preventive measures. Concerning victim profiles, features such as age, sex, location, and the severity of the wounds are reviewed. Regarding dogs, the most frequent breeds involved and the dog's previous history of aggression are described. In addition, the different contexts in which bites occur are reported. Thus, factors such as dates, number of dogs, places, victim-dog relationship and interaction, and the distinct involved categories of aggression of the canine ethogram are reviewed. The most frequent recommendations found in the literature to reduce and prevent dog bites in the human population are also described.

  16. Rose hip (Rosa canina L.) oil obtained from waste hip seeds by different extraction methods.

    Science.gov (United States)

    Szentmihályi, Klára; Vinkler, Péter; Lakatos, Béla; Illés, Vendel; Then, Mária

    2002-04-01

    From the rose hip seed, which is generally a waste material, valuable oil can be obtained for medicinal use. Various extraction methods have been compared: traditional solvent extraction with ultrasound-, microwave-, sub- and supercritical fluid extraction (SFE). Unsaturated fatty acid (UFA: oleic-, linoleic- and linolenic acid; 16.25-22.11%, 35.94-54.75%, 20.29-26.48%) and polyunsaturated fatty acid (PUFA:linoleic- and linolenic acid) content were over 90% and 60% in the recovered oils. The oils contained different amounts of metals. The concentration of some metals, particularly iron in microwave oil (27.11 microg g(-1)) is undesirable from the aspect of stability. By traditional solvent extraction, oil was obtained in 4.85 wt/wt%. Subcritical FE appeared to be the best method for the recovery of rose hip oil with highest oil yield (6.68 wt/wt%), carotene- (145.3 microg g(-1)) and linoleic acid content (54.75%). Supercritical FE without organic solvent is suitable for mild recovery of oil. The oil was rich in UFA and PUFA (92.7% and 76.25%) and contained the lowest amount of carotene and pheophytin (36.3 and 45.8 microg g(-1)). Oil yield in most new extraction methods (microwave extraction, super- and subcritical FE) was higher than in the case of traditional Soxhlet extraction. The main benefit of supercritical FE with CO2 is the solvent free oil while in the case of other extractions evaporation of the solvent is needed. Although the content of bioactive compounds in oils was different, all oils may be appropriate for medicinal use.

  17. Mosquitos vetores potenciais de dirofilariose canina na Região Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Ahid Silvia MM

    1999-01-01

    Full Text Available INTRODUÇÃO: Em alguns bairros costeiros de São Luís, Maranhão, a prevalência da dirofilariose chega a mais de 40% entre os cães domiciliados. Porém, desconhecem-se os vetores naturais, tanto lá quanto no resto do Nordeste do país. O objetivo do estudo foi identificar os prováveis vetores dessa parasitose. MÉTODOS: Realizaram-se coletas mensais de mosquitos em um bairro costeiro de São Luís, MA, de março de 1996 a maio de 1997, no peridomicílio, tendo cão e homem como iscas. Os mosquitos foram dissecados para a pesquisa de larvas da Dirofilaria immitis. RESULTADOS: Coletaram-se 1.738 mosquitos de 11 espécies. Culex quinquefasciatus, capturada todos os meses, porém menos freqüente na estação chuvosa, correspondeu a 54,5% do total, seguido de Aedes albopictus (20,3%, Aedes taeniorhynchus e Aedes scapularis (ambos 11%. Larvas de D.immitis foram encontradas em 0,1% dos Cx. quinquefasciatus e 0,5% dos Ae. taeniorhynchus. CONCLUSÕES: Ae. taeniorhynchus e Cx. quinquefasciatus foram considerados vetores potenciais da dirofilariose em São Luís. A importância local de Cx. quinquefasciatus como transmissor primário da D. immitis necessita ser melhor avaliada.

  18. Mosquitos vetores potenciais de dirofilariose canina na Região Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Silvia MM Ahid

    1999-12-01

    Full Text Available INTRODUÇÃO: Em alguns bairros costeiros de São Luís, Maranhão, a prevalência da dirofilariose chega a mais de 40% entre os cães domiciliados. Porém, desconhecem-se os vetores naturais, tanto lá quanto no resto do Nordeste do país. O objetivo do estudo foi identificar os prováveis vetores dessa parasitose. MÉTODOS: Realizaram-se coletas mensais de mosquitos em um bairro costeiro de São Luís, MA, de março de 1996 a maio de 1997, no peridomicílio, tendo cão e homem como iscas. Os mosquitos foram dissecados para a pesquisa de larvas da Dirofilaria immitis. RESULTADOS: Coletaram-se 1.738 mosquitos de 11 espécies. Culex quinquefasciatus, capturada todos os meses, porém menos freqüente na estação chuvosa, correspondeu a 54,5% do total, seguido de Aedes albopictus (20,3%, Aedes taeniorhynchus e Aedes scapularis (ambos 11%. Larvas de D.immitis foram encontradas em 0,1% dos Cx. quinquefasciatus e 0,5% dos Ae. taeniorhynchus. CONCLUSÕES: Ae. taeniorhynchus e Cx. quinquefasciatus foram considerados vetores potenciais da dirofilariose em São Luís. A importância local de Cx. quinquefasciatus como transmissor primário da D. immitis necessita ser melhor avaliada.

  19. Mosquitos vetores potenciais de dirofilariose canina na Região Nordeste do Brasil

    OpenAIRE

    Ahid Silvia MM; Lourenço-de-Oliveira Ricardo

    1999-01-01

    INTRODUÇÃO: Em alguns bairros costeiros de São Luís, Maranhão, a prevalência da dirofilariose chega a mais de 40% entre os cães domiciliados. Porém, desconhecem-se os vetores naturais, tanto lá quanto no resto do Nordeste do país. O objetivo do estudo foi identificar os prováveis vetores dessa parasitose. MÉTODOS: Realizaram-se coletas mensais de mosquitos em um bairro costeiro de São Luís, MA, de março de 1996 a maio de 1997, no peridomicílio, tendo cão e homem como iscas. Os mosquitos foram...

  20. PREVALENCIA DE BRUCELOSIS CANINA EN DOS DISTRITOS DE LA PROVINCIA CONSTITUCIONAL DEL CALLAO

    OpenAIRE

    Ramírez L., Hernán; Práctica privada.; Calle E., Sonia; Laboratorio de Microbiología y Parasitología Veterinaria, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima Perú.; Echevarría C., Luisa; Facultad de Veterinaria y Zootecnia, Universidad Peruana Cayetano Heredia; Morales C., Siever; Laboratorio de Microbiología y Parasitología Veterinaria, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima

    2012-01-01

    The objective of this study was to determine the prevalence of canine brucellosis(Brucella canis) in two districts of the province of Callao. A total of 456 sera werecollected from dogs without distinction of breed, sex and age. Samples were analyzed bythe Agar Gel Immunodiffusion (AGID) test using B. ovis antigen. The results indicatedthat 15.6 ± 3.3 (71/456) of sampled animals were positive. No statistical differences werefound due to district, breed, sex or age; however, differences were f...

  1. Resistência de estafilococos de origem canina, frente à drogas anti microbianas em Londrina, PR.

    Directory of Open Access Journals (Sweden)

    Amauri Alcindo Alfieri

    1985-11-01

    Full Text Available The sensitivity of 71 staphylococci (S. aureus and S. intermedius, isolated from dogs with signs of skin disease, to J1 chemotherapeutic agents was determined. Of the strains, 55(77,46% were resistant to amicacin, 29(40,84% to penicillin G, 26(36,61% to ampicillin, 24(33,80% to tetracycline, 15(21,13% to chloramphenicol, 12(16,90% to erytromycin, 11(15,49% to kanamycin, 8(11,27% to gentamycin, 5(7,04% to sulfazothrim, 2(2,82% to cefoxithin and 1(1,41% to oxacillin.Foram examinadas 71 cepas de estafilococos (S. aureus e S. intermedius isoladas a partir de cães com pioderma, frente a 11 substâncias antimicrobianas. Das cepas, 55(77,46% apresentaram resistência à amicacina, 29(40,84% à penicilina G, 26(36,61% à ampicilina, 24(33,80% à tetraciclina, 15(21,13% ao cloranfenicol, 12(16,90% à eritromicina, 11(15,49% à canamicina, 8(11,27% à gentamicina, 5(7,04% ao sulfazotrim, 2(2,82% à cefoxitina e 1(1,41% a oxacilina.

  2. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Campín, Sabanas del Potrero and Escobar Arriba, department of Sucre. The collected ticks were preserved into eppendorf tubes with 70% ethanol, and identified using standard morphological keys for each family. Argasid species were determined by measuring external morphological characters. Of 134 examined dogs in the three localities, 50 were found infested by ticks, representing a infestation rate of 37,3%. A total of 420 ticks were collected from dogs and identified as Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus, and Amblyomma ovale of the Ixodidae family, and Ornithodoros puertoricensis of the Argasidae family. R. sanguineus was the predominant species (92,1% in the stages of larva, nymph and adult, following by O. puertoricensis larvae recorded in low numbers in the three regions sampled. The tick O. puertoricensis is recorded for the first time as ectoparasite of domestic dogs in America. Additionally, the presence of this tick species is confirmed in Colombia.

  3. [Molecular and morphological comparison of hookworms from genus Uncinaria invading red fox (Vulpes vulpes) and dog (Canis familiaris)].

    Science.gov (United States)

    Górski, Paweł; Radowańska, Agnieszka; Jaros, Dorota; Wiśniewski, Marcin

    2006-01-01

    Two species of hookworms from genus Uncinaria have been found so far in Poland. Uncinaria stenocephala infects mainly dog, wolf and red fox, whereas Uncinaria criniformis is a parasite of mustelids (but it was also reported from red fox). 19 male and 29 female hookworms from red foxes have been compared with 10 male and 12 female worms from dogs. Hookworms from dogs were generally smaller than these from foxes, but no other morphological differences could be found. These hookworms were qualified to species Uncinaria stenocephala on the ground of morphology of male. Genomic DNA samples have been isolated from these hookworms and segments of rDNA including part of small subunit of ribosomal RNA gene; internal transcribed spacer 1 (ITS1); 5.8 S ribosomal RNA; internal transcribed spacer 2 (ITS2) and part of large subunit of ribosomal RNA have been amplified and sequenced. Sequences from Uncinaria obtained both from foxes and dogs have shown very high similarity to the sequence of Uncinaria stenocephala, so all examined hookworms have been classified as belonging to this species.

  4. Most domestic dogs (Canis lupus familiaris) prefer food to petting: population, context, and schedule effects in concurrent choice.

    Science.gov (United States)

    Feuerbacher, Erica N; Wynne, Clive D L

    2014-05-01

    Previous research has indicated both petting (McIntire & Colley, 1967) and food (Feuerbacher & Wynne, 2012) have reinforcing effects on dog behavior and support social behavior towards humans (food: Elliot & King, 1960; social interaction: Brodbeck, 1954). Which type of interaction dogs prefer and which might produce the most social behavior from a dog has not been investigated. In the current study, we assessed how dogs allocated their responding in a concurrent choice between food and petting. Dogs received five 5-min sessions each. In Session 1, both food and petting were continuously delivered contingent on the dog being near the person providing the respective consequence. Across the next three sessions, we thinned the food schedule to a Fixed Interval (FI) 15-s, FI 1-min, and finally extinction. The fifth session reversed back to the original food contingency. We tested owned dogs in familiar (daycare) and unfamiliar (laboratory room) environments, and with their owner or a stranger as the person providing petting. In general, dogs preferred food to petting when food was readily available and all groups showed sensitivity to the thinning food schedule by decreasing their time allocation to food, although there were group and individual differences in the level of sensitivity. How dogs allocated their time with the petting alternative also varied. We found effects of context, familiarity of the person providing petting, and relative deprivation from social interaction on the amount of time dogs allocated to the petting alternative.

  5. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris Affected with Hypoadrenocorticism (Addison's Disease.

    Directory of Open Access Journals (Sweden)

    Alisdair M Boag

    Full Text Available Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD or autoimmune polyendocrine syndrome (APS, circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH, CYP17A1 (17-hydroxylase; 17-OH, CYP11A1 (P450 side-chain cleavage enzyme; P450scc and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation. Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016. Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037. Significant associations with breed (p = 0.015 and DLA-type (DQA1*006:01 allele; p = 0.017 were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  6. Intranasally administered oxytocin affects how dogs (Canis familiaris) react to the threatening approach of their owner and an unfamiliar experimenter.

    Science.gov (United States)

    Hernádi, Anna; Kis, Anna; Kanizsár, Orsolya; Tóth, Katinka; Miklósi, Bernadett; Topál, József

    2015-10-01

    Fear and aggression are among the most prominent behavioural problems in dogs. Oxytocin has been shown to play a role in regulating social behaviours in humans including fear and aggression. As intranasal oxytocin has been found to have some analogous effects in dogs and humans, here we investigated the effect of oxytocin on dogs' behaviour in the Threatening Approach Test. Dogs, after having received intranasal administration of oxytocin (OT) or placebo (PL), showed the same reaction to an unfamiliar experimenter, but OT pretreated dogs showed a less friendly first reaction compared to the PL group when the owner was approaching. Individual differences in aggression (measured via questionnaire) also modulated dogs' first reaction. Moreover, subjects that received OT looked back more at the human (owner/experimenter) standing behind them during the threatening approach. These results suggest that oxytocin has an effect on dogs' response to the threatening cues of a human, but this effect is in interaction with other factors such as the identity of the approaching human and the 'baseline' aggression of the dogs.

  7. Autoantibodies against Cytochrome P450 Side-Chain Cleavage Enzyme in Dogs (Canis lupus familiaris) Affected with Hypoadrenocorticism (Addison's Disease).

    Science.gov (United States)

    Boag, Alisdair M; Christie, Michael R; McLaughlin, Kerry A; Syme, Harriet M; Graham, Peter; Catchpole, Brian

    2015-01-01

    Canine hypoadrenocorticism likely arises from immune-mediated destruction of adrenocortical tissue, leading to glucocorticoid and mineralocorticoid deficiency. In humans with autoimmune Addison's disease (AAD) or autoimmune polyendocrine syndrome (APS), circulating autoantibodies have been demonstrated against enzymes associated with adrenal steroid synthesis. The current study investigates autoantibodies against steroid synthesis enzymes in dogs with spontaneous hypoadrenocorticism. Coding regions of canine CYP21A2 (21-hydroxylase; 21-OH), CYP17A1 (17-hydroxylase; 17-OH), CYP11A1 (P450 side-chain cleavage enzyme; P450scc) and HSD3B2 (3β hydroxysteroid dehydrogenase; 3βHSD) were amplified, cloned and expressed as 35S-methionine radiolabelled recombinant protein. In a pilot study, serum samples from 20 dogs with hypoadrenocorticism and four unaffected control dogs were screened by radio-immunoprecipitation assay. There was no evidence of reactivity against 21-OH, 17-OH or 3βHSD, but five dogs with hypoadrenocorticism showed immunoreactivity to P450scc compared with controls. Serum samples were subsequently obtained from 213 dogs diagnosed with hypoadrenocorticism and 110 dogs from a hospital control population. Thirty control dogs were randomly selected to establish a threshold for antibody positivity (mean + 3 × standard deviation). Dogs with hypoadrenocorticism were more likely to be P450scc autoantibody positive than hospital controls (24% vs. 1.2%, respectively; p = 0.0016). Sex was significantly associated with the presence of P450scc autoantibodies in the case population, with 30% of females testing positive compared with 17% of males (p = 0.037). Significant associations with breed (p = 0.015) and DLA-type (DQA1*006:01 allele; p = 0.017) were also found. This cross-sectional study indicates that P450scc autoantibodies are present in a proportion of dogs affected with hypoadrenocorticism.

  8. Leishmaniosis--a report about the microvascular and cellular architecture of the infected spleen in Canis familiaris.

    Science.gov (United States)

    Alexandre-Pires, G; Pais, D; Correia, M; Pina, J A Esperança

    2006-04-01

    Leishmaniosis is an anthropozoonosis caused by an intracellular protozoan parasite that causes a wide spectrum of diseases in humans and dogs worldwide. In the Mediterranean basin, Portugal, Central and South America, and in the Middle East, visceral leishmaniosis is caused by Leishmania infantum. In these areas, dogs are believed to be the natural reservoirs of this parasite. In the case of visceral leishmaniosis, the spleen is one of the several hematopoietic and immunocompetent organs involved. Since this viscera is a blood filter, the authors investigated the expression of the morphological and microvascular environment and modifications of the spleen cell population related to immunological responses to this parasitic condition. The tools used to perform this study were scanning electronic microscopy of intact tissue and corrosion casts, transmission electronic microscopy, histology and immunohistochemistry. The results reveal three important modifications concerning the spleen's microvascular architecture when compared with its normal pattern, independently of the serological titer obtained with indirect immunofluorescence. (1) A marked scarcity of the sinusoidal system sheet that surrounds the central artery/arteriole of the white pulp; (2) A huge development of pulp venules and veins; (3) The presence of a surprising development of reticular fibers. The authors postulate that independent of the virulence of the parasite involved and the type of immunity prevalent in a particular host, the spleen develops blood dynamic conditions that permit reduction in the speed of blood flow so that cells involved in immunological processes can proliferate and differentiate, and also contributes to trapping lymphocytes within the area through the differentiation of characteristics that resemble those of HEV endothelial cells.

  9. Assessing inbreeding and loss of genetic variation in canids, domestic dog (Canis familiaris) and wolf (Canis lupus), using pedigree data

    OpenAIRE

    Jansson, Mija

    2014-01-01

    Genetic variation is necessary to maintain the ability of wild and domestic populations to genetically adapt to changed selective pressures. When relationships among individuals are known, conservation genetic management can be based on statistical pedigree analysis. Such approaches have traditionally focused on wild animal conservation breeding in captivity. In this thesis, I apply pedigree-based techniques to domestic and wild animal populations, focusing on two canids – the domestic dog an...

  10. Exploring the mechanical basis for acceleration: pelvic limb locomotor function during accelerations in racing greyhounds (Canis familiaris).

    Science.gov (United States)

    Williams, S B; Usherwood, J R; Jespers, K; Channon, A J; Wilson, A M

    2009-02-01

    Animals in their natural environments are confronted with a regular need to perform rapid accelerations (for example when escaping from predators or chasing prey). Such acceleration requires net positive mechanical work to be performed on the centre of mass by skeletal muscle. Here we determined how pelvic limb joints contribute to the mechanical work and power that are required for acceleration in galloping quadrupeds. In addition, we considered what, if any, biomechanical strategies exist to enable effective acceleration to be achieved. Simultaneous kinematic and kinetic data were collected for racing greyhounds undergoing a range of low to high accelerations. From these data, joint moments and joint powers were calculated for individual hindlimb joints. In addition, the mean effective mechanical advantage (EMA) of the limb and the ;gear ratio' of each joint throughout stance were calculated. Greatest increases in joint work and power with acceleration appeared at the hip and hock joints, particularly in the lead limb. Largest increases in absolute positive joint work occurred at the hip, consistent with the hypothesis that quadrupeds power locomotion by torque about the hip. In addition, hindlimb EMA decreased substantially with increased acceleration - a potential strategy to increase stance time and thus ground impulses for a given peak force. This mechanism may also increase the mechanical advantage for applying the horizontal forces necessary for acceleration.

  11. High speed galloping in the cheetah (Acinonyx jubatus) and the racing greyhound (Canis familiaris): spatio-temporal and kinetic characteristics.

    Science.gov (United States)

    Hudson, Penny E; Corr, Sandra A; Wilson, Alan M

    2012-07-15

    The cheetah and racing greyhound are of a similar size and gross morphology and yet the cheetah is able to achieve a far higher top speed. We compared the kinematics and kinetics of galloping in the cheetah and greyhound to investigate how the cheetah can attain such remarkable maximum speeds. This also presented an opportunity to investigate some of the potential limits to maximum running speed in quadrupeds, which remain poorly understood. By combining force plate and high speed video data of galloping cheetahs and greyhounds, we show how the cheetah uses a lower stride frequency/longer stride length than the greyhound at any given speed. In some trials, the cheetahs used swing times as low as those of the greyhounds (0.2 s) so the cheetah has scope to use higher stride frequencies (up to 4.0 Hz), which may contribute to it having a higher top speed that the greyhound. Weight distribution between the animal's limbs varied with increasing speed. At high speed, the hindlimbs support the majority of the animal's body weight, with the cheetah supporting 70% of its body weight on its hindlimbs at 18 m s(-1); however, the greyhound hindlimbs support just 62% of its body weight. Supporting a greater proportion of body weight on a particular limb is likely to reduce the risk of slipping during propulsive efforts. Our results demonstrate several features of galloping and highlight differences between the cheetah and greyhound that may account for the cheetah's faster maximum speeds.

  12. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Science.gov (United States)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  13. DIFERENCIAS INDIVIDUALES EN LOS PERROS DOMÉSTICOS (CANIS FAMILIARIS: REVISIÓN DE LAS EVALUACIONES CONDUCTUALES

    Directory of Open Access Journals (Sweden)

    Adriana Jakovcevic

    2009-01-01

    Full Text Available El estudio de las diferencias individuales en el comportamiento de los perros domésticos tiene un gran valor aplicado dado que permite una mejor selección de los mismos para cumplir las variadas funciones que tienen en la sociedad humanacomo perros guía, policía, compañía, rescatistas de personas, etc. En el trabajo que se informa se presenta una revisión de estudios sobre diferencias individuales en perros, basada únicamente en las baterías conductuales que evalúan un conjunto de rasgos del temperamento. Con este objetivo se realiza una breve descripción de cada batería de pruebas utilizadas en la literatura, analizando las definiciones operacionales de las variables eva luadas y los diferentes tipos de estímulos utilizados. Los rasgos mayormente evaluados son: temerosidad, agresividad, disposición al entrenamiento y sociabilidad. La te merosidad, en general es evaluada a través de la respuesta del animal ante la aparición de un estímulo súbito que puede ser intenso o no, como por ejemplo la reacción frente a un ruido fuerte, la apertura de un paraguas, o la aparición repentina de una figura humana. La agresividad se mide a través de la reacción frentea la amenaza o provocación por parte de un humano, la sustracción de un objeto o la confrontación con un perro dominante. La disposición al entrenamiento es estudiada a través de la respuesta del animal frente a diferentes estímulos como el juego con un trapo o una cuerda, el ejercicio de devolución de un objeto o la obediencia frente a distintos comandos. Por último, la sociabilidad se evalúa con la aparición o el acercamiento de un humano desconocido o con la exposición a un perro no familiar. Se discuten además las limitaciones metodológicas de las baterías así como también los importantes usos aplicados de las mismas.

  14. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris in a Food Choice Task.

    Directory of Open Access Journals (Sweden)

    Judit Abdai

    Full Text Available The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1 Helper UMO and (2 Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3 Non-helper UMO and (4 Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  15. An Investigation on Social Representations: Inanimate Agent Can Mislead Dogs (Canis familiaris) in a Food Choice Task.

    Science.gov (United States)

    Abdai, Judit; Gergely, Anna; Petró, Eszter; Topál, József; Miklósi, Ádám

    2015-01-01

    The nature of mental representation of others plays a crucial role in social interactions. Dogs present an ideal model species for the investigation of such mental representations because they develop social ties with both conspecifics and heterospecifics. Former studies found that dogs' preference for larger food quantity could be reversed by humans who indicate the smaller quantity. The question is whether this social bias is restricted to human partners. We suggest that after a short positive social experience, an unfamiliar moving inanimate agent (UMO) can also change dogs' choice between two food quantities. We tested four groups of dogs with different partners: In the (1) Helper UMO and (2) Helper UMO Control groups the partner was an interactive remote control car that helped the dog to obtain an otherwise unreachable food. In the (3) Non-helper UMO and (4) Human partner groups dogs had restricted interaction with the remote control car and the unfamiliar human partners. In the Human partner, Helper UMO and Helper UMO Control groups the partners were able to revert dogs' choice for the small amount by indicating the small one, but the Non-helper UMO was not. We suggest that dogs are able to generalize their wide range of experiences with humans to another type of agent as well, based on the recognition of similarities in simple behavioural patterns.

  16. Anatomia dental de cães (Canis familiaris) e gatos (Felis catus). Considerações cirúrgicas

    OpenAIRE

    Juliana Kowalesky

    2005-01-01

    Com a rápida evolução da odontologia veterinária na última década, faz-se crescente a busca pelo conhecimento da área e a busca por referências bibliográficas, porém nota-se que as informações existentes de uma área essencial, a anatomia, estão limitadas a descrições básicas. Sabe-se que o conhecimento da anatomia do sistema estomatognático é de fundamental importância para que clínicos e cirurgiões possam diagnosticar e instituir tratamento adequado e preciso. Apesar dos livros de odontologi...

  17. Functional anatomy and muscle moment arms of the pelvic limb of an elite sprinting athlete: the racing greyhound (Canis familiaris).

    Science.gov (United States)

    Williams, S B; Wilson, A M; Rhodes, L; Andrews, J; Payne, R C

    2008-10-01

    We provide quantitative anatomical data on the muscle-tendon architecture and geometry of the pelvic limb of an elite sprint athlete, the racing greyhound. Specifically, muscle masses, muscle lengths, fascicle lengths, pennation angles and muscle moment arms were measured. Maximum isometric force and power of muscles, the maximum muscle torque at joints and tendon stress and strain were estimated. We compare data with that published for a generalized breed of canid, and other cursorial mammals such as the horse and hare. The pelvic limb of the racing greyhound had a relatively large volume of hip extensor muscle, which is likely to be required for power production. Per unit body mass, some pelvic limb muscles were relatively larger than those in less specialized canines, and many hip extensor muscles had longer fascicle lengths. It was estimated that substantial extensor moments could be created about the tarsus and hip of the greyhound allowing high power output and potential for rapid acceleration. The racing greyhound hence possesses substantial specializations for enhanced sprint performance.

  18. Functional anatomy and muscle moment arms of the thoracic limb of an elite sprinting athlete: the racing greyhound (Canis familiaris).

    Science.gov (United States)

    Williams, S B; Wilson, A M; Daynes, J; Peckham, K; Payne, R C

    2008-10-01

    We provide quantitative muscle-tendon architecture and geometry data for the racing greyhound thoracic limb. Muscle mass, belly length, fascicle lengths, pennation angles and moment arms were measured, as were tendon masses and lengths. Maximum isometric force and maximum power were estimated for muscles, and maximum stress and strain were estimated for tendons. Results are compared with other fast quadrupedal runners, and to previously published data in mixed-breed dogs. The implications of the functional adaptations of the greyhound thoracic limb for sprinting performance are discussed. The thoracic limb was found to benefit from a similar proportion of locomotor muscle mass to the pelvic limb, suggesting that it may be used to some extent in propulsion, or alternatively that stabilisation is very important in this animal. Extrinsic muscles, especially latissimus dorsi and pectoralis profundus, were predicted to be powerful and important for generating net positive work during accelerations. Proximal biarticular muscles show specialisation toward preventing collapse of the shoulder and elbow joints to enable strut-like limb function, or some form of dynamic control. Distal muscles did not appear specialised for elastic energy storage, a functional difference to pelvic limb muscles, and the equivalents in horse thoracic limbs. The greyhound thoracic limb appears to possess substantial differences from both that of more 'sub-maximal specialist' quadrupeds, and from the greyhound pelvic limb.

  19. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris.

    Science.gov (United States)

    de Oliveira Filho, Jaires Gomes; Sarria, André Lucio Franceschini; Ferreira, Lorena Lopes; Caulfield, John C; Powers, Stephen J; Pickett, John A; de León, Adalberto A Pérez; Birkett, Michael A; Borges, Lígia Miranda Ferreira

    2016-06-01

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed, the beagle, is mediated by volatile organic compounds (VOCs) 2-hexanone and benzaldehyde present in beagle odour. Ectoparasite location of animal hosts is affected by variation in these odour components and their ratios. The aim of this study was to quantify the release rate, and the ratio, of 2-hexanone and benzaldehyde from beagles. The odour of three beagles was collected, for four days, over one week (day 0, day 1, day 4 and day 7). The compounds were identified using coupled high-resolution gas chromatography-mass spectrometry (GC-MS), and authentic standards of compounds were used to generate external calibration curves for quantification. Both compounds were found in all dogs on all days. The amount of benzaldehyde was always higher than that of 2-hexanone and so their ratio varied from unity, on average (over time) being 3.128±0.365, 1.902±0.390, 1.670±0.671ngmL(-1) for beagle 1, 2 and 3, respectively. There was no significant (pbenzaldehyde in beagle odour samples covering a 7-day period. This knowledge enables development of repellents to protect dogs from R. sanguineus s. l. infestation.

  20. Distribución y abundancia de Capromys pilorides en manglares de la Península de Guanahacabibes (Cuba

    Directory of Open Access Journals (Sweden)

    Hernández- Martínez, Fernando R

    2008-07-01

    Full Text Available La presente investigación se llevó a cabo con la finalidad de determinar la abundancia y distribución de las poblaciones del endémico Capromys pilorides en la formación de manglar de la Reserva de la Biosfera Península de Guanahacabibes. Se seleccionaron 3 localidades: Carabelita, Palma Sola y Bolondrón, en las cuales se establecieron y muestrearon 10 parcelas de 5.000 m2 durante tres momentos diferentes del periodo lluvioso y poco lluvioso. Los valores de abundancia (jutías/ha variaron entre 3,53 y 10,4en dependencia del grado de naturalidad y el efecto de ntropización, así como de la influencia del perro jíbaro (Cannis familiaris sobre las poblaciones de jutía conga. Se encontró diferencia significativa en el patrón de distribución de la abundancia entre el período poco lluvioso y lluvioso, así como entre localidades en ambos períodos. En el patrón de distribución de la abundancia relativa de Capromys/especie de árbol estuvo asociado aConocarpus erectus y el Callophylum brasiliense.

  1. Studies on changes of atrial function and its mechanism in a cannie atrial fibrillation model%心房颤动犬心房功能改变特点及机制的研究

    Institute of Scientific and Technical Information of China (English)

    马骁; 张薇; 杨贵荣; 钟明; 黎莉; 张运

    2007-01-01

    目的 应用声学定量技术评价心房颤动(房颤)犬左心房功能改变,探讨钙激活蛋白酶系统与左房功能重构的关系.方法 17只杂种犬随机分为房颤组(11只)和对照组(6只),通过心房快速起搏8周建立犬房颤模型,于起搏前后应用声学定量技术记录左心房容量-时间曲线,并计算相关指标.采用Western blot技术检测左心房肌钙依赖性中性蛋白酶(calpain)及其抑制剂钙蛋白酶抑制蛋白(calpastatin)的蛋白表达量.结果 与对照组比较,房颤组左房储存器容积无明显改变;管道容积显著增加(P<0.01);左房射血分数、峰值心房排空率(PAER)显著降低(P <0.01);左房心室收缩末期容积、快速排空末期容积、心室舒张末期容积、心房排空容积增加(P<0.01).房颤组calpain Ⅰ、calpain Ⅱ蛋白表达明显高于对照组(P<0.05),calpastatin蛋白表达明显低于对照组(P <0.05).calpain Ⅰ蛋白表达水平与左房PAER、左房排空分数、左室射血分数呈显著负相关(P<0.05);calpastatin蛋白表达水平与左心房PAER、左房排空分数呈显著正相关(P <0.05).结论 房颤时心房发生功能重构,表现为助力泵功能减低,管道功能增强,calpain系统激活可能是房颤时心房功能重构的重要分子机制.

  2. Astrocytic reaction in the canine granulomatous meningoencephalomyelitis Reação astrocítica na meningoencefalomielite granulomatosa canina

    Directory of Open Access Journals (Sweden)

    L.S. Jardim

    2001-04-01

    Full Text Available A meningoencefalomielite granulomatosa (MEG ocorre em cães de todas as raças, em qualquer idade e já foi descrita em vários países. Sua etiologia não é definida, mas sugere-se que uma reação de hipersensibilidade retardada esteja envolvida. Nas lesões há ocorrência de profuso infiltrado de células B e T, além de macrófagos. No presente estudo verificou-se, com técnicas de imunoistoquímica, a distribuição e a morfologia de astrócitos imunorreativos à proteína glial fibrilar ácida no encéfalo de cães acometidos por MEG e também as proporções de células imunorreativas a IgG, IgM e CD3. Foram utilizados seis cães, três machos e três fêmeas, com idade entre dois e seis anos. Observou-se acentuada astrocitose principalmente ao redor das lesões, com aumento da área do corpo celular e da área nuclear em 302,6% e 88,9%, respectivamente. Os processos citoplasmáticos dos astrócitos tornaram-se mais evidentes, aparecendo, às vezes, como fragmentos no neurópilo. Do total de células inflamatórias infiltradas, 37,9% eram IgG positivas, 23,5% IgM positivas e 12% CD3 positivas. Conclui-se que na MEG ocorre uma expressiva astrocitose associada com a presença de alta proporção de células imunes.

  3. Evaluación del espesor parietal relativo en la especie canina Evaluation of relative wall thickness in dogs

    Directory of Open Access Journals (Sweden)

    C. Lightowler

    2005-12-01

    Full Text Available Tanto los fenómenos patológicos como el ejercicio y entrenamiento promueven en el corazón fenómenos de adaptación, que varían según el mecanismo que los promueve. Uno de los mecanismos que se encuentra siempre en la adaptación cardiaca es la hipertrofia del miocardio. El grado de hipertrofia puede evaluarse midiendo la masa miocárdica ventricular izquierda. Sin embargo este parámetro evalúa la cantidad de hipertrofia, pero no la manera en que ésta se distribuye. Dicha distribución puede calcularse por medio del índice ecocardiográfico conocido como espesor parietal relativo (EPR. En este trabajo, los autores presentan la técnica ecocardiográfica para la evaluación del EPR en el perro y su valor normal promedio. Los resultados obtenidos fueron los siguientes: Media: 0,482; Desviación estándar: 0,098; Coeficiente de variación: 18,37%; Valor mínimo: 0,355; Primer cuartil: 0,407; Mediana: 0,459; Tercer cuartil: 0,528; Valor máximo: 0,728. Asimismo, se verificó la inexistencia de regresión lineal entre el EPR y el peso corporal.As much as the pathological phenomena the exercise and training promote in the heart adaptation phenomena, which vary according to the mechanism that promotes them. One of the mechanisms that is always present in cardiac adaptation is hypertrophy of myocardium. The degree of hypertrophy can be evaluated measuring the left ventricular myocardial mass. Nevertheless this parameter measures the amount of hypertrophy, but not how it is distributed; this can be evaluated by means of relative wall thickness (RWT index. In the present study the authors describe the echocardiography technique for the evaluation of the RWT in the dog and present its normal mean value. The results obtained were the following: Mean: 0,482; Standard deviation: 0,098; Coefficient of variation: 18,37%; Minimum value: 0,355; First quartile: 0,407; Median: 0,459; Third quartile: 0,528; Maximum value: 0,728. Also was verified the nonexistence of linear regression between the RWT and the body weight.

  4. Biomarcadores metabólicos y de inflamación en la obesidad canina y felina en enfermedades asociadas

    OpenAIRE

    Tvarijonaviciute, Asta

    2012-01-01

    En esta Tesis los principales 5 avances que se aportan sobre obesidad en perros y gatos son: 1) Los ensayos comercialmente disponibles para la adiponectina y la IGF-1 funcionan para estas especies. 2) La adiponectina y IGF-1 no están influenciadas por los ciclos de alimentación/ayuno o por corticoides. La adiponectina no se afecta por orquidectomia, mientras que la IGF-1 baja. La inflamación disminuye la adiponectina y la IGF-1. 3) La adiponectina baja en la obesidad, aunque no se aprecia un ...

  5. Leishmaniose tegumentar canina em Morada das Águias (Serra da Tiririca, Maricá, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Cathia M. B. Serra

    2003-12-01

    Full Text Available Descreve-se a ocorrência da leishmaniose tegumentar em cães da localidade de Morada das Águias (Serra da Tiririca, Maricá, Estado do Rio de Janeiro, Brasil. Foram avaliados 83 cães por meio de exames clínico, sorológico e parasitológico. Os soros de 11 (13,2% animais foram reagentes à imunofluorescência indireta (IFI e de 30 (36,1% ao ensaio imunoenzimático (ELISA. Úlceras cutâneas e ou mucosas foram observadas em 18 (n = 83; 21,7% dos animais. Leishmania foi isolada de 11 cães. Discute-se a ocorrência da doença e a ocupação da localidade.

  6. CANINE EHRLICHIOSIS IN CAMPOS DOS GOYTACAZES, RIO DE JANEIRO, BRAZIL ERLIQUIOSE CANINA EM CAMPOS DOS GOYTACAZES, RIO DE JANEIRO, BRASIL

    Directory of Open Access Journals (Sweden)

    Orlando Augusto Melo Jr.

    2007-12-01

    Full Text Available

    It was evaluated 1.576 dogs with the intention to search positivity and to analyze hematological aspects of dogs infected with Ehrlichia spp. in Campos dos Goytacazes. The research of blood-parasites and complete blood counts had been carried out, to determine the occurrence and hematological aspects of dogs infected for Ehrlichia spp. The diagnosis was based by visualization of the Ehrlichia spp. morulae in the leukocytes, its great majority was in monocyte, being considered infected 219 (13,89% dogs. Anemia, thrombocytopenia, nuclear left deviation neutrophils, eosinopenia and absolute monocytopenia was been the most hematological alterations found.

    Key-words: Blood smears, Ehrlichia spp., hematology.

    Com o propósito de pesquisar a positividade e analisar os aspectos hematológicos de cães infectados com Ehrlichia spp. na cidade de Campos dos Goytacazes, avaliaram-se 1.576 cães. Realizaram-se pesquisa de hemocitozoários e hemograma para se determinar a ocorrência e os aspectos hematológicos dos cães infectados por Ehrlichia spp. Baseou-se o diagnóstico no achado de mórulas de Ehrlichia spp. nos leucócitos, em sua maioria nos monócitos, sendo considerados infectados 219 (13.89% cães.   Anemia, trombocitopenia, DNNE leve, eosinopenia e monocitopenia absolutas foram as alterações hematológicas mais observadas.

    Palavras-chaves: Esfregaço sangüíneo, hematologia, Ehrlichia spp.

  7. BETAHISTINE DIHYDROCHLORIDE IN CANINE PERIPHERAL VESTIBULAR SYNDROME DICLORIDRATO DE BETAISTINA NA SÍNDROME VESTIBULAR PERIFÉRICA CANINA

    Directory of Open Access Journals (Sweden)

    Tatiana Champion

    2010-04-01

    Full Text Available Vestibular disease is a common syndrome in small animals that  may resulst of central or peripheral disease. The pathophysiology of peripheral vestibular syndrome is unknown, however it can be related to an abnormal dynamic of endolymphatic fluid or neuritis of the vestibular portion of the VIII cranial nerve.  The recovery of neurological sings is slow and, in chronic cases, the neurological deficits can be irreversible. In veterinary medicine, thera are few medical options to treat this condition, however, in Medicine, betahistine dihydrochloride is used to treat peripheral vestibular disorders. These drug  was used in four dogs with vestibular syndrome. The results showed clinical improvement in 7 to 10 days of treatment and completed recovery in 20 to 30 days, followed by the cure. One year after the treatment, the dogs did not have recurrence of the syndrome. This report shows the use of betahistine dihydrochloride in dogs with peripheral vestibular syndrome, with rapid clinical recover, without laboratorial abnormalities or recurrence of the clinical signs .The results encourage the use of betahistine dihydrochloride in the treatment of  peripheral vestibular disorders in small animals.

    KEY WORDS: Betahistine, dog, vestibular syndrome.
    A síndrome vestibular periférica é uma condição clínica comum em cães. Várias doenças podem causar essa síndrome. Entretanto, sua patofisiologia ainda é pouco conhecida. As alterações clínicas geralmente são autolimitantes, a recuperação pode ser longa e, em casos crônicos, os déficits neurológicos podem ser irreversíveis. Em medicina veterinária, há poucas opções terapêuticas. Na Medicina, o dicloridrato de betaístina é amplamente utilizado. Essa medicação foi empregada em seis cães com síndrome vestibular periférica. Os resultados mostraram melhora clínica com sete a dez dias de tratamento e recuperação quase completa entre vinte e trinta dias. Este trabalho descreve a utilização da betaistina em cães com síndrome vestibular periférica, a rápida melhora clínica e ausência de efeitos adversos. Os resultados obtidos parecem justificar o uso de dicloridrato de betaistina na terapia de distúrbios vestibulares periféricos em animais de companhia.

    PALAVRAS-CHAVES: Betaistina, cão, síndrome vestibular.

  8. Linear B-cell epitope mapping of MAPK3 and MAPK4 from Leishmania braziliensis: implications for the serodiagnosis of human and canine leishmaniasis.

    Science.gov (United States)

    Menezes-Souza, Daniel; de Oliveira Mendes, Tiago Antônio; de Araújo Leão, Ana Carolina; de Souza Gomes, Matheus; Fujiwara, Ricardo Toshio; Bartholomeu, Daniella Castanheira

    2015-02-01

    The correct and early identification of humans and dogs infected with Leishmania are key steps in the control of leishmaniasis. Additionally, a method with high sensitivity and specificity at low cost that allows the screening of a large number of samples would be extremely valuable. In this study, we analyzed the potential of mitogen-activated protein kinase 3 (MAPK3) and mitogen-activated protein kinase 4 (MAPK4) proteins from Leishmania braziliensis to serve as antigen candidates for the serodiagnosis of human visceral and tegumentary leishmaniasis, as well as canine visceral disease. Moreover, we mapped linear B-cell epitopes in these proteins and selected those epitopes with sequences that were divergent in the corresponding orthologs in Homo sapiens, in Canis familiaris, and in Trypanosoma cruzi. We compared the performance of these peptides with the recombinant protein using ELISA. Both MAPK3 and MAPK4 recombinant proteins showed better specificity in the immunodiagnosis of human and canine leishmaniasis than soluble parasite antigens and the EIE-leishmaniose-visceral-canina-bio-manguinhos (EIE-LVC) kit. Furthermore, the performance of this serodiagnosis assay was improved using synthetic peptides corresponding to B-cell epitopes derived from both proteins.

  9. Taxonomy Icon Data: dog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...

  10. Estimativa do intervalo pós-morte em um canino (Canis lupus familiaris Linnaeus 1758 pela entomologia forense em Cabedelo-PB, Brasil: relato de caso

    Directory of Open Access Journals (Sweden)

    G. Martins

    2013-08-01

    Full Text Available O intervalo pós-morte (IPM é um instrumento importante de diagnóstico relacionado à prática forense. O uso de insetos tem sido relatado como um modo eficiente para estimá-lo, quando o cadáver encontra-se em estágio avançado de decomposição. Objetivou-se com este trabalho estimar o IPM com base em evidências entomológicas em um canino. Foram coletadas larvas de moscas no cadáver e encaminhadas ao laboratório de entomologia, onde foram criadas e eclodiram adultos da espécie Chrysomya albiceps (Wiedemann, 1819. Somando-se os dados abióticos de temperatura e umidade relativa do local de coleta e do local de criação, estimou-se um IPM mínimo de 3,34 dias do momento da postura dos ovos pelas moscas até a coleta das larvas. Com base nos resultados obtidos, conclui-se que a entomologia forense, como ferramenta para estimativa do IPM, mostrou-se eficaz e determinante na elucidação do caso em questão.

  11. Individual differences in social and non-social behaviors in domestic dogs (Canis familiaris) during the acquisition, extinction and reacquisition of a problem solving task.

    Science.gov (United States)

    Shimabukuro, Carolina; Putrino, Natalia; Helbling, Julia; Tognetti, Sandra; Bentosela, Mariana

    2015-04-01

    Dogs are able to solve different problems by trial and error learning, but it seems that they cannot understand the means-end connection. Some studies suggest that dogs' performance is influenced by their breed and by the level of familiarity with the person they interact with. In our study, we assess individual differences in both social and non-social responses in a problem-solving task during the acquisition, extinction, and reacquisition phases. In order to investigate the effect of familiarity, in the first experiment, the human present during the task was either a familiar (the dog's owner) or unfamiliar person. In the second experiment, we compared breeds (Retrievers and Shepherds) that had previously shown differences in a communicative task. The results revealed that all groups learned the task and became more efficient in the acquisition trials. These non-social responses diminished during extinction, where an increase in social responses was observed. With regard to individual differences, dogs were more persistent in searching the reward during the second extinction trial when the owner was present (in contrast with a stranger), and also looked longer at the unfamiliar person at the beginning of the acquisition trial. On the other hand, Retrievers showed greater social motivation during reacquisition and Shepherds picked up more bones during the third acquisition trial, thus suggesting a more persistent search of the reward. These findings highlight the relevance of studying different learning schedules as well as individual differences in problem-solving ability so as to improve selection and training techniques.

  12. Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, M.; Sonne, C.; Jakobsen, Jette

    2010-01-01

    correlated negatively with sigma-dichlorodiphenyldichloroethane (sigma DDT) and and sigma-polybrominated diphenyl ethers (sigma PBDE) for all exposed animals. A negative correlation between kidney -tocopherol and sigma PCB concentrations was observed, whereas two positive significant correlations were...

  13. Effects of long-term dietary exposure to organohalogen contaminants on vitamin and hormonestatus in the Greenland Sledge dog (Canis familiaris)

    DEFF Research Database (Denmark)

    Kirkegaard, Maja

    lipids and vitamins. The study showed negative correlations between e.g. vitamin A and DDT and PBDE. Also liver vitamin D (25OHD3) in exposed females was signifi cantly lower, although they had received approximately 33% more vitamin D3 than controls. Despite the limited sample size, also testicular...

  14. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus)

    OpenAIRE

    Udell, Monique A.R.

    2015-01-01

    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' ‘looking back’ behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks mo...

  15. Shut up and pet me! Domestic dogs (Canis lupus familiaris) prefer petting to vocal praise in concurrent and single-alternative choice procedures.

    Science.gov (United States)

    Feuerbacher, Erica N; Wynne, Clive D L

    2015-01-01

    The nature of the interactions that maintain the social behavior of dogs toward humans and which interactions dogs prefer have not been thoroughly investigated. We focused here on dogs' preference for petting and vocal praise, and the influence that familiarity (owner vs. stranger) has on that preference. We first used concurrent choice to evaluate dogs' preference for petting or vocal praise and measured the initial choice, the time spent with each alternative, and the number of within-session alternations. We assessed dogs' preference for petting or vocal praise in (1) shelter dogs, (2) owned dogs with strangers providing both interactions, and (3) owned dogs with the dog's owner providing the interactions. Across all experimental groups, dogs preferred petting to vocal praise. We next assessed time spent with each alternative when only one alternative was available at a time in shelter dogs and owned dogs (Experiment 2). Shelter dogs were tested with a stranger and owned dogs were tested with their owners providing the interaction. Dogs alternated between petting and vocal praise, vocal praise and no interaction, or received only petting for eight 3-min sessions of each comparison. Both shelter and owned dogs spent significantly longer in proximity to the experimenter when the interaction was petting compared to vocal praise. Vocal praise produced as little proximity-seeking behavior as did no interaction. Additionally, dogs did not show any sign of satiation with petting across all eight sessions. Overall, petting seems to be an important interaction between dogs and humans that might maintain inter-specific social behavior but vocal praise likely has to be specifically conditioned. This article is part of a Special Issue entitled: Canine Behavior.

  16. Un percorso civile: storia e memoria dell’Associazione fra i familiari delle vittime della strage alla stazione di Bologna, 2 agosto 1980

    Directory of Open Access Journals (Sweden)

    Paolo Bolognesi

    2007-09-01

    Full Text Available On 2nd August 1980, at 10.25 a.m., a bomb exploded at the Central Station of Bologna. It was placed there by a commando of terrorists and it caused the death of 85 people and the wounding of others 200. Many of them are still suffering from the injuries caused by that tragic event and still today they need to follow a treatment.In order to promote the research of truth, in 1981, on 1st June, the “Association among the victims and their families of the attack at the Central Station of Bologna”, was founded and since then the Association goes on fighting to obtain justice. Le 2 août 1980, à dix heures vingt-cinq, une bombe, posée par des terroristes, explosa à la gare centrale de Bologne faisant 85 morts et 200 blessés. A cause de ce massacre, nombreuses furent les personnes handicapées à vie, blessées et traumatisées qui, encore aujourd'hui, doivent être soignées.Pour promouvoir la quête de vérité, le premier juin 1981, l'Association des parents des victimes a été constituée et depuis lors, on n'a cessé de lutter pour obtenir justice.

  17. La legge 154/2001 in tema di "Misure contro la violenza nelle relazioni familiari": cosa è cambiato nel nostro Paese dopo la sua entrata in vigore?

    Directory of Open Access Journals (Sweden)

    Susanna Vezzadini

    2007-09-01

    Full Text Available Domestic violence is a crime. All international and national studies on this subject have contributed to uncovering part of it, shedding light on a very serious and dramatic reality. For that reason, in April 2001, the Italian Parliament passed the law n. 154 concerning “Measures against domestic violence”, therefore affirming in by this act its will to respond to the problem. The law, which is considered an example of a “normative act against the blackmail of fear”, consists of a series of guide lines to prevent the offender from repeating the crime. In view of this, it is essential to find out today what has actually changed in Italy six years after its coming into force. La violence intrafamiliale est un délit. Les études réalisées à l'échelle internationale, tout comme les études nationales, ont ouvert une brèche sur cette réalité dont la gravité est déconcertante. Cependant le Parlement italien a approuvé en avril 2001, la loi relative aux "Mesures contre la violence dans la famille", affirmant ainsi sa volonté de répondre concrètement au problème de la violence domestique en Italie. Cette loi, présentée par les législateurs comme un example "d'acte normatif contre le chantage de la peur", contient une série de provisions destinées à empêcher à l'offenseur de réitérer son crime, introduisant des instruments procéduraux contre les abus intrafamiliaux. Face à de telles innovations, il est d'autant plus utile de continuer à se demander ce qui a changé en Italie, six ans après l'entrée en viguer de la loi.

  18. In vitro hepatic microsomal metabolism of meloxicam in koalas (Phascolarctos cinereus), brushtail possums (Trichosurus vulpecula), ringtail possums (Pseudocheirus peregrinus), rats (Rattus norvegicus) and dogs (Canis lupus familiaris).

    Science.gov (United States)

    Kimble, B; Li, K M; Valtchev, P; Higgins, D P; Krockenberger, M B; Govendir, M

    2014-04-01

    Quantitative and qualitative aspects of in vitro metabolism of the non-steroidal anti-inflammatory drug meloxicam, mediated via hepatic microsomes of specialized foliage (Eucalyptus) eating marsupials (koalas and ringtail possums), a generalized foliage eating marsupial (brushtail possum), rats, and dogs, are described. Using a substrate depletion method, intrinsic hepatic clearance (in vitro Clint) was determined. Significantly, rates of oxidative transformation of meloxicam, likely mediated via cytochromes P450 (CYP), were higher in marsupials compared to rats or dogs. The rank order of apparent in vitro Clint was brushtail possums (n=3) (mean: 394μL/min/mg protein), >koalas (n=6) (50), >ringtail possums (n=2) (36) (with no significant difference between koalas and ringtail possums), >pooled rats (3.2)>pooled dogs (in which the rate of depletion, as calculated by the ratio of the substrate remaining was meloxicam, at a first-order rate constant, 5-hydroxymethyl metabolite (M1) was identified in the brushtail possums and the rat as the major metabolite. However, multiple hydroxyl metabolites were observed in the koala (M1, M2, and M3) and the ringtail possum (M1 and M3) indicating that these specialized foliage-eating marsupials have diverse oxidation capacity to metabolize meloxicam. Using a well-stirred model, the apparent in vitro Clint of meloxicam for koalas and the rat was further scaled to compare with published in vivo Cl. The closest in vivo Cl prediction from in vitro data of koalas was demonstrated with scaled hepatic Cl(total) (average fold error=1.9) excluding unbound fractions in the blood and microsome values; whereas for rats, the in-vitro scaled hepatic Cl fu(blood, mic), corrected with unbound fractions in the blood and microsome values, provided the best prediction (fold error=1.86). This study indicates that eutherians such as rats or dogs serve as inadequate models for dosage extrapolation of this drug to marsupials due to differences in hepatic turnover rate. Furthermore, as in vivo Cl is one of the pharmacokinetic indexes for determining therapeutic drug dosages, this study demonstrates the utility of in vitro to in vivo scaling as an alternative prediction method of drug Cl in koalas.

  19. ATIVIDADE ANTIMICROBIANA DO MEL DE ABELHAS JATAÍ (Tetragonisca angustula EM CULTIVO DE MICRORGANISMOS DO CONDUTO AUDITIVO DE CANINOS DOMÉSTICOS (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Denise de Mello Bobany

    2010-06-01

    Full Text Available The present work aimed to investigate, in vitro, the efficacyof the honey of Tetragonisca angustula, against the microorganismsfound in the auditory canal inflammations of dogs. The sampleswere collected through a sterile swab of secretion of the auditorycanal of dogs with clinical otitis. The material was fixed in glassslide by performing the smear, Gram stained, and submittedto microscopic identification. The samples were inoculated inTryptone Soya Broth culture media and incubated at 37°C for24 hours. After verifying that there was growth, the sampleswere cultured in Petri’s plates containing Chapman, Levine andMueller-Hinton, and incubated at 37°C for 24 hours. Filter paperdiscs were adapted, sterilized in autoclave and embedded in honeyfor the antibiogram. The disks impregnated with honey wereplaced in Petri’s plates containing the contamined material andagain incubated at 37°C for 24 hours. This experiment verified theformation of inhibition halos in the antibiograma with the honey ofthe Tetragonisca angustula, showing to be effective in the controlof Staphylococcus sp, Bacillus sp and yeasts.

  20. A Review of Domestic Dogs' ("Canis Familiaris") Human-Like Behaviors: Or Why Behavior Analysts Should Stop Worrying and Love Their Dogs

    Science.gov (United States)

    Udell, Monique A. R.; Wynne, C. D. L.

    2008-01-01

    Dogs likely were the first animals to be domesticated and as such have shared a common environment with humans for over ten thousand years. Only recently, however, has this species' behavior been subject to scientific scrutiny. Most of this work has been inspired by research in human cognitive psychology and suggests that in many ways dogs are…

  1. When dogs look back: inhibition of independent problem-solving behaviour in domestic dogs (Canis lupus familiaris) compared with wolves (Canis lupus).

    Science.gov (United States)

    Udell, Monique A R

    2015-09-01

    Domestic dogs have been recognized for their social sensitivity and aptitude in human-guided tasks. For example, prior studies have demonstrated that dogs look to humans when confronted with an unsolvable task; an action often interpreted as soliciting necessary help. Conversely, wolves persist on such tasks. While dogs' 'looking back' behaviour has been used as an example of socio-cognitive advancement, an alternative explanation is that pet dogs show less persistence on independent tasks more generally. In this study, pet dogs, shelter dogs and wolves were given up to three opportunities to open a solvable puzzle box: when subjects were with a neutral human caretaker, alone and when encouraged by the human. Wolves were more persistent and more successful on this task than dogs, with 80% average success rate for wolves versus a 5% average success rate for dogs in both the human-in and alone conditions. Dogs showed increased contact with the puzzle box during the encouragement condition, but only a moderate increase in problem-solving success. Social sensitivity appears to play an important role in pet and shelter dogs' willingness to engage in problem-solving behaviour, which could suggest generalized dependence on, or deference to, human action.

  2. Distribución de los ectoparásitos de Canis lupus familiaris L. (Carnivora: Canidae) de Panamá

    OpenAIRE

    Bermúdez, Sergio; Miranda, Roberto

    2011-01-01

    Objetivo. Determinar la distribución de ectoparásitos de perros en Panamá. Materiales y métodos. Se examinaron 720 individuos en 57 comunidades. Resultados. Los resultados demostraron que el 84% de los perros presentaron al menos una especie de ectoparásito. Los perros de tierras bajas mostraron un mayor porcentaje de parasitismo y mayor biodiversidad de parásitos que los animales de tierras altas. Se encontraron siete especies de garrapatas, cuatro de pulgas, dos de piojos y una de mosca. La...

  3. Mira lo que te muestro: ¿Comunicación referencial entre perros domésticos (canis familiaris) y humanos?

    OpenAIRE

    2012-01-01

    Históricamente, la comunicación referencial fue considerada como exclusivamente humana. No obstante, recientemente se observó que los animales también pueden referirse hacia objetos externos. Para los perros domésticos, las personas proveen el acceso a los recursos valiosos, por lo que una adecuada comunicación con las mismas resulta fundamental. En este contexto, la comprensión y producción de señales comunicativas visuales cobran especial relevancia. Las evidencias revisadas indican que los...

  4. Mira lo que te muestro: ¿Comunicación referencial entre perros domésticos (canis familiaris y humanos?

    Directory of Open Access Journals (Sweden)

    ADRIANA JAKOVCEVIC

    2012-01-01

    Full Text Available Históricamente, la comunicación referencial fue considerada como exclusivamente humana. No obstante, recientemente se observó que los animales también pueden referirse hacia objetos externos. Para los perros domésticos, las personas proveen el acceso a los recursos valiosos, por lo que una adecuada comunicación con las mismas resulta fundamental. En este contexto, la comprensión y producción de señales comunicativas visuales cobran especial relevancia. Las evidencias revisadas indican que los perros detectan el estado atencional humano, siguen la orientación de la cabeza para hallar comida oculta y dirigen la atención del humano hacia un objeto fuera de su alcance, mediante la alternancia de la mirada. En función de ello, se sugiere que los perros se comunican de manera referencial con las personas. Sin embargo, esto no necesariamente implica que comprendan al otro como un agente intencional. Se discuten los posibles mecanismos involucrados así como las hipótesis acerca del origen de dichas capacidades.

  5. Trypanosoma caninum n. sp. (Protozoa: Kinetoplastida) isolated from intact skin of a domestic dog ( Canis familiaris) captured in Rio de Janeiro, Brazil.

    Science.gov (United States)

    Madeira, M F; Sousa, M A; Barros, J H S; Figueiredo, F B; Fagundes, A; Schubach, A; DE Paula, C C; Faissal, B N S; Fonseca, T S; Thoma, H K; Marzochi, M C A

    2009-04-01

    An unknown Trypanosoma species was isolated from an axenic culture of intact skin from a domestic dog captured in Rio de Janeiro, Brazil, which was co-infected with Leishmania (Viannia) braziliensis. Giemsa-stained smears of cultures grown in different media revealed the presence of epimastigotes, trypomastigotes, spheromastigotes, transitional stages, and dividing forms (epimastigotes or spheromastigotes). The highest frequency of trypomastigotes was observed in RPMI (15.2%) and DMEM (9.2%) media containing 5% FCS, with a mean length of these forms of 43.0 and 36.0 mum, respectively. Molecular analysis by sequential application of PCR assays indicated that this trypanosome differs from Trypanosoma cruzi and T. rangeli when specific primers were applied. On the other hand, a PCR strategy targeted to the D7 domain of 24salpha rDNA, using primers D75/D76, amplified products of about 250 bp in that isolate (stock A-27), different from the amplification products obtained with T. cruzi and T. rangeli. This organism differs from T. cruzi mainly by the size of its trypomastigote forms and kinetoplasts and the absence of infectivity for macrophages and triatomine bugs. It is also morphologically distinct from salivarian trypanosomes reported in Brazil. Isoenzyme analysis at 8 loci demonstrated a very peculiar banding pattern clearly distinct from those of T. rangeli and T. cruzi. We conclude that this isolate is a new Trypanosoma species. The name T. caninum is suggested.

  6. Síndrome de Kartagener em um cão (Canis lupus familiaris da raça Cocker Spaniel Inglês

    Directory of Open Access Journals (Sweden)

    P. Souza Junior

    2011-06-01

    Full Text Available Kartagener is syndrome is a rare disorder described in dogs determined by the triad situs inversus totalis, chronic sinusitis, and bronchial disease. The clinical signs of chronic respiratory and other less common presentations (such as hydrocephalus and subfertility are due to a concomitant ciliary dysfunction. This article describes the clinical, radiographic, and computed tomography findings and treatment in a dog affected by Kartagener is syndrome since early months of life. This is the first case report of this syndrome in a domestic dog in Brazil and the only known scientific report in the English Cocker Spaniel.

  7. Use of fibrin glue derived from snake venom in the repair of deep corneal ulcers: experimental study in dogs (Canis familiaris, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    R. L. Sampaio

    2007-01-01

    Full Text Available Fibrin glue has been researched as an alternative method for tissue synthesis and is known for its capability to promote hemostasis at the application site, good approximation of wound edges and fast healing. The current study consisted in the application of fibrin glue derived from snake venom as treatment for experimental corneal ulcers. Twenty-one dogs had their corneas experimentally prepared through lamellar keratectomy (of standardized diameter and depth. Animals were divided into seven groups of three animals each. Six experimental groups were periodically evaluated and collection was carried out on the 1st, 3rd, 7th, 15th, 30th and 60th post-operative days, whereas one control group was evaluated throughout the experiment. Analyses consisted in the clinical evolution and in the histopathological study of all operated on eyes. Results indicated that fibrin glue was efficient in repairing keratectomy wounds in dogs and contributed to an earlier healing phenomenon, avoiding edema formation and keeping corneal clearness. The use of fibrin glue derived from snake venom showed to be easy to apply, feasible with animal models and of low cost, avoiding the lesion progress and allowing fast and appropriate corneal healing.

  8. CREATINE PHOSPHOKINASE ISOENZYME-MB MASS (CK-MB MASS AND TROPONIN I (cTnI IN DOGS (Canis familiaris

    Directory of Open Access Journals (Sweden)

    Millena Vidal Freitas

    2015-07-01

    Full Text Available Cardiac markers, especially CK-MB mass and cTnI, have an essential role in both human and veterinary clinical and surgical cardiology, allowing a more precise and accurate diagnosis in myocardial lesions. The goal of this work was to measure these cardiac markers in veterinary medicine, improve their use and provide information about these laboratory methods that allow non-invasive health monitoring of the myocardial cell. Parameters quantification was obtained from sera of healthy dogs examined during routine procedures at the Small Animal Veterinary Hospital of Universidade Estadual do Norte Fluminense Darcy Ribeiro. The human chemiluminescence essay turbo kit (IMMULITE Turbo, Siemens ® test proved to be effective in canine species for both CK-MB mass and cTnI. In addition, the values found for CK-MB will significantly contribute to clinical routine or experimental work with dogs.

  9. Estructuración y función del miocardio ventricular canino (Canis lupus familiaris): banda miocárdica ventricular

    OpenAIRE

    De Lavalle, Rodrigo; Rendón, Luis

    2015-01-01

    Introducción: actualmente se está presenciando la aparición de nuevas herramientas de diagnóstico y terapias para enfermedades del corazón, pero sin consenso científico serio sobre los interrogantes sobre la estructura normal del corazón y su función. La banda helicoidal miocárdica ventricular de Torrent-Guasp es el nuevo y revolucionario concepto en la comprensión global, en tres dimensiones de la arquitectura funcional del miocardio ventricular. Este concepto define la arquitectura de tejid...

  10. EFEITO AUXILIAR DO CERUMINOLÍTICO NA TERAPIA TÓPICA DE CÃES (Canis lupus familiaris COM OTITE EXTERNA CERUMINOSA

    Directory of Open Access Journals (Sweden)

    Eduardo Negri Mueller

    2013-03-01

    Full Text Available We evaluated the help effect of ceruminolytic in ceruminous external otitis in dog’s ears. Dogs with bilateral ceruminous external otitis, whose ears were evaluated by palpation, inspection, otoscopy and fungal and bacterial culture were studied. For the treatment, carried out twice a day during 15 days, the animals were divided into two groups, A and B. The animals in group A were treated with ceruminolytic and otological solution, containing, respectively, salicylic acid and aminoglycoside, while the animals in group B were treated only with otological solution. Clinical and microbiologic evaluations were performed on 0 and 15 days of treatment. Twenty dogs (n=40 ears, with at least erythema in the otoscopy and moderate to intense ceruminous exsudate. Besides these, we observed more erythema (n=16 in both groups and exsudate in the acoustic conch (n=14 and n=11, respectively, groups A and B and itch (n=13 and n=11, respectively, groups A and B. On the 15th day, we observed reduction of all clinical signals, except stenosis, which did not change in any of the groups, and pain, which increased in group A. The microorganisms Malassezia pachydermatis e Staphylococcus sp. reduced in treatment B with statistical significance. Bacteria were more sensitive to gentamicin. The use of ceruminolytic associated to otological solution reduced the external ottis clinical signals, mainly exsudate and smell in the acoustic conch and the quantity of cerumen in the otoscopy, without interfering in the microorganisms reduction.

  11. Decreased erytrocyte osmotic fragility during canine leptospirosis Diminuição da fragilidade osmótica eritrocitária na leptospirose canina

    Directory of Open Access Journals (Sweden)

    Marcelo L. Santoro

    1994-02-01

    Full Text Available Erythrocyte osmotic fragility (EOF was carried out in nineteen dogs naturally infected by Leptospira interrogans serovar icterohaemorrhagiae/copenhagi. A decreased EOF was observed, suggesting a modification of erythrocyte components secondary to disturbances that occur during canine leptospirosis, such as renal damage and hepatic disease.A fragilidade osmótica eritrocitária foi estudada em dezenove cães infectados naturalmente pela Leptospira interrogans serovar icterohaemorrhagiae/copenhagi. Observou-se uma redução da fragilidade osmótica eritrocitária, sem a presença de anemia, possivelmente relacionada aos distúrbios hepato-renais que ocorrem nesta patologia.

  12. Hepatozoonose canina: achados clínico-epidemiológicos em três casos Canine hepatozoonosis: clinic-epidemiological data in three cases

    Directory of Open Access Journals (Sweden)

    D.M. Aguiar

    2004-06-01

    Full Text Available Clinic-epidemiological data in canine infection by Hepatozoon canis were reported. Apatia, anorexia, prostaction, weight loss and muscle pain were the most-common clinical recognized signs. Blood smear was used as diagnosis method for the detection of H. canis gamonts in the neutrophils. Anaemia, leucocytosis, monocytosis and lymphopenia were observed in the haematological exams. Imidocarb dipropionate associated with tetracyclines and sulfamethoxasole-trimethoprim were used in therapy.

  13. AISLAMIENTO, CARACTERIZACIÓN Y POTENCIAL DE DIFERENCIACIÓN DE CÉLULAS MADRE MESENQUIMALES CANINAS DERIVADAS DE TEJIDO ADIPOSO

    Directory of Open Access Journals (Sweden)

    N. B. Riaño

    2014-01-01

    Full Text Available Se caracterizaron células obtenidas del tejido adiposo subcutáneo de caninos para demostrar su naturaleza de células madre mesenquimales (ad-MSCs. Las células se cultivaron y expan - dieron bajo condiciones in vitro . Se determinó la presencia de marcadores de superficie CD73, CD90 y CD105 por citometría de flujo y PCR en tiempo real, siendo idéntico el perfil de expresión obtenido al reportado en células madre mesenquimales humanas. Se demostró su potencial de diferenciación mediante análisis de expresión génica por PCR en tiempo real luego de inducirlas a procesos de diferenciación osteogénica y adipogénica. La capacidad de diferenciación osteogénica se evidenció a través de la expresión de genes de tejido óseo (colágeno tipo I y osteonectina en una cinética de expresión concordante con los eventos moleculares y celulares del desarrollo óseo in vivo . El potencial adipogénico se evaluó por la formación de vacuolas lipídicas intracelulares y la expresión del gen de lipoprotein-lipasa, acorde con el proceso in vivo . Se concluye que las células mesenquimales obtenidas del tejido adiposo de caninos cumplen los criterios morfológicos, de expresión de marcadores de superficie espe - cíficos y de capacidad de diferenciación mesodérmica, confirmando su naturaleza de células madre mesenquimales. Los resultados del presente trabajo indicaron que las ad-MSCs de los caninos son un excelente modelo preclínico para el desarrollo de aplicaciones en medicina regenerativa, tanto en medicina veterinaria, como en medicina humana.

  14. Uso de cetoanálogo na terapia da insuficiência renal canina Use of keto analogues in therapy of the renal failure in dogs

    Directory of Open Access Journals (Sweden)

    J.C.C. Veado

    2002-10-01

    Full Text Available The efficacy of keto acids and essential amino acids on a two-year-old female dog, Labrador, suffering from Leishmaniasis and acute renal failure was evaluated by clinical and laboratorial analyses based on urea and creatinine dosages. An improving in the animal general condition and an increasing in the appetite, activity and weight gain, were observed and favorably contributed to the treatment of the primary disease. Ketoanalogueswere oraly administered during 76 days and the levels of urea and creatinine remained within acceptable limits, even after this period of time. Ketoanaloguescontributed positively for the treatment of acute renal failure and appears to be an important alternative for the leishmaniasis treatment.

  15. Anticuerpos monoclonales específicos de inmunoglobulina G canina: caracterización y aplicación en inmunoensayos

    OpenAIRE

    2011-01-01

    En este trabajo se ha conseguido aislar la IgG+IgM de perro a partir de sueros de animales sanos y enfermos, considerado de gran interés dada la escasez de este tipo de reactivos en el mercado y de la importancia de los estudios inmunologicos en las especies de interes veterinario. A partir de la IgG comercial se ha producido y posteriormente caracterizado un panel de seis anticuerpos (CA2E9, CA3B8, CA3H1, CA4E7, CA4F1, CA5B2) frente a dicha inmunogloblulina. Dada la reaccion cruzada de los a...

  16. Aspectos sorológicos e epidemiológicos da leishmaniose tegumentar americana canina em Maricá, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Uchôa Claudia Maria Antunes

    2001-01-01

    Full Text Available Foram estudados 261 cães (134 moradias do Município de Maricá, RJ, Brasil, visando avaliar a resposta sorológica e infecção ativa para leishmaniose tegumentar americana (LTA. Oito cães apresentaram lesões sugestivas, sendo o isolamento positivo em 3. Pelo ELISA, 24,5% (64/261 apresentaram reatividade (sensibilidade = 66% e especificidade = 76%, estando associado ao isolamento em 2 e 0,4% (1/261 pela imunofluorescência indireta (RIFI sem associação com isolamento. Para a redução de reações inespecíficas no ELISA, utilizou-se um segundo critério para obtenção do cutoff (sensibilidade = 33% e especificidade = 93%, obtendo positividade de 6,9% (18/261 associando-se ao isolamento em um animal. Sete pessoas apresentaram cicatrizes de LTA e uma lesão ativa em tratamento. A não associação da infecção ativa dos cães à sorologia pela IFI e o grande número de resultados inespecíficos encontrado pelo ELISA, restringe o uso isolado destas no diagnóstico precoce da LTA. O encontro de lesões ativas confirma a circulação recente da Leishmania em Maricá, indicando a necessidade de estudos nesta região.

  17. The effectiveness of a standardized rose hip powder, containing seeds and Shells of Rosa canina, on cell longevity, skin wrinkles, moisture, and elasticity 

    DEFF Research Database (Denmark)

    Phetcharat, L; Wongsuphasawat, K; Winther, Kaj

    2015-01-01

    Objective: To evaluate the effects of a rose hip powder (Hyben Vital®) made from seeds and shells on cell senescence, skin wrinkling, and aging. Methods: A total of 34 healthy subjects, aged 35–65 years, with wrinkles on the face (crow’s-feet) were subjected to a randomized and double......-blinded clinical study of the effects of the rose hip powder, as compared to astaxanthin, a well-known remedy against wrinkles. During the 8-week study, half of the participants ingested the standardized rose hip product, while the other half ingested astaxanthin. Objective measurements of facial wrinkles, skin...... in crow’s-feet wrinkles (P,0.05), skin moisture (P,0.05), and elasticity (P,0.05) after 8 weeks of treatment. A similar improvement was observed for astaxanthin, with P-values 0.05, 0.001, and 0.05. Likewise, both groups expressed equal satisfaction with the results obtained in their self...

  18. Abordagem do doente neurológico e localização de lesões neurológicas na espécie canina

    OpenAIRE

    Gradil, Ana Maria Meireles

    2009-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A integridade do sistema nervoso pode ser avaliada através de um exame neurológico completo, realizado com o intuito de averiguar se o sistema nervoso se encontra afectado num animal com um quadro sintomatológico suspeito. O contributo do exame neurológico completo na dedução fiável da localização de lesões neurológicas em doentes caninos é possível tendo como base o conhecimento da anatomia do sistema nervoso e da sua ...

  19. Características epidemiológicas da leishmaniose tegumentar americana em uma região endêmica do Estado da Bahia: II leishmaniose canina

    Directory of Open Access Journals (Sweden)

    Air C. Barretto

    1984-06-01

    Full Text Available Um inquérito em cães realizado na região de Três Braços, Bahia, mostrou que 3,0% de 98 animais tinham amastigotas em lesões de pele. Parasitos não foram encontrados em pele normal da orelha. De uma amostra selecionada de 13 cães, portadores de lesão cutânea ativa, nove (69,2% deles estavam comprovadamente infectados. Sete amostras de lesão produziram infecção em hamsters. O estudo biológico (crescimento em meio de cultura, evolução da lesão em hamster e desenvolvimento no tubo digestivo de Lutzomyia longipalpis identificou o parasito como pertencente ao complexo L. braziliensis. A caracterização bioquímica (mobilidade eletroforética de enzimas em placas de acetato de celulose e o estudo imunotaxonômico (anticorpos monoclonais definiram as amostras como L. braziliensis braziliensis. O papel do cão como um possível reservatório de L. b. braziliensis na região de Três Braços é discutido.

  20. The effectiveness of a standardized rose hip powder, containing seeds and Shells of Rosa canina, on cell longevity, skin wrinkles, moisture, and elasticity 

    DEFF Research Database (Denmark)

    Phetcharat, L; Wongsuphasawat, K; Winther, Kaj

    2015-01-01

    longevity was measured in terms of leakage of hemoglobin through red cell membranes (hemolytic index) in blood samples kept in a blood bank for 5 weeks. Significance of all values was attained with P#0.05. Results: In the double-blinded study, the rose hip group showed statistically significant improvements......-assessment. The rose hip powder further resulted in increased cell longevity of erythrocyte cells during storage for 5 weeks in a blood bank. Conclusion: Results suggest that intake of the standardized rose hip powder (Hyben Vital®) improves aging-induced skin conditions. The apparent stabilizing effects of the rose...

  1. Estágio em clínica de animais de companhia: síndrome de disfunção cognitiva canina

    OpenAIRE

    Diesing, Ulla

    2014-01-01

    Este estágio foi realizado em clínica de animais de companhia. Observou e acompanhou-se tanto consultas com carácter preventivo como de clínica médica e cirúrgica. As consultas de medicina preventiva consistiram essencialmente em vacinações e desparasitações, enquanto outras foram meramente informativas. As consultas de clínica médica incidiram em diversas áreas, incluíndo dermatologia, gastroenterologia e cardiologia. As cirurgias efetuadas foram sobretudo eletivas, mas também...

  2. Leishmaniose visceral canina: avaliação da metodologia sorológica utilizada em inquéritos epidemiológicos

    Directory of Open Access Journals (Sweden)

    Carlos A. da Costa

    1991-03-01

    Full Text Available Foi realizado um estudo comparativo da reação de imunofluorescência indireta em eluatos de sangue de cães infectados experimentalmente com diferentes tripanosomatídeos. Utilizaram-se como antigenopromastigotas de L. mexicana, L. braziliensis e L. chagasi. Os resultados mostraram que a sensibilidade do método foi de 87,5% para o diagnóstico do calazar canino, independentemente do antigeno empregado; e que ocorre reação cruzada com Leishmaniose tegumentar em 75% dos casos e com doença de Chagas em 83,3%. Levantamento epidemiológico em área de leishmaniose confirma que a reação de imunofluorescência em eluatos de sangue canino fornece reações cruzadas em cães infectados com Leishmania braziliensis e L. chagasi. Não se verificou reação cruzada pela RFC. Sugere-se a utilização da reação de imunofluorescência nas campanhas de saúde pública, mas é de se chamar a atenção para o fato de que as taxas de positividade não devem ser utilizadas como indicadores da prevalência do calazar canino.A comparative study was made of eluates of the blood of dogs experimentally infected with different trypanosomatids. Using antigens prepared from promastigotes of Leishmania mexicana, L. braziliensis and L. chagasi, assessments were made by the indirect immunofluorescence test. The results showed a sensitivity of 87,5% in the diagnosis of canine visceral leishmaniasis, independent of antigen used. Cross-reactions occurred in 75% of cases of cutaneous leishmaniasis and 83,3% of dogs with chagas' disease. An epidemiological survey in an area of leishmaniasis confirmed that immunofluorescence tests on eluates of dogs' blood give cross-reactions between L. braziliensis and L. chagasi. The results suggest that such testing could be useful in public health campaigns but attention is drawn to thefact that the level ofpositive reactions cannot be used as an indicator of the prevalence of canine kala-azar.

  3. Características epidemiológicas da leishmaniose tegumentar americana em uma região endêmica do Estado da Bahia: II leishmaniose canina

    Directory of Open Access Journals (Sweden)

    Air C. Barretto

    1984-06-01

    Full Text Available Um inquérito em cães realizado na região de Três Braços, Bahia, mostrou que 3,0% de 98 animais tinham amastigotas em lesões de pele. Parasitos não foram encontrados em pele normal da orelha. De uma amostra selecionada de 13 cães, portadores de lesão cutânea ativa, nove (69,2% deles estavam comprovadamente infectados. Sete amostras de lesão produziram infecção em hamsters. O estudo biológico (crescimento em meio de cultura, evolução da lesão em hamster e desenvolvimento no tubo digestivo de Lutzomyia longipalpis identificou o parasito como pertencente ao complexo L. braziliensis. A caracterização bioquímica (mobilidade eletroforética de enzimas em placas de acetato de celulose e o estudo imunotaxonômico (anticorpos monoclonais definiram as amostras como L. braziliensis braziliensis. O papel do cão como um possível reservatório de L. b. braziliensis na região de Três Braços é discutido.During a survey of domestic and hunting dogs conducted in the Três Braços region, State of Bahia, 3,0% of 98 dogs had amastigotes in skin lesions. Parasites were not found in normal ear skin. In a nonrandomly selected sample of 13 dogs with active cutaneous lesions, infection was confirmed in nine (69,2%. Tissue biopsies from seven dog lesions produced infection in hamsters. The biological behaviour of the parasite (rate of growth in culture media, evolution of lesions in hamsters and development in the gut of Lutzomyia longipalpis, identified it to the Leishmania braziliensis complex. Characterization by biochemical means (eletrophoretic mobility of enzymes in cellulose acetate plates and immunotaxonomic studies (monoclonal antibodies defined the strains as L. braziliensis braziliensis. The role of dogs as a possible reservoir host of L. b. braziliensis in Três Braços region is discussed.

  4. Obesidad canina: repercusiones clínicas y factores relacionados (presión arterial y parámetros metabólicos)

    OpenAIRE

    Peña Romera, Cristina

    2015-01-01

    Programa de Doctorado en Clínica e Investigación Terapéutica [ES]En esta tesis hemos estudiado las repercusiones analíticas y clínicas asociadas a la sobrecarga ponderal, así como evaluado los efectos de un programa de pérdida de peso en perros obesos, tratados con mitratapida y una dieta alta en fibra seca y el impacto sobre la presión arterial y algunos parámetros metabólicos [aminotransferasa de alanina (ALT), fosfatasa alcalina (ALP), co...

  5. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    OpenAIRE

    1999-01-01

    OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un ani...

  6. Mosquitos vetores potenciais de dirofilariose canina na Região Nordeste do Brasil Mosquitoes potential vectors of canine heartworm in the Northeast Region from Brazil

    Directory of Open Access Journals (Sweden)

    Silvia MM Ahid

    1999-12-01

    Full Text Available INTRODUÇÃO: Em alguns bairros costeiros de São Luís, Maranhão, a prevalência da dirofilariose chega a mais de 40% entre os cães domiciliados. Porém, desconhecem-se os vetores naturais, tanto lá quanto no resto do Nordeste do país. O objetivo do estudo foi identificar os prováveis vetores dessa parasitose. MÉTODOS: Realizaram-se coletas mensais de mosquitos em um bairro costeiro de São Luís, MA, de março de 1996 a maio de 1997, no peridomicílio, tendo cão e homem como iscas. Os mosquitos foram dissecados para a pesquisa de larvas da Dirofilaria immitis. RESULTADOS: Coletaram-se 1.738 mosquitos de 11 espécies. Culex quinquefasciatus, capturada todos os meses, porém menos freqüente na estação chuvosa, correspondeu a 54,5% do total, seguido de Aedes albopictus (20,3%, Aedes taeniorhynchus e Aedes scapularis (ambos 11%. Larvas de D.immitis foram encontradas em 0,1% dos Cx. quinquefasciatus e 0,5% dos Ae. taeniorhynchus. CONCLUSÕES: Ae. taeniorhynchus e Cx. quinquefasciatus foram considerados vetores potenciais da dirofilariose em São Luís. A importância local de Cx. quinquefasciatus como transmissor primário da D. immitis necessita ser melhor avaliada.INTRODUCTION: In some coastal districts of São Luís, capital of the state of Maranhão, Brazil, the prevalence of Dirofilaria immitis is more than 40% in house dogs. Natural potential vectors, as found in other areas of Northeastern Brazil, are unknown. The aim of this study was to identify probable vectors of the disease. METHODS: Mosquito catches were performed at a coastal, district Olho d'Água, in S. Luís, to look for local potential vectors. Captures were carried out monthly, from March 1996 to May 1997, outdoors, having a man and a dog as baits. Mosquitoes were dissected for D. immitis larvae. RESULTS: A total of 1,738 mosquitoes belonging to 11 species were collected. Culex quinquefasciatus, the only species collected every month, was more frequently in the dry season. It accounted for 54.5% of the total, followed by Aedes albopictus (20.3%, Ae. scapularis (11% and Ae. taeniorhynchus (11%. D. immitis larvae were detected in 0.1% of the Cx. quinquefasciatus dissected (L3 in the Malpighian tubules and 0.5% of the Ae. taeniorhynchus (L2 in the Malpighian tubules. CONCLUSION: Ae. taeniorhynchus and Cx. quinquefasciatus are considered natural potential vectors of the canine heartworm in São Luís. The role of Cx. quinquefasciatus as primary vector of D. immitis, however, needs further evaluation.

  7. Retrospective study (1998-2001) on canine ehrlichiosis in Belo Horizonte, MG, Brazil Estudo retrospectivo (1998 a 2001) da erliquiose canina em Belo Horizonte

    OpenAIRE

    S.M. Moreira; C.V. Bastos; R.B. Araújo; Santos,M.; L.M.F. Passos

    2003-01-01

    The present work describes a retrospective study of clinical cases of ehrlichiosis in dogs examined from March 1998 to September 2001. From the clinical records with laboratorial confirmation of Ehrlichia canis or E. platys infections, the following parameters were analyzed: demographic aspects (age, race, sex, period of the year and origin), clinical characteristics (body temperature, exposure to ticks and clinical signs), and hematological characteristics (blood cell counts and type of infe...

  8. Characteristics of rose hip (Rosa canina L.) cold-pressed oil and its oxidative stability studied by the differential scanning calorimetry method.

    Science.gov (United States)

    Grajzer, Magdalena; Prescha, Anna; Korzonek, Katarzyna; Wojakowska, Anna; Dziadas, Mariusz; Kulma, Anna; Grajeta, Halina

    2015-12-01

    Two new commercially available high linolenic oils, pressed at low temperature from rose hip seeds, were characterised for their composition, quality and DPPH radical scavenging activity. The oxidative stability of oils was assessed using differential scanning calorimetry (DSC). Phytosterols, tocopherols and carotenoids contents were up to 6485.4; 1124.7; and 107.7 mg/kg, respectively. Phenolic compounds determined for the first time in rose hip oil totalled up to 783.55 μg/kg, with a predominant presence of p-coumaric acid methyl ester. Antiradical activity of the oils reached up to 3.00 mM/kg TEAC. The acid, peroxide and p-anisidine values as well as iron and copper contents indicated good quality of the oils. Relatively high protection against oxidative stress in the oils seemed to be a result of their high antioxidant capacity and the level of unsaturation of fatty acids.

  9. Reconstrução do ligamento cruzado cranial em animais da espécie canina / Reconstruction of cranial cruciate ligament in animals of canine species

    Directory of Open Access Journals (Sweden)

    Luciana Dalazen dos Santos

    2013-01-01

    Full Text Available A ruptura do ligamento cruzado cranial (RLCC é uma lesão que ocorre com frequência em cães e gatos e pode ser dividida em agudas, relacionadas a traumatismos; crônicas, relacionadas a processos degenerativos; e ainda ruptura completa ou parcial. A ruptura ligamentar traumática leva os cães a demonstrarem gravemente claudicantes e após três a cinco semanas a claudicação mostra-se leve a moderada. Na afecção crônica, a claudicação é intermitente e exacerbada pela atividade física. O diagnóstico é obtido com a realização do teste de gaveta cranial e o teste de compressão tibial. Para o tratamento, são propostas as terapias conservadora e a cirúrgica, sendo a última composta por mais de quarenta técnicas. São utilizados três métodos cirúrgicos na restauração da estabilidade numa articulação apresentando RLCC: (1 técnicas de sutura para laceração da substância intermediária, ou a fixação das lesões por avulsão óssea por meio da aplicação de faixas de tensão; (2 substituição ou reconstrução do ligamento, mediante o uso de materiais diversos, classificadas como métodos intra-articulares ou intracapsulares; (3 transposição de estruturas periarticulares ou a aplicação de materiais de sutura externamente à articulação, classificados como extra-articulares ou extracapsulares.

  10. Orientação sobre posse responsável em uma área endêmica para leishmaniose visceral canina

    OpenAIRE

    Matos,Lucas Vinicius Shigaki de; Teixeira, Weslen Fabrício Pires [UNESP; Bregadioli, Thales [UNESP; Aquino, Monally Conceição Costa [UNESP; Viol, Milena Araúz [UNESP; Bresciani,Katia Denise Saraiva

    2012-01-01

    The purpose of this work was to provide guidance to householders in the responsible care of their pets, in a region where canine visceral leishmaniasis is endemic. Questionnaires on responsible ownership and the control of this disease were completed by owners of dogs and cats in the city of Araçatuba, São Paulo State, Brazil, in order to evaluate their level of knowledge. Based on the identified deficiencies, the project team provided the owners of the pets with individual guidance at home, ...

  11. Análise comparativa do teste imunocromatográfico DPP-Biomanguinhos com ELISA e RIFI no diagnóstico da leishmaniose visceral canina

    OpenAIRE

    Marcos Vinicius de Santana Leandro Junior

    2014-01-01

    Com o objetivo de avaliar o desempenho do teste rápido DPP® LVC comparando com os testes de ELISA e RIFI (Bio-Manguinhos, Br), assim como ELISA e RIFI in-house, empregando como antígeno formas promastigotas de L. (L.) infantum chagasi, com ênfase a reatividade cruzada com outros agentes infecciosos, soros de cães infectados por L. (L.) infantum chagasi, clinicamente sintomáticos (n=48) e assintomáticos (n=39), assim como soros de cães sadios e não infectados (n=18), e soros de cães infectados...

  12. Leishmaniose visceral canina: avaliação da metodologia sorológica utilizada em inquéritos epidemiológicos

    Directory of Open Access Journals (Sweden)

    Carlos A. da Costa

    1991-03-01

    Full Text Available Foi realizado um estudo comparativo da reação de imunofluorescência indireta em eluatos de sangue de cães infectados experimentalmente com diferentes tripanosomatídeos. Utilizaram-se como antigenopromastigotas de L. mexicana, L. braziliensis e L. chagasi. Os resultados mostraram que a sensibilidade do método foi de 87,5% para o diagnóstico do calazar canino, independentemente do antigeno empregado; e que ocorre reação cruzada com Leishmaniose tegumentar em 75% dos casos e com doença de Chagas em 83,3%. Levantamento epidemiológico em área de leishmaniose confirma que a reação de imunofluorescência em eluatos de sangue canino fornece reações cruzadas em cães infectados com Leishmania braziliensis e L. chagasi. Não se verificou reação cruzada pela RFC. Sugere-se a utilização da reação de imunofluorescência nas campanhas de saúde pública, mas é de se chamar a atenção para o fato de que as taxas de positividade não devem ser utilizadas como indicadores da prevalência do calazar canino.

  13. Incontinência urinária após gonadectomia em fêmeas caninas Urinary incontinence after gonadectomy in female dogs

    Directory of Open Access Journals (Sweden)

    Fabiana Azevedo Voorwald

    2010-03-01

    Full Text Available A incontinência urinária adquirida é uma condição debilitante e, muitas vezes, incurável que acomete fêmeas castradas e raramente fêmeas inteiras ou machos. A manifestação clínica pode ocorrer em qualquer momento após a gonadectomia e resulta em graves problemas no manejo do paciente. Os mecanismos que desencadeiam a incontinência após ovariectomia envolvem decréscimo na pressão de fechamento uretral, alterações hormonais, aumento na deposição de colágeno na musculatura lisa da bexiga, diminuição na contratilidade do músculo detrusor e redução na resposta aos estímulos elétricos e ao carbachol. O diagnóstico é realizado pelo histórico do animal, pelo exame físico, pelos exames laboratoriais, pelo perfil de pressão uretral, pela ultrassonografia e pelas radiografias abdominais. O tratamento clínico envolve utilização de fármacos -adrenérgicos, estrógenos, análogos de GnRH e agentes antidepressivos. As técnicas cirúrgicas recomendadas correspondem à uretropexia, cistouretropexia, aplicação de colágeno na uretra e colpossuspensão. Melhor compreensão da etiologia, da fisiopatologia, dos métodos de diagnóstico e tratamentos é fundamental em razão do pouco conhecimento e da identificação dessa condição no Brasil.Acquired urinary incontinence is a debilitating, incurable condition, prevalent in spayed bitches and rarely seen in entire bitches or males. In bitches, acquired urinary incontinence can occur anytime from one week after neutering and is associated with severe management problems. Incontinence in neutered bitches can be associated with a decrease in maximal urethral closure pressure, hormonal changes and increase in the percentage of collagen in the bladder wall. It's also associated to a reduced contractility of the detrusor muscle, decrease in the magnitude of response of the bladder wall to both carbachol and eletrical field stimulation, and there are risk factors involved. The diagnosis is established based on historical findings, physical examination, laboratorial exams, urethral pressure profilometry, ultrasonography and abdominal radiographs. The medical management involves the appliance of -adrenergics agonists, oestrogens, GnRH analogues and antidepressive agents. Surgical recommendation management corresponds to urethropexy, cistourethropexy, endoscopic periurethral injection and colposuspension. The better understanding A better comprehension of etiology, physiopathology, diagnosis methods and treatment could provide significant benefits considering the lack of knowledge and diagnoses of this clinical condition in Brazil.

  14. The effectiveness of a standardized rose hip powder, containing seeds and shells of Rosa canina, on cell longevity, skin wrinkles, moisture, and elasticity

    Directory of Open Access Journals (Sweden)

    Phetcharat L

    2015-11-01

    Full Text Available L Phetcharat,1,2 K Wongsuphasawat,1,2 K Winther31School of Antiaging and Regenerative Medicine, Mae Fah University, Bangkok, Thailand; 2Department of Anti-aging and Regenerative Medicine, Mae Fah University, Bangkok, Thailand; 3Institute for Nutrition, Exercise and Sports, University of Copenhagen, Frederiksberg C, DenmarkObjective: To evaluate the effects of a rose hip powder (Hyben Vital® made from seeds and shells on cell senescence, skin wrinkling, and aging.Methods: A total of 34 healthy subjects, aged 35–65 years, with wrinkles on the face (crow’s-feet were subjected to a randomized and double-blinded clinical study of the effects of the rose hip powder, as compared to astaxanthin, a well-known remedy against wrinkles. During the 8-week study, half of the participants ingested the standardized rose hip product, while the other half ingested astaxanthin. Objective measurements of facial wrinkles, skin moisture, and elasticity were made by using Visioscan, Corneometer, and Cutometer at the beginning of the study, after 4 weeks, and after 8 weeks. Evaluation of participant satisfaction of both supplements was assessed using questionnaires. In addition, the effect of the rose hip preparation on cell longevity was measured in terms of leakage of hemoglobin through red cell membranes (hemolytic index in blood samples kept in a blood bank for 5 weeks. Significance of all values was attained with P≤0.05.Results: In the double-blinded study, the rose hip group showed statistically significant improvements in crow’s-feet wrinkles (P<0.05, skin moisture (P<0.05, and elasticity (P<0.05 after 8 weeks of treatment. A similar improvement was observed for astaxanthin, with P-values 0.05, 0.001, and 0.05. Likewise, both groups expressed equal satisfaction with the results obtained in their self-assessment. The rose hip powder further resulted in increased cell longevity of erythrocyte cells during storage for 5 weeks in a blood bank.Conclusion: Results suggest that intake of the standardized rose hip powder (Hyben Vital® improves aging-induced skin conditions. The apparent stabilizing effects of the rose hip product on cell membranes of stored erythrocyte cells observed in this study may contribute to improve the cell longevity and obstructing skin aging.Keywords: rose hip seed and shell powder, cell longevity, wrinkles, aging skin, moisture, elasticity

  15. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    Directory of Open Access Journals (Sweden)

    Zuñiga-A Ismael

    1999-01-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfológica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P < 0,05; la cantidad de alfa globulinas fue mayor en el grupo infectado (P < 0,05. CONCLUSIONES: Los resultados permiten confirmar el ciclo perro-cerdo y una infección subclínica en los huéspedes definitivos, lo que dificulta su diagnóstico y control en una especie intimamente relacionada con el hombre.

  16. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México

    Directory of Open Access Journals (Sweden)

    Ismael Zuñiga-A

    1999-06-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfológica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P < 0,05; la cantidad de alfa globulinas fue mayor en el grupo infectado (P < 0,05. CONCLUSIONES: Los resultados permiten confirmar el ciclo perro-cerdo y una infección subclínica en los huéspedes definitivos, lo que dificulta su diagnóstico y control en una especie intimamente relacionada con el hombre.

  17. Impacto do maneio clínico da Diabetes mellitus canina e felina na qualidade de vida do cuidador e do paciente

    OpenAIRE

    Carreira, Juliana Rodrigues

    2016-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A Diabetes mellitus é uma afeção crónica caracterizada por hiperglicémia persistente, cujos mecanismos fisiopatológicos, ainda não totalmente esclarecidos, serão diferentes em cães e gatos, razão provável para que nos últimos seja possível alcançar o estado de remissão quando o diagnóstico, a terapêutica e a monitorização são implementados precocemente. Independentemente da espécie, o tratamento passa sempre pela administração de in...

  18. Dicty_cDB: Contig-U06379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 47RE5.T0 BedlingtonTerrier Canis familiari... 46 0.65 1 ( BV258716 ) S235P6265FH5.T0 ItalianGreyhound Canis ...familiaris... 46 0.65 1 ( BV258272 ) S235P6198FF7.T0 ItalianGreyhound Canis famil...iaris... 46 0.65 1 ( BV255857 ) S235P6319RD12.T0 ItalianGreyhound Canis familiari... 46 0.65 1 ( CU467494 )

  19. NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...

  1. NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  3. NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...

  7. NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...

  8. Estudo comparativo entre toracotomia intercostal, esternotomia mediana parcial e total em cães sadios (Canis familiaris : avaliação clínica e hemogasométrica Comparative study among intercostal thoracotomy, parcial median sternotomy and total in health dogs (Canis familiaris: clinical and hemogasometric avaliation

    Directory of Open Access Journals (Sweden)

    Marcus Paulo de Souza Ferreira Pinto

    2000-12-01

    Full Text Available O objetivo deste experimento foi comparar as alterações hemogasométricas e as possíveis complicações trans e pós-operatórias encontradas na toracotomia intercostal direita, esternotomia mediana parcial e esternotomia mediana total, determinando qual das técnicas produziu menor grau de intercorrências. Foram utilizados dezoito cães, sem raça definida, adultos, machos e fêmeas, com peso entre quinze e vinte quilos e em condições de saúde julgadas satisfatórias para o experimento. Os cães foram divididos em três grupos de seis animais, de acordo com a técnica cirúrgica empregada: GRUPO A -animais submetidos à toracotomia intercostal direita; GRUPO B - animais submetidos à esternotomia mediana parcial e GRUPO C - animais submetidos à esternotomia mediana total. Os cães foram avaliados quanto às possíveis intercorrências intra e pós-operatórias, alterações das freqüências cardíaca e respiratória, temperatura, oxigenação, ventilação, equilíbrio ácido-básico e dor. Durante sete dias foi feita avaliação da ferida cirúrgica, não observando-se intercorrências com cicatrização, infecção, presença de fístulas e deiscência de sutura. Os resultados obtidos foram analisados estatisticamente. Concluiu-se que as três técnicas foram exeqüíveis em cães, pois permitiram recuperação pós-operatória satisfatória e comparativamente não foram verificadas alterações significativas quanto ao pH, gases sangüíneos e dor.The experiment’s objective was to compare hemogasometric changes and possible complications during and after Right Intercostal Thoracotomy, Partial Median Sternotomy and Total Median Sternotomy; determining which technique(s would produce less problems. Eighteen dogs were used, without any breeding, all adults, males and females, weighting between fifteen and twenty kilos and with health judged satisfactory for the experiment. The dogs were divided in three groups of six, according to the operative technique established: GROUP A - animals submitted to right intercostal thoracotomy; GROUP B - animals submitted to partial median sternotomy and GROUP C - animals submitted to total median sternotomy. Complications trans and postoperative, cardiac frequency, respiratory frequency, temperature, oxygenation, ventilation, acid-basic status, fistula presence and suture dehiscence were explored. As result the three techniques were available, because allowed satisfactory postoperative recuperation. Comparatively it didn’t have any important alteration of pH, blood gases and pain.

  9. Triplex Doppler da artéria renal e a relação entre a ecobiometria dos rins com distância atlanto-coccígea e altura em Canis familiaris Renal artery Triplex Doppler and the relationship between kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in Canis familiaris

    Directory of Open Access Journals (Sweden)

    Expedito Jr Matos Santana

    2009-10-01

    Full Text Available O objetivo do trabalho foi estabelecer a relação entre a ecobiometria renal com medidas de conformação corporal como a distância atlanto-coccígea (DAC e a altura (H de cães adultos saudáveis, obtendo-se parâmetros de normalidade para avaliar o tamanho e volume renal, bem como estabelecer valores de referência para avaliar a perfusão sanguínea dos rins por meio do índice de resistividade (IR e do índice de pulsatilidade (IP do ramo principal da artéria renal. No estudo foram utilizados 22 cães adultos sem raça definida, sendo 11 machos e 11 fêmeas. Os animais foram previamente aferidos quanto a DAC e a H. Os exames ultra-sonográficos foram realizados com um aparelho HDI 4000 PHILIPS munido de um transdutor microconvexo multifreqüêncial (5-8 MHz, dispositivos Doppler Colorido e Doppler de Fluxo. Os animais foram posicionados em decúbito lateral direito ou esquerdo, de acordo com o rim a ser avaliado. Os diâmetros longitudinal (DL e dorsoventral (DDV dos rins foram mensurados na secção longitudinal e, o diâmetro transversal (DT foi aferido no plano transversal. O volume (V foi calculado automaticamente pelo software do ultra-som. Com o uso do Triplex Doppler, o IR e o IP das artérias renais direita e esquerda foram obtidos. Todos os dados foram apresentados em média ± EPM. Análises de regressão linear foram realizadas tendo o DL, DDV, DT e V como variáveis dependentes e a DAC e H como variáveis independentes. Os IR e IP dos rins direito e esquerdo foram comparados pelo teste t de Student. A DAC variou de 54-78cm para machos e 37-71cm para fêmeas e a altura variou entre 34-64 cm para os machos e 24-57cm para as fêmeas. As médias obtidas para DL, DDV, DT e V dos rins esquerdo e direito foram: 5,24±0,27cm, 3,07±0,15cm, 3,07±0,9cm, 28,01±3,4mL e 4,50±0,19cm, 2,88±0,14cm, 2,71±0,15cm, 21,27±2,6mL, respectivamente. As análises de regressão linear entre as medidas lineares e volume renal com a DAC e a H foram significativas para os interceptos e coeficientes de regressão (PThe aim of this paper was to establish the relation between the kidney ecobiometry with atlanto-coccyges distance (ACD and height (H in adult healthy dogs, to obtain normality parameters for assessment of renal size and volume, as well as establish reference values to evaluate kidney blood perfusion by the resistivity index (RI and pulsatility index (PI of main renal artery. The study was applied at 22 adult dogs, 11 males and 11 females. Previously, the DAC and H of all animals were measured. For ultrasonographic examination, the ultra-sound system HDI 4000 PHILIPS equipped with a multi-frequency microconvex transducer, Color Doppler and Spectral Doppler devices was used. The animals were placed into right or left lateral decubitus position, in agreement with the kidney to be assessed. The longitudinal (LD and dorsoventral diameters (DVD of kidney were measured in longitudinal plane, and the transverse diameter (TD was determined in transversal section. The renal volume (V was automatically calculated by the ultrasound software. With Triplex Doppler, the RI and PI of right and left main renal arteries were obtained. All data were represented in mean ± SEM. Linear regression analyses were performed with renal LD, DVD, TD and V as dependent variable, and ACD and H as independent variable. RI and PI were compared between right and left renal arteries with Student's t-test. The LD, DVD, TD (cm and V (ml mean measurements for the left and right kidneys were: 5.24±0.27, 3.07±0.15, 3.07±0.9, 28.01±3.4 and 4.50±0.19, 2.88±0.14, 2.71±0.15, 21.27±2.6. All regression analyses were significant for the intercept and regression coefficient (P<0.01. There were statistical differences on RI and PI means between right and left renal arteries (P=0.001. The RI and PI means of left and right renal artery obtained were: 0.62±0.08 and 1.34±0.18; 0.70±0.06 and 1.62±0.13. The data obtained in the present paper can be used as parameters for evaluation of the renal size, volume and perfusion in adult dogs.

  10. Dicty_cDB: SHH577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0334758850 Dog Library Canis familiaris genomic,genomic survey sequence. 30 0.052... 3 CE699805 |CE699805.1 tigr-gss-dog-17000368830355 Dog Library Canis familiaris genomic, genomic survey seq...uence. 40 0.16 2 CE011802 |CE011802.1 tigr-gss-dog-17000321033562 Dog Library Canis familiaris genomic, genomic survey...og Library Canis familiaris genomic, genomic survey sequence. 46 0.59 1 CE427774 |CE427774.1 tigr-gss-dog-17...000362871784 Dog Library Canis familiaris genomic, genomic survey sequence. 30 1.5 3 CE637188 |CE637188.1 ti

  11. Dicty_cDB: VSE320 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available og Library Canis familiaris genomic, genomic survey sequence. 40 0.001 2 AC106112 |AC106112.6 Rattus norvegi...003 3 CE198350 |CE198350.1 tigr-gss-dog-17000372200949 Dog Library Canis familiaris genomic, genomic survey ...sequence. 50 0.005 1 CE120051 |CE120051.1 tigr-gss-dog-17000325900106 Dog Library Canis familiaris genomic, genomic survey...804 Dog Library Canis familiaris genomic, genomic survey sequence. 38 0.005 2 AC139061 |AC139061.3 Mus muscu... |CE001298.1 tigr-gss-dog-17000320774441 Dog Library Canis familiaris genomic, genomic survey

  12. Detection of Leishmania infantum in naturally infected Lutzomyia longipalpis (Diptera: Psychodidae: Phlebotominae) and Canis familiaris in Misiones, Argentina: the first report of a PCR-RFLP and sequencing-based confirmation assay.

    Science.gov (United States)

    Acardi, Soraya Alejandra; Liotta, Domingo Javier; Santini, María Soledad; Romagosa, Carlo Mariano; Salomón, Oscar Daniel

    2010-09-01

    In this study, a genotypification of Leishmania was performed using polimerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and sequencing techniques to identify species of Leishmania parasites in phlebotomine sand flies and dogs naturally infected. Between January-February of 2009, CDC light traps were used to collect insect samples from 13 capture sites in the municipality of Posadas, which is located in the province of Misiones of Argentina. Sand flies identified as Lutzomyia longipalpis were grouped into 28 separate pools for molecular biological analysis. Canine samples were taken from lymph node aspirates of two symptomatic stray animals that had been positively diagnosed with canine visceral leishmaniasis. One vector pool of 10 sand flies (1 out of the 28 pools tested) and both of the canine samples tested positively for Leishmania infantum by PCR and RFLP analysis. PCR products were confirmed by sequencing and showed a maximum identity with L. infantum. Given that infection was detected in one out of the 28 pools and that at least one infected insect was infected, it was possible to infer an infection rate at least of 0.47% for Lu. longipalpis among the analyzed samples. These results contribute to incriminate Lu. longipalpis as the vector of L. infantum in the municipality of Posadas, where cases of the disease in humans and dogs have been reported since 2005.

  13. Hérnias toraco-lombares do tipo I e II na espécie canis lupus familiaris : prognóstico a curto prazo após tratamento cirúrgico

    OpenAIRE

    Horta, Tânia Sofia Guerreiro

    2011-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária A hérnia de disco intervertebral (HDI) caracteriza-se pela extrusão (hérnia Hansen tipo I) ou pela protrusão (hérnia Hansen tipo II) de um ou mais discos intervertebrais, mais comummente na região toraco-lombar, que pelo efeito de massa no canal medular ou pela concussão da medula espinhal, ou por ambos, causam uma disfunção neurológica do segmento medular afectado. Os sinais neurológicos podem variar desde ataxia e dor (menor gravi...

  14. Canis familiaris (carnívora: Canidae) como sentinelas da saúde animal e humana no Parque Estadual do Ibitipoca e entorno, município de Lima Duarte MG, Brasil.

    OpenAIRE

    Julio Cesar Rocha Costa

    2011-01-01

    A presença de cães domésticos em Unidades de Conservação é uma realidade bastante comum no Brasil. Problema sério e de difícil resolução ocasionado principalmente pelo abandono ou descuido de cães por seus proprietários. Hábito que pode ser a causa de sérios problemas ambientais, como a interferência destes animais domésticos em diversos aspectos da sobrevivência de populações silvestres e na estabilidade ecológica de ecossistemas. Além disso, cães errantes e ou ferais podem carrear vários pa...

  15. A placebo-controlled study to investigate the effect of Dog Appeasing Pheromone and other environmental and management factors on the reports of disturbance and house soiling during the night in recently adopted puppies (Canis familiaris

    OpenAIRE

    Taylor, Katy; Mills, Daniel S

    2007-01-01

    Disturbance and house soiling during the night are common problems faced by the new puppy dog owner. They may result as consequence of a mismatch between the developmental status of the puppy and its new environment and/or separation distress in a typically social animal. The aim of this study was to examine the effect of Dog Appeasing Pheromone (DAP, Ceva Santé Animale) as well as a range of other management and environmental factors that might affect this process. It has been suggested tha...

  16. Ultra-sonografia bidimensional em tempo real do bulbo ocular de cães (Canis familiaris, Linnaeus, 1758 com opacificação de meios transparentes. Emprego do transdutor mecânico setorial de 7,5 MHz com almofada de recuo Two-dimensional real-time ultrasonography in eyes of dogs (Canis familiaris, Linnaeus, 1758 with opacification of transparent media use of a 7.5 MHz mechanical sector fluid offset transducer

    Directory of Open Access Journals (Sweden)

    Ana Maria Barros Soares

    1998-12-01

    Full Text Available Utilizou-se ultra-sonografia bidimensional em tempo real na avaliação de 20 bulbos oculares de 10 cães, sem alterações clínicas visíveis, e de 55 bulbos oculares de 30 cães com opacificação de meios transparentes. Empregou-se transdutor mecânico setorial de 7,5 MHz com almofada de recuo, em técnica de contato corneano. Para a realização dos exames, os animais foram contidos mecanicamente e as córneas receberam anestesia tópica. A blefarostasia deu-se manualmente. Os bulbos foram avaliados com o transdutor aplicado nas posições vertical e horizontal. As características ultra-sonográficas encontradas em olhos normais o foram a similitude da literatura especializada. Relativamente aos bulbos oculares com opacificação de meios transparentes, encontraram-se alterações junto às estruturas e compartimentos. Destacaram-se as cataratas, as luxações e subluxações do cristalino, as degenerações do vítreo, as hemorragias e inflamações em câmaras anterior e vítrea e os descolamentos de retina. A base dos achados e a fidedignidade das imagens colhidas permitem admitir que a ultra-sonografia bidimensional em tempo real, utilizando o transdutor mecânico setorial de 7,5MHz com almofada de recuo, adequa-se ao exame das estruturas intra-oculares, mormente na Medicina Veterinária em que os recursos são parcos à aplicação de procedimentos mais sofisticados ou de equipamentos para ultra-sonografia próprios à especialidade.The two-dimensional real-time ultrasonography was used to evaluate 20 normal eyes of 10 dogs and 55 eyes o f 30 dogs with ocular opacity. A 7.5MHz mechanical sector fluid offset transducer was utilized, and the corneal contact method was performed. The exams were carried out with the animal awake, the córnea received a topical ophtalmic anesthetic, and the eyelids were held open manually. The eyes were examined with the transducer in vertical and horizontal positions. The ultraso- nographic characteristics found in the normal eye structures were compatible with the experiences related by several dijferent authors. Several changes were found in the structures and chambers of the eye which presented opacities of the media, such as cataracts, lens luxation and sub-luxation, vitreous degeneration, hemorrhage and inflammation in the vitreal chamber, besides retinal detachments. On the basis of the studies carried out and the obtained results, it was possible to conclude that the two-dimensional real-time ultrasonography, with the use of a 7.5MHz mechanical sector fluid offset transducer shows a satisfactory adaptability to the evaluation of the intra-ocular structures. It is indicated specially in Veterinary Medicine in which resources are scanty to sophisticated procedures or specific eye ultrasound equipment.

  17. Predation on the black capuchin monkey Cebus nigritus (Primates: Cebidae by domestic dogs Canis lupus familiaris (Carnivora: Canidae, in the Parque Estadual Serra do Brigadeiro, Minas Gerais, Brazil Predação de macaco-prego Cebus nigritus (Primates: Cebidae por cães domésticos Canis lupus familiaris (Carnivora: Canidae, no Parque Estadual da Serra do Brigadeiro, Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Valeska B. de Oliveira

    2008-06-01

    Full Text Available Predation on an adult male black capuchin monkey, Cebus nigritus (Goldfuss, 1809 by two domestic dogs was observed in the Parque Estadual Serra do Brigadeiro, in the Atlantic Forest of southeastern Minas Gerais. Predation occurred in an area of well preserved native forest 800 m from the nearest forest edge. This is the first confirmed record of predation by domestic dogs in this reserve, yet data from a study in the same area indicates that the domestic dog is the most frequently recorded mammal species, which suggests that it is common in the area. The few published reports indicate that this problem occurs in other conservation units in Brazil and should, therefore, be treated with more rigor by the environmental agencies.A predação de um macho adulto de macaco-prego, Cebus nigritus (Goldfuss, 1809 por dois cães-domésticos é relatada no interior do Parque Estadual da Serra do Brigadeiro, localizado na Mata Atlântica do sudeste de Minas Gerais. A observação foi registrada em local de mata nativa bem preservada, a cerca de 800 m da borda mais próxima da reserva. Embora este seja o primeiro registro confirmado de predação por cão doméstico nesta unidade de conservação, dados de um estudo sobre a mastofauna local, usando parcelas de pegadas, indicam que o cão-doméstico é a espécie de mamífero mais freqüentemente registrada, sugerindo que sua presença é constante e amplamente distribuída na área. Os poucos relatos existentes na literatura indicam que este problema está presente em outras unidades de conservação e deveria, portanto, ser tratado com maior rigor pelas agências ambientais.

  18. Gene : CBRC-FCAT-01-0270 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lfactory receptor-like protein DTMT emb|CAA46129.1| DTMT [Canis familiaris] prf||1804351B olfactory receptor...N*SFSDLCFSSVTMPKLLQNMQSQVPPLPYASCLAQMYCYLFFGVLESFLIVVMAYGRYVAICFPLHYTTIMSPNLCLSLVVVLWVLTTAHAMLHTLLMAKLSFCANNIIPRF

  19. Gene : CBRC-PHAM-01-1587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available D: similar to CG31439-PA [Canis familiaris] 6e-46 29% MDPVEVSILRRSVPCGGVYPVEVCPCGGMDPVEVCILWRCVPCTLWRCVPCTLWRYVPCGGMDPVEVC...ILWRCVPCGGVYPVEVCTLWRCVPCGSMDPVEVCIPWRYVPCGGVYPVEVCILWRCVPCGGVYSVEVCTLWRCVSCGGMNPVEVCTLYPVEVSTLWRCVPCGGMDPVEVC...TLWRCVPVEVWILWRHVPCEGVHPVKVWILWRCVLCGDMYPVEVCTLWRYRSCGAVYPVEVYTLW...RFVLCGGVYPAEVWILWRYVPCGSVYPVEVWILWRCVLCGGVYPVEVCTLWRCILCGGVYPVEVWNLWRCVSCGGVYPVEVYILWRCVPCGGMEPVEVCILWRRVSCGGVYPVEVYTLWRCVPCGGMEPVEVC...ILWRYGSCGGVYPVEVWILWRCVPCRSVYPVEVCTLWRCVPCGGMEPVEVCILWRYGSCGGVYLVGVCTLWRCVLCGGVYPVEVWNLWRCVSCGGMDSVNVCTLWECVPCGGVYPVEIWIL ...

  20. Gene : CBRC-EEUR-01-1482 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1e-144 81% ref|XP_542459.2| PREDICTED: similar to olfactory receptor 705 [Canis familiaris] 1e-150 85% MELWNATLGSDFLLMGILNDSGSPELLCAT...IAALYMLALTSNSLLILVITVDARLHVPMYLLLGQLSLMDLLFTSVVTPKALVDFLRGDNSISFEGCALQMFLALTLGGAEDL

  1. Diagnóstico sorológico de erliquiose canina com antígeno brasileiro de Ehrlichia canis Serological diagnosis of canine monocytic ehrlichiosis with Brazilian antigen of Ehrlichia canis

    Directory of Open Access Journals (Sweden)

    Daniel Moura Aguiar

    2007-06-01

    Full Text Available O presente trabalho relata o isolamento de Ehrlichia canis em cultivo de células DH82 e posterior padronização da Reação de Imunofluorescência Indireta (RIFI. Leucócitos de uma cadela experimentalmente infectada com o isolado Jaboticabal de E. canis foram inoculados em cultivo de células DH82. A inoculação foi monitorada após a segunda semana, a cada 5-6 dias, através de exames citológicos e pela amplificação de um fragmento do gene dsb de Ehrlichia pela Reação em Cadeia pela Polimerase (PCR para confirmação da infecção. A cultura apresentou-se positiva aos 27 dias pós-inoculação pela PCR e aos 28 dias pela citologia. No 33o dia pós-inoculação, observou-se 20% de células infectadas e, aos 53 dias, 60% de infecção. Atualmente, o isolado encontra-se estabelecido em células DH82, com várias passagens atingindo 90-100% de células infectadas entre 7-10 dias após a inoculação. Após o seqüenciamento do produto de PCR, o isolado apresentou-se 100% similar à seqüência correspondente de E. canis depositada no GenBank. As células infectadas foram utilizadas como antígeno para a padronização da RIFI para detecção da infecção em cães.The present study describes a successful isolation of Ehrlichia canis and its establishment in DH82 cells, followed by the development of an Indirect Fluorescent Antibodies Test (IFAT. Leukocytes collected from an experimentally infected dog with the Jaboticabal strain of E. canis were used to inoculate a DH82 cell monolayer. Two weeks later, the inoculated culture was checked for infectivity, every 5-6 days by both cytological staining and PCR, targeting a fragment of the dsb gene. The cell culture showed to be infected by Ehrlichia on day 27 by PCR and on day 28 by cytological staining. By the day 33, the infection rate reached 20% and on day 53, 60%. Currently, the isolate is established in DH82 cells, with several passages reaching 90-100% of infected cells, within 7 to 10 days post inoculation. After sequencing, the amplicon was identical to other E. canis corresponding sequences available in the GenBank. DH82 infected cells were used to standardize an IFAT for the diagnosis of canine ehrlichiosis.

  2. Desnervação capsular percutânea ou aberta no tratamento da dor na displasia coxofemoral canina Percutaneous versus open hip denervation in the treatment of canine pain hip dysplasia

    Directory of Open Access Journals (Sweden)

    Gisele Francine da Silva

    2012-04-01

    Full Text Available A desnervação capsular (DC se baseia na desperiostização da borda acetabular e tem sido utilizada como uma das técnicas de alívio da dor articular em cães displásicos. Compararam-se as técnicas de DC percutânea e aberta, aplicadas em 25 cães, que apresentaram diagnóstico clínico e radiográfico de displasia coxofemoral, totalizando 31 cirurgias. Os efeitos das técnicas foram comparados, em período de 180 dias, por meio de avaliação subjetiva de claudicação e dor, perimetria da coxa, graus máximos de flexão e extensão da articulação coxofemoral e amplitude de movimento articular. Os graus de claudicação e dor apresentaram decréscimo significativo ao longo do período avaliado em ambos os grupos, sem apresentarem diferenças quando comparados entre si. Com relação à perimetria da coxa, flexão, extensão e amplitude de movimento articular, foi observado o aumento dos valores numéricos destas variáveis ao longo do estudo. Baseado nos achados, concluiu-se que a abordagem percutânea ou aberta na DC produz similitude nas variáveis avaliadas, e ambas trazem bons resultados.Joint capsule denervation is based on removal of sensitive fibers from the acetabular edge and has been used as one of the techniques to joint pain relief in the canine dysplastic hip. This study compared the techniques of percutaneous and open hip denervation in 25 dogs that showed clinical and radiographic signs of hip dysplasia, totaling 31 surgeries. The effects of the techniques were evaluated and compared in a period of 180 days following surgery, including subjective evaluation of lameness and pain, thigh girth, maximum degree of hip flexion and extension and range of motion (ROM. Degree of lameness and pain significantly decreased during the study period for both groups, and no difference could be observed between groups. Thigh girth, degree of flexion, extension and ROM presented an increase in the numerical values throughout the study. Based on these findings, it is concluded that the percutaneous or open approach for capsular denervation produced similar results.

  3. A monitorização por electrocardiografia ambulatória (Holter) na cardiologia canina : estudo clínico de nove canídeos com lesão degenerativa crónica da valva mitral

    OpenAIRE

    Almeida, Joana Grade Mendes Costa

    2009-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária Nos anos 40 do século passado, Norman Holter descobriu a electrocardiografia ambulatória. Em alguns anos o monitor Holter chegou à Medicina Veterinária, sendo actualmente um meio de diagnóstico prático, não doloroso, não invasivo e bem tolerado, que permite a monitorização do funcionamento cardíaco por 24 horas e portanto a identificação e quantificação das arritmias presentes num traçado com tal duração. Até à data e no...

  4. TRIPLEX DOPPLER DA ARTÉRIA HEPÁTICA CANINA NOS PERÍODOS PRÉ E PÓS-PRANDIAL TRIPLEX DOPPLER OF CANINE HEPATIC ARTERY ON PRE AND POSPRANDIAL PERIODS

    Directory of Open Access Journals (Sweden)

    Elizabete Nikolak Nikolak

    2009-09-01

    Full Text Available O objetivo deste trabalho foi avaliar por meio do triplex doppler as varia��ões dos índices de resistividade (IR e pulsatilidade (IP da artéria hepática (AH de cães adultos saudáveis em períodos pré e pós-prandiais. O grupo amostral foi composto por quatorze cães sem raça definida, sendo nove fêmeas e cinco machos com peso entre seis e dezenove quilos e quatro e dezesseis quilos, respectivamente. Previamente aos exames ultrassonográficos, os animais foram submetidos a 24 horas de jejum e, para os exames pós-prandiais, foram alimentados com leite ou ração comercial. Utilizou-se o ultrassom Philips HDI 4000, munido de um transdutor microconvexo (5-8MHz. Dividiram-se as mensurações dos IR e IP da AH em três tempos: T0 (período pré-prandial, T1 (trinta minutos pós-prandial e T2 (noventa minutos pós-prandial. Não houve diferença estatística quando comparadas as médias de IR e IP da AH entre T0 e T2. No entanto, ambos os índices foram significativamente menores no T1 quando comparado com os outros períodos de análise, comprovando aumento de fluxo sanguíneo na AH trinta minutos pós-prandial. O uso do triplex doppler da AH possibilitou mensurações do fluxo sanguíneo pré e pós-prandial, sendo uma técnica importante para estabelecer parâmetros comparativos entre homeostasia metabólica e diferentes estados fisiopatológicos hepáticos.

    PALAVRAS-CHAVES: Artéria hepática, cães, índice de resistividade, índice de pulsatilidade, ultrassonografia. The aim of the current study was to evaluate the resistivity index (RI and pulsatility index (PI of hepatic artery (HA by Triplex Doppler in health adult dogs on pre and postprandial periods. The experimental group was formed by 14 mongrel dogs, 9 females and five males, weighing 6-19 kg and 4-16 kg, respectively. The animals were previously prepared, remaining 24 hours of starvation, and feeding with milk or pellet show food to perform posprandial analysis. The ultrasound PHILIPS HDI 4000 equipped with a micro convex transducer (5-8MHz was used. The RI and PI measurements of HA were performed on tree times: T0 (pre-prandial period, T1 (30 minutes postprandial and T2 (90 minutes postprandial. There are no statistical differences between T0 and T2 when compared RI and PI of HA. However, both indices were significantly diminished on T1 in relation with T0 and T2, which represents an increase of AH blood flow 30 min postprandial. The employment of HA Triplex Doppler improves the blood flow evaluation pre and posprandial and can be one important technique to establish comparative parameter to distinguish between hepatic metabolic homeostasis from different physiopathologics states.

    KEY WORDS: Dogs, hepatic artery, pulsatility index, resistivity index, ultrasound.

  5. Canine visceral leishmaniasis: a remarkable histopathological picture of one asymptomatic animal reported from Belo Horizonte, Minas Gerais, Brazil Leishmaniose visceral canina: um caso inusitado de um animal assintomático proveniente de Belo Horizonte, Minas Gerais

    Directory of Open Access Journals (Sweden)

    S.C. Xavier

    2006-12-01

    Full Text Available A remarkable histopathological picture of one asymptomatic dog naturally infected with Leishmania infantum (syn. chagasi has been presented. Intracellular parasites were ease found in macrophages of all exanimated organs, especially in skin. Embedded paraffin tissues of liver, spleen, axillary and popliteal lymph nodes, and skin (ear, muzzle and abdomen were stained by hematoxylin and eosin and by immunocytochemical reaction (streptoavidin-peroxidase method to detect parasites. All organs showed an intense parasitism associated to severe pathological changes. All lymph nodes had conspicuous histological architecture alterations. Lymphocytes were replaced by macrophages stuffed with an intense number of amastigotes forms of Leishmania. The lymphoid nodules (without germinal centers and the mantle zones in the cortex that surround the follicles were markedly attenuated. Livers showed small intralobular granulomas composed by macrophages loaded with amastigotes. Spleens had an intense depression of the white pulp whereas the lymphocytes were replaced by parasitized macrophages. All fragments of different anatomical region of skin (ear, muzzle and abdomen showed a diffuse chronic inflammation. The cellular exudate was composed by macrophages, plasmocytes and lymphocytes. Macrophages loaded with amastigotes were ease found in all tissue fragments, but more intense in ear and muzzle. Thus, this fact enhances the importance of asymptomatic dogs in the epidemiology of visceral leishmaniasis.Relata-se um quadro histológico caracterizado por lesões acentuadas em tecidos de um cão assintomático naturalmente infectado por Leishmania infantum (sin. chagasi. Cortes parafinados de fígado, baço, linfonodos (cervical, axilar e poplíteo e pele (orelha, espelho nasal e abdome foram corados pela técnica de hematoxilina-eosina e pela técnica imunoistoquímica de estreptoavidina-peroxidase para detecção de formas amastigotas de Leishmania. Os linfonodos apresentaram profundas alterações estruturais. Em todos observou-se depleção linfocitária, principalmente da córtex, com substituição dos linfócitos por macrófagos abarrotados de formas amastigotas de Leishmania. No fígado, observou-se a presença de pequenos granulomas intralobulares compostos por macrófagos intensamente parasitados, plasmócitos e raros linfócitos. No baço, a alteração marcante foi a depressão da polpa branca. Os folículos linfóides foram substituídos por macrófagos intensamente parasitados com as formas amastigotas de Leishmania. Fragmentos de pele de orelha, espelho nasal e abdome apresentaram reação inflamatória crônica e difusa com exsudato celular composto por macrófagos, plasmócitos e linfócitos. Parasitos foram detectados em todos os tecidos estudados e mais numerosos na pele da orelha e focinho. Os achados mostram a importância de cães assintomáticos na epidemiologia da leishmaniose visceral.

  6. Eficácia das lactonas macrocíclicas sistêmicas (ivermectina e moxidectina na terapia da demodicidose canina generalizada Efficacy of systemics macrocyclic lactones (ivermectin and moxidectin for the treatment of generalized canine demodicosis

    Directory of Open Access Journals (Sweden)

    E.H. Delayte

    2006-02-01

    Full Text Available Avaliou-se a eficácia de lactonas macrocíclicas (ivermectina e moxidectina sobre a eventual ocorrência de efeitos colaterais e acompanharam-se, após a alta parasitológica, por 12 meses, os cães tratados, visando detectar a recidiva do quadro dermatopático. Dos 63 animais, 59% eram fêmeas, 76% apresentavam precisa definição racial e 67% tinham pelame curto. A ivermectina (0,6mg/kg/dia foi administrada por via oral a 31 cães, e a moxidectina (0,5mg/kg/cada 72 horas, pela mesma via, a 32 animais. Os tempos médios para a obtenção da primeira negativação do exame parasitológico do raspado cutâneo e para a consecução da alta foram, respectivamente, de 90 e 130 dias para a ivermectina e de 108 e 147 dias para a moxidectina. A ivermectina acarretou menos (16,1% efeitos colaterais em relação à moxidectina (37,5% (P=0,03. As recidivas foram, respectivamente, 10,3% e 13% para ivermectina e moxidectina. Não houve diferença entre os dois protocolos de terapia quanto aos percentuais de recidiva (P=0,67 e eficácia (P=0,61. Ambas as lactonas macrocíclicas mostraram-se eficazes: ivermectina 89,7% e moxidectina 87%.The efficacy of ivermectin and moxidectin for treatment of generalized canine demodicosis, was evaluated to detect the eventual occurrence of side effects caused by the use of these drugs, and to follow the treated dogs for 12 months after obtaining parasitologic cure. Of 63 dogs, 59% were females, 76% were defined as purebred and 67% had short hair. Ivermectin (0.6mg/kg/daily was orally administered to 31 dogs and moxidectin (0.5mg/kg/every 72 hours to 32 dogs. The average number of days to obtain the first negative skin scraping results and the parasitologic cure were, respectively, 90 and 130 days for ivermectin, and 108 and 147 days for moxidectin. Ivermectin caused fewer side effects (16.1% than moxidectin (37.5% (P0.67 and efficacy (P>0.61. Both drugs were effective and safe to treat generalized canine demodicosis: ivermectin 89.7% and moxidectin 87.0%.

  7. Isolamento de bactérias aeróbias e sua sensibilidade a antimicrobianos em processos de osteomielite canina Aerobic bacterial isolates and susceptibility to antimicrobial agents in canine osteomyelitis

    Directory of Open Access Journals (Sweden)

    A.C. Simionato

    2003-04-01

    Full Text Available O objetivo deste trabalho foi estudar a presença de bactérias aeróbias em 20 cães com osteomielite, decorrente de exposição óssea. Na identificação das bactérias utilizou-se o sistema API-Bio Mérieux e testou-se a sensibilidade dos microrganismos in vitro, pelo método de difusão em ágar, frente a 14 diferentes antibacterianos. O osso mais acometido pela infecção foi a tíbia (35%. Isolaram-se 68,3% de bactérias Gram positivas e 31,7% de Gram negativas. Staphylococcus spp, Streptococcus spp e Enterococcus spp foram os gêneros mais freqüentes, representando respectivamente 34,1%, 14,6% e 14,6% do total de bactérias (41 cepas. Enterobactérias foram isoladas em 26,8% das amostras. Os cocos Gram positivos apresentaram maior sensibilidade à amoxicilina associada ao ácido clavulânico. Os microrganismos Gram negativos, tanto as bactérias da família Enterobacteriaceae como as do gênero Pseudomonas, apresentaram altos índices de resistência.The aim of this work was to detect aerobic bacteria in osteomyelitis process in dogs with bone exposure. The API-Bio Mérieux Identification System was used to identify the bacteria. Susceptibility in vitro was verified by the agar diffusion method, to 14 different antibiotics. The most frequent bone involved was tibia (35%. Gram positive cocci represented 68.3% from isolates and the Gram negative bacteria 31.7%. Staphylococcus spp, Streptococcus spp and Enterococcus spp were the most frequent genus, representing, respectively, 34.1%, 14.6%, and 14.6% of the total bacteria strains (41 strains. Enterobacteria were isolated in 26.8%. Cocci Gram positive presented good susceptibility to amoxicillin associated with clavulanic acid. Gram negative microorganisms, the enterobacteria and Pseudomonas sp, showed high resistance profile.

  8. Análise de dados de gastroenterite hemorrágica canina para identificar fatores de risco por regressão logística Data analysis of hemorrhagic gastroenteritis to identify risk factors by logistic regression

    Directory of Open Access Journals (Sweden)

    Paula Roberta Mendes

    2004-04-01

    Full Text Available No presente estudo, ajustou-se um modelo de regressão logística para prever a probabilidade de óbito de cães acometidos por gastroenterite hemorrágica. O modelo Logístico é recomendado para variáveis-resposta dicotômicas em estudo de Coorte. Registraram-se 176 animais censitariamente atendidos com gastroenterite hemorrágica em quatro clínicas veterinárias da cidade de Lavras, sul de Minas Gerais, entre os anos de 1992 e 1999. Após terem sido selecionadas por meio do teste de de Pearson ou teste exato de Fisher, ajustou-se o modelo considerando-se as variáveis sexo, idade, diárias de internação e número de atendimentos. A estimação dos parâmetros foi feita pelo método da máxima verossimilhança. Conclui-se que quando os cães acometidos por gastroenterite hemorrágica são atendidos apenas uma vez, aqueles com idade superior a 6 meses possuem 15,45 vezes mais chances de morrerem (PThis paper presents a study of how to fit a logistic regression model to predict the death probability of dogs with hemorrhagic gastroenteritis. A logistic model is recommended to treat dichotomic variables in Coorte study. Using a census procedure from 1992 to 1999 four veterinary clinic in Lavras, MG, registered 176 infected animals. The variables of the model have been chosen to be sex, age internment days rates and number of clinical treatments by the or Fisher’s exact test. The parameters were estimated by the maximum likelihood method. The results showed that if the infected dogs were clinically treated only once then the animals older than six months had their mortality chances 15.45 times (P<0.05 larger than those younger than six months. If the infected animals younger than six months were clinically treated only once then their mortality chances were 20.251 (P<0.05 higher than if they had received two to seven medical treatments.

  9. A UTILIZAÇÃO DA IMUNOFLUORESCÊNCIA INDIRETA NO DIAGNÓSTICO DE ROTINA DA LEISHMANIOSE VISCERAL CANINA E SUAS IMPLICAÇÕES NO CONTROLE DA DOENÇA

    Directory of Open Access Journals (Sweden)

    Bruno Jean Adrien Paule

    2006-10-01

    Full Text Available Neste trabalho foram analisados, por enzyme-linked immunosorbent assay (ELISA e imunofluorescência indireta (IFI, 101 soros caninos provenientes da Região Metropolitana de Salvador, Bahia, sendo 30 soros de cães com resultado parasitológico positivo para Leishmania chagasi em cultura esplênica e 71 soros de cães clinicamente sadios. Dez soros de cães com cultivo positivo e com resultados sorológicos concordantes ou não entre os testes ELISA e IFI foram testados pela técnica de Western-Blotting (WB. Das 30 amostras de soro com resultado positivo em cultura, o ELISA detectou 27 amostras positivas e o IFI mostrou resultado positivo em 12. Das 71 amostras de soro de cães clinicamente sadios, todas apresentaram resultados negativos no ELISA e uma apresentou resultado positivo no IFI. A sensibilidade e a especificidade foram de 90% e 100% para o ELISA e 40% e 98,6% para IFI, respectivamente. O índice de concordância Kappa entre os testes foi considerado moderado (0,53, e os resultados do WB apresentaram maior concordância com o ELISA. Este estudo demonstra a possibilidade de falha no teste IFI na detecção de cães infectados e discute a sua implicação no controle da doença em áreas endêmicas. PALAVRAS-CHAVE: Cães, ELISA, IFI, Leishmania chagasi, Western-Blotting.

  10. Investigación experimental de la equinococosis canina a partir de quiste hidatídico de origen porcino en México Experimental investigation of canine echinococcosis from swine hydatic cyst in Mexico

    Directory of Open Access Journals (Sweden)

    Ismael Zuñiga-A

    1999-06-01

    Full Text Available OBJETIVO: Para evaluar la infección y obtener el estado adulto del cestodos, se buscó reproducir la equinococosis en perros a partir de quiste hidatídico de origen porcino. MÉTODOS: Se formaron 2 grupos, uno de 5 y otro de 3 perros, a cada animal del grupo experimental se le dió 2 g de membrana germinativa de quíste hidatídico fértil por vía oral, el segundo grupo fue testigo. Ambos grupos fueron evaluados clínica, serológica y parasitológicamente, en el grupo experimental se sacrificó un animal el día 35 de la infección y los siguientes cada 5 dias hasta el 55, en el segundo grupo todos se sacrificaron el día 55. Se observaron huevos del cestodos en heces a partir del dia 51 postinfección. La evaluación morfol��gica se realizó mediante observación microscópica del raspado de mucosa intestinal. RESULTADOS: De 50 cestodos analizados, 10 de cada uno de los perros infectados, 49 (98% presentaron 3 proglótidos y 1 (2% tenía 4; 18 (36% de los cestodos presentaban un proglótido grávido. La longitud de los estróbilos varió de 1,6 a 2,6 mm. El número promedio de los ganchos largos y cortos fue de 31 y 34 respectivamente. La longitud de los ganchos largos varió entre 0,081 y 0,09 mm, los ganchos cortos fluctuaron entre 0,034 y 0,041 mm. En los perros evaluados clínicamente, el número de leucocitos y la cantidad de proteínas plasmáticas fue significativamente mayor en el grupo testigo (P OBJETIVO: Avaliar a infeção e obter o estado adulto do cestóides, provocando-se a reprodução da equinococose em cães a partir do cisto hidático de origem suína. MÉTODOS: Formaram-se dois grupos, um de 5 e outro de 3 cães. Cada animal do grupo experimental recebeu, por via oral, 2 g de membrana germinativa de cisto hidático fértil. O segundo grupo serviu como testemunha. Ambos os grupos foram avaliados de maneira clínica, sorológica e parasitológica. No grupo experimental foi sacrificado um animal no 35º dia da infeção e os outros cada 5 dias até o 55º dia. No segundo grupo, foram sacrificados no 55º dia. Foram encontrados ovos do cestóides em fezes a partir do 51º dia pós-infeção. A avaliação morfológica foi feita por meio de observação microscópica da raspagem de mucosa intestinal. RESULTADOS: Dos 50 cestóides analisados, 10 corresponderam a cada um dos cães infectados, 49 (98% mostraram 3 proglotides e 1 (2% continha só 4; 18 (36% dos cestóides apresentavam um proglotide grávido. Na availação clínica, o número de leucócitos e a quantidade de proteínas plasmáticas foram significantemente maiores no grupo testemunha (P OBJECTIVE: To evaluate the infection and obtain the adult state of the cestode, echinococcosis was reproduced in dogs using the hydatic cyst of swine. METHODS: Two groups were formed, one of five and the other of three dogs, each animal in the experimental group was given two grams of germinative membrane of fertile hydatic cyst by oral route. The second was the control group. Both groups were evaluated clinically, serologically and parasitologically. One animal was killed on the 35th day after infection and each five successive days until the 55th day. In the second group all the animals were killed on the 55th day. Eggs of the cestode were observed in feces from the 51st post-infection day. The morphological evaluation was made through microscopic observation of the mucous intestine scraping. RESULTS: Fifty cestodes were analyzed, ten from each of the infected dogs, 49 (98% presented three proglottids and 1 (2% had four; 18 (36% of the cestodes presented a gravid proglottid. The length of the strobila varied from 1.6 to 2.6 mm. The average of the long and short hooks was 31 and 34, respectively. The length of the long hooks varied from 0.081 to 0.09 mm, the short hooks from 0.034 to 0.041 mm. The quantity of plasmatic proteins and the number of leukocytes were significantly greater in the control group (P < 0.05; the quantity of alpha-globulins was larger in the infected group (P < 0.05. CONCLUSIONS: The results con

  11. Análisis comparativo de la rigidez al desplazamiento antero-posterior de la rodilla canina completa, rodilla con rotura del ligamento cruzado anterior y rodilla reparada con la técnica de avance de la tuberosidad tibial

    OpenAIRE

    Musté Rodríguez, Marta

    2013-01-01

    In canine traumatology, one of the most common knee pathologies is torn cruciate ligament (ACL), the diagnosis and treatment costs were 1.32 billion dollars in the U.S. during 2003. The short-term effects are instability of the knee, osteoarthritis, meniscal injuries, pain and loss of function of the joint. The ACL acts as a joint stabilizer. Its function is to limit anterior displacement of the tibia relative to the femur, internal tibia rotation and hyperextension of the knee. Treating ACL ...

  12. Soroepidemiologia da brucelose canina causada por Brucella canis e Brucella abortus na cidade de Alfenas, MG Seroepidemiology of canine brucellosis caused by Brucella canis and Brucella abortus in Alfenas, MG, Brazil

    Directory of Open Access Journals (Sweden)

    A.C. Almeida

    2004-04-01

    Full Text Available The prevalence of canine brucellosis was evaluated in the city of Alfenas, MG through the technique of agarose gel imunodifusion for Brucella canis and slow serum agglutination test with 2-mercaptoetanol for Brucella abortus. The prevalence was of 14.2% and 2.8%, respectively, for B. canis and B. abortus. The positives, characterized by animals above one year of age (77.8%, and mongrel dogs (56.2%, showed a prevalence of 50 and 48% for males and females, respectively. The canine brucellosis was prevalent in the city principally in dogs of outskirts.

  13. Equinococosis canina en un sector del Departamento de Río Cuarto,Provincia de Córdoba, Argentina Canine echinococcosis in an area of Río Cuarto Department(Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    J. GONZALEZ PERALTA

    1998-01-01

    Full Text Available La hidatidosis es una zoonosis parasitaria de distribución universal,producida por un céstode del género Equinococus granulosus,que tiene como huésped definitivo de mayor importancia epidemiológicaal canino. El hombre y los animales de producción son huéspedesintermediarios. En Argentina las zonas que muestran altas tasas de transmisiónde hidatidosis al hombre son: La Patagonia, la Pampa Húmeda y elLitoral. En el resto del país los casos de hidatidosis humana senotifican sólo esporádicamente, como sucede en la provinciade Córdoba, que no posee un programa destinado al estudio epidemiológicoy de control, aunque su zona serrana es considerada endémica porla casuística encontrada. El presente trabajo de investigación se efectuó en ElChacay y Las Albahacas, dos localidades ubicadas en el sector sur de lasSierras de Comechingones, departamento Río Cuarto, provincia deCórdoba, con los siguientes objetivos: a determinar la proporciónde caninos con Equinococus granulosus, b valorar el nivelde conocimiento de los habitantes en relación a la enfermedad hidatídica.Se obtuvieron muestras de materia fecal de 120 caninos, por el suministrode Bromhidrato de Arecolina al 1.5%, realizándose el diagnósticopor visualización directa. Se efectuaron encuestas a travésde entrevistas personales a los propietarios de los caninos y a los pobladoresen general. La proporción de equinococosis en caninos fue del 5% en El Chacayy de 17.5% en Las Albahacas. Todos los caninos positivos proveníande establecimientos donde se halló la mayor cantidad de factoresde riesgo. Las 169 entrevistas realizadas determinaron aproximadamenteun 70% de desconocimiento de los pobladores acerca de la enfermedad hidatídica. Los resultados obtenidos justificarían, por su impacto en lasalud pública, la implementación de un programa de estudiosepidemiológicos completos que sirvan de soporte a un futuro programade prevención y control de la hidatidosis a nivel provincialHydatidosis is a parasitic zoonosis of universal distribution whichis produced by a cestode, the Echinococcus granulosus. This parasiteuses dogs as the epidemiological relevant definitive host, being humansand production animals the intermediate hosts. In Argentina, the regions that present very high rates of hydatidosistransmission to man are: Patagonia, the Pampas and the Littoral. In therest of the country, hydatidosis in humans is reported only sporadically,such as in Córdoba province whose hill area is considered an endemicone, and where there is no program to obtain an epidemiological and controlstudies of this zoonosis. Two localities, El Chacay and Las Albahacas, in the south area of theComechingones Hills, Río Cuarto Department, Córdoba Provincewere the working area for this study whose objectives were: a to determinethe proportion of dogs infected with Echinococcus granulosus, bto evaluate the population’s knowledge about the hydatidic disease. 120 dogs administrated with arecoline bromhydrate (1.5 % were sampledto obtain their fecal material. They were diagnosed by direct identificationof the parasite. The hydatidic problematic was analysed through personal interviewswith the dog owners and with the (general population. The (dog proportion of echinococcosis was 5% in El Chacay and 17.5%in Las Albahacas, all belonging to establishments where many hazard factorswere found. The 169 interviews showed that 70% of the cases lacked knowledge aboutthe hydatidic disease. Because of the public health impact of these considerations it is justifiedto carry on a control program of the disease

  14. Comparação da infecção canina por diferentes espécies de ancilostomídeos: aspectos parasitológicos, imunológicos e moleculares

    OpenAIRE

    Denilson Eduardo Silva Cunha

    2009-01-01

    A ancilostomose é uma das doenças parasitárias mais prevalentes no mundo, infectando cerca de 740 milhões de pessoas em regiões rurais tropicais e subtropicais do mundo. Além de sua importância médica, estudos mostram que parasitos do gênero Ancylostoma continuam sendo um dos grupos de nematódeos mais freqüentes em infecções intestinais de cães e gatos. Há diversos grupos de moléculas produzidas e secretadas por ancilostomídeos (produtos ES - Excretados e Secretados) que garantem o sucesso de...

  15. Estudio epidemiológico de las luxaciones sacroilíacas caninas y de su tratamiento - Epidemiological study about dog´s ilio-sacral luxations and their treatment

    Directory of Open Access Journals (Sweden)

    Casasola, A.

    2010-07-01

    Full Text Available ResumenSe ha realizado un estudio retrospectivo en 23 perros recibidos en laConsulta de Cirugía de la Facultad de Veterinaria de la Universidad deExtremadura a los que se les diagnosticó subluxación o luxación sacroilíaca unilateral o bilateral. El 1,06% de los perros con lesiones traumatológicas y/o ortopédicas tienen luxación sacroilíaca. El 39,13% de los casos de luxaciones sacroilíacas pesan menos de 10 kg. y el 73,9% son menores de 2 años. El 82,6% se deben a atropellos por vehículos de motor. El 20,7% (23/111 de las fracturas de pelvis en perros se acompañan de luxaciones sacroilíacas. A ninguno de los 16 casos remitidos por otro veterinario se le había diagnosticado la luxación sacroilíaca. Diagnóstico que no debe ser pasado por alto, porque, en nuestro estudio, el 28,6% de los casos se asociabacon déficits neurológicos. Un 86,25% de las luxaciones sacroilíacasestaban asociadas a otras lesiones, como fracturas de ilion, isquion,pubis, fémur, luxación lumbosacra o arrancamiento sacrococcígeo.La técnica quirúrgica se ha realizado con un abordaje dorsal y consistía, fundamentalmente, en la estabilización de la articulación con tornillos,agujas de Kirschner o combinaciones de ambos. En un 60% de los casos (6/10 se produjeron complicaciones intraoperatorias. En 4/6 por problemas en la colocación de implantes, bien inserciones repetidas o malposiciones. Las complicaciones postoperatorias acaecieron en el 30% (3/10, un caso por infección y dos por movilización de los implantes. En el 25% de los casos que llevaban agujas de Kirschner se produjeron migraciones de las mismas.SummaryA retrospective study in 23 dogs received in the Surgery Department ofthe Veterinary Faculty of Extremadura´s University whose diagnoseswere unilateral or bilateral ilio-sacral sub-luxation or luxation has been done. One point zero six percent of the dogs with traumatological and/or orthopedical injuries have ilio-sacral luxation. The weight was less than 10 kg in the 39,13% of the ilio-sacral luxation cases and the 73,9% of the cases were younger than 2 years old. The 82,6% of the ilio-sacral luxations were causes by motor vehicle. Twenty and three out one hundred and eleven (20,7% of pelvic fractures in dogs were accompanied with ilio-sacral luxations. None of the 16 cases that were referred by others vets were diagnosed of ilio-sacral luxation. This diagnosis has been done carefully because, in our study, the 28,6% of the cases had neurological deficits associated. The 86,25% of iliosacral luxations were accompanied by other injuries as ilial, isquial, pubical andfemoral fractures, lumbosacral luxation or pull the tail up.The surgical technique was done with a dorsal approach and consisted,fundamentally, in the stabilization of the joint with screws, Kirschner´s pins or a combination of both of them.

  16. Diagnóstico da raiva canina: I. comparação entre amostras de saliva e de encéfalo Diagnosis of canine rabies: I. comparison of saliva and encephalon samples

    Directory of Open Access Journals (Sweden)

    Valdson de Angelis Côrtes

    1979-12-01

    Full Text Available Foram examinadas mediante as técnicas de inoculação em camundongos e de imunofluorescência, 30 amostras de saliva e 30 amostras de encéfalo, colhidas de 30 cães raivosos. Todas as amostras, tanto de saliva como de encéfalo, apresentaram resultados positivos frente às duas técnicas usadas, demonstrando uma perfeita correlação entre os métodos e os espécimens utilizados. Foi ressaltada a importância da saliva para o estabelecimento de um diagnóstico mais precoce da raiva.Thirty saliva samples and 30 encephalon samples, collected from an equal number of rabid dogs, were examined by both the mouse inoculation and immunoflluorescent techniques. The results for each sample were positive with both techniques, showing perfect correlation in the methods and specimens used. The importance of saliva for early diagnosis was stressed.

  17. Análisis cinemático mediante videografía de alta velocidad en la displasia de cadera canina - Kinematic analysis using high speed videography in canine hip dysplasia

    Directory of Open Access Journals (Sweden)

    Vilar, JM

    2010-01-01

    Full Text Available ResumenEl objetivo de este trabajo consiste en proporcionar aquellos parámetros lineares, angulares y temporales en un perro de raza bulldog con displasia de cadera mediante el analisis cinematico con videografía de alta velocidad.SummaryThe purpose of this paper is to provide linear,angular and temporal parameters of a bulldog with hip dysplasia. The analysis was performed using high speed videography

  18. Análisis cinemático mediante videografía de alta velocidad en la displasia de cadera canina - Kinematic analysis using high speed videography in canine hip dysplasia

    OpenAIRE

    Vilar, JM; Morales M; Morales, I.; F. Miró; Martinez, A; Rodríguez, O

    2012-01-01

    ResumenEl objetivo de este trabajo consiste en proporcionar aquellos parámetros lineares, angulares y temporales en un perro de raza bulldog con displasia de cadera mediante el analisis cinematico con videografía de alta velocidad.SummaryThe purpose of this paper is to provide linear,angular and temporal parameters of a bulldog with hip dysplasia. The analysis was performed using high speed videography.

  19. Etiology of canine otitis media and antimicrobial susceptibility of coagulase-positive Staphylococci in Fortaleza city, Brazil Etiologia da otite média canina e susceptibilidade a antimicrobianos de Staphylococcus coagulase-positiva em Fortaleza, Brasil

    Directory of Open Access Journals (Sweden)

    Lis Christina de Oliveira

    2006-06-01

    Full Text Available This study evaluated the middle ear microbiota and antimicrobial susceptibility patterns from strains isolated from dogs with otitis media. A total of 62 dogs obtained from Zoonoses Control Center of Fortaleza City Ceará State / Brazil were studied over a 10-month period (August/2003 to June/2004. Of the total, 46.8% (n=30 of the animals were positive for otitis media and the infection was monomicrobial in 76.6% of them. The most frequent isolated agents were coagulase-positive Staphylococci (CPS-55% and Pseudomonas sp (10%. For S. intermedius (n=13 and S. aureus subsp aureus (n=9, respectively, the greater resistance rates were observed using penicillin G (30.76% and 44.44%, ampicillin (7.69% and 44.44%, erythromycin (23.07% and 44.44%, clindamycin (23.07% and 44.44% and thrimethropim/sulfamethoxazol (15.38% and 33.33%.O presente trabalho avaliou a microbiota do ouvido médio e os perfis de susceptibilidade a antimicrobianos de cepas isoladas de cães com otite média. Um total de 62 cães obtidos no Centro de Controle de Zoonoses de Fortaleza Ceará / Brasil foram estudados no período de 10 meses (agosto/2003 a junho/2004. Do total de animais, 46.8% (n=30 foram positivos para otite media e a infecção envolvida era monomicrobiana em 76,6% dos casos. Os agentes isolados com maior frequência foram Staphylococcus coagulase-positiva (CPS-55% e Pseudomonas sp (10%. Considerando-se S. intermedius (n=13 e S. aureus subsp aureus (n=9, respectivamente, as mais elevadas taxas resistência foram observadas frente a: penicilina G (30,76% e 44,44%, ampicilina (7,69% e 44,44%, eritromicina (23,07% e 44,44%, clindamicina (23,07% e 44,44% e trimetropim/sulfametoxazol (15,38% e 33,33%.

  20. Distribuição espacial e temporal da leishmaniose visceral canina em relação a densidade vetorial e ao controle de cães infectados em Porteirinha - MG (1998 - 2002)

    OpenAIRE

    2003-01-01

    Na área endêmica de leishmaniose visceral (LV) de porteirinha, norte de Minas Gerais, em sendo desenvolvido,desde 1998, um projeto sobre eliminação de cães, borrifação de inseticidas e tratamento dos casos humanos,tendo como objetivos: a) avaliar a real importância do cão como reservatório domestico; b) estabelecer a flutuação sazonal de Lutzomya Longipalpis; c) medir o impacto do inseticida na densidade vetorial; d)avaliar a eficiência do programa no controle da LV.Amostras de sangue de cães...

  1. Dicty_cDB: Contig-U04369-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV347056 ) S230P6400RH7.T0 Rottweiler Canis familiaris STS g... 34 4.1 2 ( FB5... hubrichti mitochondrion, complete ge... 44 6.3 1 ( BV348868 ) S230P6384RC8.T0 Rottweiler Canis familiaris S

  2. Dicty_cDB: Contig-U15636-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one: CAS01_020_O16, 3'end. 44 0.11 2 ( BV286792 ) S232P6569RB8.T0 Beagle Canis familiaris STS genom... 40 0....D-2021A8 from 7, complet... 50 0.11 4 ( BV291216 ) S232P6154FH6.T0 Beagle Canis familiaris STS genom... 44 0

  3. Dicty_cDB: Contig-U06288-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Canis familiaris prostatic steroid... 60 5e-08 (Q8AVI9) RecName: Full=3-oxo-5-alpha-steroid 4-dehydr...7_1( EF537017 |pid:none) Oryzias latipes steroid 5-alpha-re... 58 1e-07 AF136720_1( AF136720 |pid:none) Canis familiaris prostatic

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-0683 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ycystic kidney disease 1 [Canis familiaris] NP_001006651.1 0.0 81% ... ...CBRC-BTAU-01-0683 ref|NP_001006651.1| polycystin 1 [Canis lupus familiaris] gb|AAM45378.1| polycystin 1; pol

  5. NCBI nr-aa BLAST: CBRC-PCAP-01-1446 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1446 ref|NP_001033695.1| chemokine (C-C motif) receptor 1 [Canis lupus... familiaris] dbj|BAE66670.1| chemokine (C-C motif) receptor 1 [Canis lupus familiaris] NP_001033695.1 1e-155 77% ...

  6. NCBI nr-aa BLAST: CBRC-PVAM-01-1085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1085 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-130 71% ...

  7. NCBI nr-aa BLAST: CBRC-STRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1304 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 3e-77 78% ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...

  9. NCBI nr-aa BLAST: CBRC-DRER-16-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-16-0068 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-119 65% ...

  10. NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  11. NCBI nr-aa BLAST: CBRC-PABE-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-07-0060 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  12. NCBI nr-aa BLAST: CBRC-LAFR-01-3535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3535 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-109 74% ...

  13. NCBI nr-aa BLAST: CBRC-PTRO-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0072 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  14. NCBI nr-aa BLAST: CBRC-HSAP-06-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0078 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-173 90% ...

  15. NCBI nr-aa BLAST: CBRC-MMUR-01-1296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1296 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...

  16. NCBI nr-aa BLAST: CBRC-CFAM-12-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0019 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 0.0 99% ...

  17. NCBI nr-aa BLAST: CBRC-OGAR-01-0872 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0872 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-171 89% ...

  18. NCBI nr-aa BLAST: CBRC-RMAC-04-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0054 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-174 91% ...

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...

  20. NCBI nr-aa BLAST: CBRC-CJAC-01-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0081 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-172 90% ...

  1. NCBI nr-aa BLAST: CBRC-PHAM-01-1272 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1272 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-119 88% ...

  2. NCBI nr-aa BLAST: CBRC-TSYR-01-1188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1188 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-145 89% ...

  3. NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-2271 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2271 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-144 78% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1922 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1922 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-126 73% ...

  6. NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...

  7. NCBI nr-aa BLAST: CBRC-TBEL-01-2041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2041 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Can...is lupus familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis familiaris] NP_001003037.1 1e-123 91% ...

  8. NCBI nr-aa BLAST: CBRC-OPRI-01-1433 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1433 ref|NP_001041572.1| G protein-coupled receptor 44 [Canis lupus fa...miliaris] emb|CAJ77887.1| G-protein coupled receptor [Canis lupus familiaris] NP_001041572.1 1e-133 66% ...

  9. NCBI nr-aa BLAST: CBRC-VPAC-01-1411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1411 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-31 37% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-08-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0127 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 5e-77 45% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...

  12. NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...

  13. NCBI nr-aa BLAST: CBRC-PVAM-01-0471 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0471 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-136 75% ...

  14. NCBI nr-aa BLAST: CBRC-MLUC-01-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0118 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 4e-64 52% ...

  15. NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...

  16. NCBI nr-aa BLAST: CBRC-GGOR-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0320 ref|NP_001003054.1| prostaglandin E2 receptor EP4 subtype [Canis lupus... familiaris] gb|AAF00470.1|AF177934_1 prostaglandin E2 receptor EP4 subtype [Canis lupus familiaris] NP_001003054.1 3e-91 87% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-1851 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1851 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-147 73% ...

  19. NCBI nr-aa BLAST: CBRC-PCAP-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1445 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-164 87% ...

  20. NCBI nr-aa BLAST: CBRC-TSYR-01-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0145 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 4e-82 61% ...

  1. NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...

  2. NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...

  3. NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-1134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1134 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-137 77% ...

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-3181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-3181 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-153 94% ...

  7. NCBI nr-aa BLAST: CBRC-GGOR-01-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0009 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 77% ...

  8. NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...

  10. NCBI nr-aa BLAST: CBRC-PVAM-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1133 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 2e-61 92% ...

  11. NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...

  12. NCBI nr-aa BLAST: CBRC-RMAC-14-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0161 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 9e-90 72% ...

  13. NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...

  14. NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...

  15. NCBI nr-aa BLAST: CBRC-VPAC-01-1422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1422 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-101 64% ...

  16. NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...

  17. NCBI nr-aa BLAST: CBRC-LAFR-01-3197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-149 81% ...

  18. NCBI nr-aa BLAST: CBRC-PCAP-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0105 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-97 62% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0599 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0599 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-108 65% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-08-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0132 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-71 48% ...

  1. NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-1165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1165 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 6e-76 41% ...

  3. NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-1930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1930 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-69 59% ...

  5. NCBI nr-aa BLAST: CBRC-MLUC-01-0701 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0701 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-157 74% ...

  6. NCBI nr-aa BLAST: CBRC-CPOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1448 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-141 93% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

  8. NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...

  11. NCBI nr-aa BLAST: CBRC-PCAP-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0028 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-149 89% ...

  12. NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...

  13. NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...

  14. NCBI nr-aa BLAST: CBRC-TSYR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1175 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 73% ...

  15. NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...

  16. NCBI nr-aa BLAST: CBRC-PHAM-01-0220 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0220 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-153 89% ...

  17. NCBI nr-aa BLAST: CBRC-MDOM-08-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-08-0128 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 8e-62 45% ...

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...

  19. NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

  20. NCBI nr-aa BLAST: CBRC-MEUG-01-1021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1021 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-62 43% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-64 44% ...

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0140 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 4e-68 57% ...

  3. NCBI nr-aa BLAST: CBRC-LAFR-01-2049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2049 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-113 78% ...

  4. NCBI nr-aa BLAST: CBRC-TTRU-01-0899 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0899 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 86% ...

  5. NCBI nr-aa BLAST: CBRC-MMUR-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0421 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 7e-75 50% ...

  6. NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...

  7. NCBI nr-aa BLAST: CBRC-FCAT-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1055 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 4e-61 46% ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...

  9. NCBI nr-aa BLAST: CBRC-MEUG-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1732 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-178 83% ...

  10. NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...

  11. NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...

  12. NCBI nr-aa BLAST: CBRC-MMUR-01-0910 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0910 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 90% ...

  13. NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

  14. NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...

  15. NCBI nr-aa BLAST: CBRC-MEUG-01-1061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1061 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-61 44% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0869 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0869 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 2e-30 37% ...

  17. NCBI nr-aa BLAST: CBRC-FCAT-01-0865 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ycystic kidney disease 1 [Canis familiaris] NP_001006651.1 0.0 85% ... ...CBRC-FCAT-01-0865 ref|NP_001006651.1| polycystin 1 [Canis lupus familiaris] gb|AAM45378.1| polycystin 1; pol

  18. NCBI nr-aa BLAST: CBRC-TTRU-01-0331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0331 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 1e-136 65% ...

  19. NCBI nr-aa BLAST: CBRC-LAFR-01-3974 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3974 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-150 78% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-0808 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0808 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 1e-102 62% ...