WorldWideScience

Sample records for candidatus pelagibacter ubique

  1. Identification of candidate structured RNAs in the marine organism 'Candidatus Pelagibacter ubique'

    Directory of Open Access Journals (Sweden)

    Schwalbach Michael S

    2009-06-01

    Full Text Available Abstract Background Metagenomic sequence data are proving to be a vast resource for the discovery of biological components. Yet analysis of this data to identify functional RNAs lags behind efforts to characterize protein diversity. The genome of 'Candidatus Pelagibacter ubique' HTCC 1062 is the closest match for approximately 20% of marine metagenomic sequence reads. It is also small, contains little non-coding DNA, and has strikingly low GC content. Results To aid the discovery of RNA motifs within the marine metagenome we exploited the genomic properties of 'Cand. P. ubique' by targeting our search to long intergenic regions (IGRs with relatively high GC content. Analysis of known RNAs (rRNA, tRNA, riboswitches etc. shows that structured RNAs are significantly enriched in such IGRs. To identify additional candidate structured RNAs, we examined other IGRs with similar characteristics from 'Cand. P. ubique' using comparative genomics approaches in conjunction with marine metagenomic data. Employing this strategy, we discovered four candidate structured RNAs including a new riboswitch class as well as three additional likely cis-regulatory elements that precede genes encoding ribosomal proteins S2 and S12, and the cytoplasmic protein component of the signal recognition particle. We also describe four additional potential RNA motifs with few or no examples occurring outside the metagenomic data. Conclusion This work begins the process of identifying functional RNA motifs present in the metagenomic data and illustrates how existing completed genomes may be used to aid in this task.

  2. Packet Reordering Procedure with Ubiquous Communication Systems

    Directory of Open Access Journals (Sweden)

    Giridhar Akula

    2012-11-01

    Full Text Available Satellite links are going to play a vital role in the deployment of ubiquous broad band systems. Non- Geostationary (NGEO satellite communication systems are more advantageous than terrestrial satellites. This paper presents an exchange of information on cooperation status among neiboring satellites. The new explicit load balancing scheme is used to avoid congestion and packet drops at the satellite. A TTL based algorithm is used for packet reordering.

  3. Structures of dimethylsulfoniopropionate-dependent demethylase from the marine organism Pelagabacter ubique

    Energy Technology Data Exchange (ETDEWEB)

    Schuller, David J.; Reisch, Chris R.; Moran, Mary Ann; Whitman, William B.; Lanzilotta, William N. (Cornell); (Georgia)

    2012-01-20

    Dimethylsulfoniopropionate (DMSP) is a ubiquitous algal metabolite and common carbon and sulfur source for marine bacteria. DMSP is a precursor for the climatically active gas dimethylsulfide that is readily oxidized to sulfate, sulfur dioxide, methanesulfonic acid, and other products that act as cloud condensation nuclei. Although the environmental importance of DMSP metabolism has been known for some time, the enzyme responsible for DMSP demethylation by marine bacterioplankton, dimethylsufoniopropionate-dependent demethylase A (DmdA, EC 2.1.1.B5), has only recently been identified and biochemically characterized. In this work, we report the structure for the apoenzyme DmdA from Pelagibacter ubique (2.1 {angstrom}), as well as for DmdA co-crystals soaked with substrate DMSP (1.6 {angstrom}) or the cofactor tetrahydrofolate (THF) (1.6 {angstrom}). Surprisingly, the overall fold of the DmdA is not similar to other enzymes that typically utilize the reduced form of THF and in fact is a triple domain structure similar to what has been observed for the glycine cleavage T protein or sarcosine oxidase. Specifically, while the THF binding fold appears conserved, previous biochemical studies have shown that all enzymes with a similar fold produce 5,10-methylene-THF, while DmdA catalyzes a redox-neutral methyl transfer reaction to produce 5-methyl-THF. On the basis of the findings presented herein and the available biochemical data, we outline a mechanism for a redox-neutral methyl transfer reaction that is novel to this conserved THF binding domain.

  4. Dicty_cDB: Contig-U11762-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10 ( CP000084 ) Candidatus Pelagibacter ubique HTCC1062, complete... 34 0.87 20 ( EF568108 ) Glossina pallidipes salivary gland hyper...trophy vi... 30 0.88 16 ( AF529435 ) Bombus morio 12S small subunit ribosomal RNA g

  5. Candidatus Coxiella massiliensis Infection

    OpenAIRE

    Angelakis, Emmanouil; Mediannikov, Oleg; Jos, Sarah-Lyne; Berenger, Jean-Michel; Parola, Philippe; Raoult, Didier

    2016-01-01

    Bacteria genetically related to Coxiella burnetii have been found in ticks. Using molecular techniques, we detected Coxiella-like bacteria, here named Candidatus Coxiella massiliensis, in skin biopsy samples and ticks removed from patients with an eschar. This organism may be a common agent of scalp eschar and neck lymphadenopathy after tick bite.

  6. Candidatus Coxiella massiliensis Infection.

    Science.gov (United States)

    Angelakis, Emmanouil; Mediannikov, Oleg; Jos, Sarah-Lyne; Berenger, Jean-Michel; Parola, Philippe; Raoult, Didier

    2016-02-01

    Bacteria genetically related to Coxiella burnetii have been found in ticks. Using molecular techniques, we detected Coxiella-like bacteria, here named Candidatus Coxiella massiliensis, in skin biopsy samples and ticks removed from patients with an eschar. This organism may be a common agent of scalp eschar and neck lymphadenopathy after tick bite. PMID:26811945

  7. The Utility and Ubiquity of Taboo Words.

    Science.gov (United States)

    Jay, Timothy

    2009-03-01

    Taboo words are defined and sanctioned by institutions of power (e.g., religion, media), and prohibitions are reiterated in child-rearing practices. Native speakers acquire folk knowledge of taboo words, but it lacks the complexity that psychological science requires for an understanding of swearing. Misperceptions persist in psychological science and in society at large about how frequently people swear or what it means when they do. Public recordings of taboo words establish the commonplace occurrence of swearing (ubiquity), although frequency data are not always appreciated in laboratory research. A set of 10 words that has remained stable over the past 20 years accounts for 80% of public swearing. Swearing is positively correlated with extraversion and Type A hostility but negatively correlated with agreeableness, conscientiousness, religiosity, and sexual anxiety. The uniquely human facility for swearing evolved and persists because taboo words can communicate emotion information (anger, frustration) more readily than nontaboo words, allowing speakers to achieve a variety of personal and social goals with them (utility). A neuro-psycho-social framework is offered to unify taboo word research. Suggestions for future research are offered. PMID:26158942

  8. Ubiquity of bisphenol A in the atmosphere

    International Nuclear Information System (INIS)

    Bisphenol A (BPA) is a suspected endocrine disruptor in the environment. However, little is known about its distribution and transport in the atmosphere. Here, the concentrations of BPA in the atmospheric aerosols from urban, rural, marine, and the polar regions were measured using solvent extraction/derivatization and gas chromatography/mass spectrometry technique. The concentrations of BPA (1-17,400 pg m-3) ranged over 4 orders of magnitude in the world with a declining trend from the continent (except for the Antarctica) to remote sites. A positive correlation was found between BPA and 1,3,5-triphenylbenzene, a tracer for plastic burning, in urban regions, indicating that the open burning of plastics in domestic waste should be a significant emission source of atmospheric BPA. Our results suggest that the ubiquity of BPA in the atmosphere may raise a requirement for the evaluation of health effects of BPA in order to control its emission sources, for example, from plastic burning. - This study gives first insight into the sources and global distributions of bisphenol A (BPA) in the atmosphere.

  9. Ubiquity of Polynucleobacter necessarius subspecies asymbioticus results from ecological diversification

    Czech Academy of Sciences Publication Activity Database

    Jezbera, Jan; Jezberová, Jitka; Brandt, U.; Hahn, M.W.

    2011-01-01

    Roč. 13, č. 4 (2011), s. 922-931. ISSN 1462-2912 R&D Projects: GA ČR(CZ) GAP504/10/0566; GA MŠk(CZ) MEB060901 Institutional research plan: CEZ:AV0Z60170517 Keywords : ubiquity * Polynucleobacter * ecological diversification Subject RIV: EE - Microbiology, Virology Impact factor: 5.843, year: 2011

  10. Natural variation in SAR11 marine bacterioplankton genomes inferred from metagenomic data

    OpenAIRE

    Wilhelm Larry J; Tripp H James; Givan Scott A; Smith Daniel P; Giovannoni Stephen J

    2007-01-01

    Abstract Background One objective of metagenomics is to reconstruct information about specific uncultured organisms from fragmentary environmental DNA sequences. We used the genome of an isolate of the marine alphaproteobacterium SAR11 ('Candidatus Pelagibacter ubique'; strain HTCC1062), obtained from the cold, productive Oregon coast, as a query sequence to study variation in SAR11 metagenome sequence data from the Sargasso Sea, a warm, oligotrophic ocean gyre. Results The average amino acid...

  11. Dicty_cDB: Contig-U02939-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U02939-1 (Conti...nenia stuttgartiensis genome... 111 6e-23 CP000084_201( CP000084 |pid:none) Candidatus Pelagibacter ubique...nces producing significant alignments: (bits) Value N ( BJ390552 ) Dictyostelium discoi...DN... 50 3e-20 5 ( EH431537 ) NPE00000865 Neocallimastix patriciarum ZAP II cDN... 48 4e-09 3 ( AR547284 ) Seque...8N13TV VUUBBa (VUH2) Vigna unguiculata geno... 46 3.2 1 ( EL929854 ) EST1483 ARS-CICGRU ONmgEST Ostrin

  12. Thermodynamic Explanation for the Cosmic Ubiquity of Organic Pigments

    CERN Document Server

    Michaelian, Karo

    2016-01-01

    There is increasingly more evidence being accumulated for the occurrence of large amounts of organic material in the cosmos, particularly in the form of aromatic compounds. These molecules can be found on the surface of Earth and Mars, in the atmospheres of the larger planets and on many of their satellites, on asteroids, comets, meteorites, the atmospheres of red giant stars, interstellar nebulae, and in the spiral arms of galaxies. Many of these environments are expected to be of low temperature and pressure, implying that the Gibbs free energy for the formation of these complex molecules should be positive and large, suggesting that their existence could only be attributed to non-equilibrium thermodynamic processes. In this article we first review the evidence for the abundance of these molecules in the cosmos and then describe how the ubiquity can be explained from within the framework of non-equilibrium thermodynamics on the basis of the catalytic properties of these pigment molecules in dissipating phot...

  13. Human attribute concepts: relative ubiquity across twelve mutually isolated languages.

    Science.gov (United States)

    Saucier, Gerard; Thalmayer, Amber Gayle; Bel-Bahar, Tarik S

    2014-07-01

    It has been unclear which human-attribute concepts are most universal across languages. To identify common-denominator concepts, we used dictionaries for 12 mutually isolated languages-Maasai, Supyire Senoufo, Khoekhoe, Afar, Mara Chin, Hmong, Wik-Mungkan, Enga, Fijian, Inuktitut, Hopi, and Kuna-representing diverse cultural characteristics and language families, from multiple continents. A composite list of every person-descriptive term in each lexicon was closely examined to determine the content (in terms of English translation) most ubiquitous across languages. Study 1 identified 28 single-word concepts used to describe persons in all 12 languages, as well as 41 additional terms found in 11 of 12. Results indicated that attribute concepts related to morality and competence appear to be as cross-culturally ubiquitous as basic-emotion concepts. Formulations of universal-attribute concepts from Osgood and Wierzbicka were well-supported. Study 2 compared lexically based personality models on the relative ubiquity of key associated terms, finding that 1- and 2-dimensional models draw on markedly more ubiquitous terms than do 5- or 6-factor models. We suggest that ubiquitous attributes reflect common cultural as well as common biological processes. PMID:24956320

  14. Potential psyllid vectors of 'Candidatus Phytoplasma mali' and 'Candidatus Phytoplasma pyri' in Turkey

    OpenAIRE

    Serce, Çigdem Ulubas; Gazel, Mona; Caglayan, Kadriye; Sauvion, Nicolas

    2016-01-01

    Psyllids are vectors of phytoplasma, which cause important diseases of pome fruit trees. Psyllid species reported as phytoplasma vectors were captured during 2010–2011 in several pome fruit growing regions in Turkey. Potential psyllid vectors of ‘Candidatus Phytoplasma mali’ were collected from Malus spp. (apple), Cydonia oblonga (quince), Crataegus spp. (hawthorn) and also from the overwintering hosts, whereas those of ‘Candidatus Phytoplasma pyri’ were collected from wild and cultured forms...

  15. The development of web service for the Ubiquiti mFi device data access

    OpenAIRE

    Vuk, Zdenko

    2014-01-01

    The purpose of thesis is to present the development of a web service which eliminates the problems when using the mFi products of the company Ubiquiti Networks, inc. The problems are mainly the limited functionality offered by the software bundled with these devices. The webservice uses the communication protocol SOAP. Additionally and we encountered a relatively unknown database management system named MongoDB. Ubiquiti mFi is a family of gadgets to monitor events in buildings. The protoc...

  16. Candidatus Competibacter’-lineage genomes retrieved from metagenomes reveal functional metabolic diversity

    DEFF Research Database (Denmark)

    McIlroy, Simon Jon; Albertsen, Mads; Andresen, Eva Kammer;

    2014-01-01

    theoretically reduces the EBPR capacity. In this study, two complete genomes from Competibacter were obtained from laboratory-scale enrichment reactors through metagenomics. Phylogenetic analysis identified the two genomes, ‘Candidatus Competibacter denitrificans’ and ‘Candidatus Contendobacter odensis...

  17. Influence of study in hee on ubiquity and strength of students’ computer gambling

    Directory of Open Access Journals (Sweden)

    Kudryavtsev M.D.

    2016-06-01

    Full Text Available Purpose: to clear up effectiveness of learning-education process for counteraction of students’ harmful passion to computer games’ ubiquity. Material: 1st - 3rd year students (main health group were the objects of the research. In total they were 952 boys and 523 girls. In 1st year students’ academic groups testing was carried out ant the beginning of academic year (October; in academic groups of 1st-3rd year students the testing was at the end of academic year (May. Results: it was found that among 1st year boy students ubiquity of computer gaming as well as time losses, connected with it are higher than among girl students. Educational process is not sufficiently effective in struggle against computer gaming. For girls, this passion is not dangerous in general. In the course of study at HEE, the strength of this passion reduces independent on sex. Conclusions: for increase of educational process’s effectiveness and improvement of students’ life quality it is necessary to consider personal features of boy students as well as to organize health related measures with the help of health related physical culture means.

  18. Complete genome sequence of ‘Candidatus Liberibacter africanus’

    Science.gov (United States)

    The complete genome sequence of ‘Candidatus Liberibacter africanus’ (Laf), strain ptsapsy, was obtained by an Illumina HiSeq 2000. The Laf genome comprises 1,192,232 nucleotides, 34.5% GC content, 1,141 predicted coding sequences, 44 tRNAs, 3 complete copies of ribosomal RNA genes (16S, 23S and 5S) ...

  19. Clues into the metagenome of huanglongbing infected citrus by analysis of ancillary sequences from Ion Torrent whole genome Candidatus Liberibacter asiaticus sequencing

    Science.gov (United States)

    Huanglongbing (HLB) is a globally devastating disease of citrus. Presently, three etiological agents are associated with HLB and include; Candidatus Liberibacter asiaticus (CLas), Candidatus Liberibacter americanus; and Candidatus Liberibacter africanus. Attempts to determine alternate (non-Liberi...

  20. Microbiology of ‘Candidatus Accumulibacter’ in activated sludge

    OpenAIRE

    He, Shaomei; McMahon, Katherine D.

    2011-01-01

    Summary ‘Candidatus Accumulibacter’ is a biotechnologically important bacterial group that can accumulate large amounts of intracellular polyphosphate, contributing to biological phosphorus removal in wastewater treatment. Since its first molecular identification more than a decade ago, this bacterial group has drawn significant research attention due to its high abundance in many biological phosphorus removal systems. In the past 6 years, our understanding of Accumulibacter microbiology and ...

  1. Characterization of putative virulent factors of Candidatus Liberibacter asiaticus

    OpenAIRE

    Ying, Xiaobao; Wang, Nian

    2014-01-01

    Citrus greening or huanglongbing (HLB) is a devastating disease of citrus, and poses a major threat to the citrus industry in the United States (1, 2). Candidatus Liberibacter asiaticus has been known to be associated with HLB in the United States (3, 4).  Unsuccessful attempts to culture Ca. L. asiaticus have notably hampered efforts to understand its biology and pathogenesis mechanism despite some limited progresses in culturing.  In order to characterize the putative virulence factors, we ...

  2. Environmental distribution and population biology of Candidatus Accumulibacter, a primary agent of Biological Phosphorus Removal

    OpenAIRE

    Peterson, S. Brook; Warnecke, Falk; Madejska, Julita; McMahon, Katherine D.; Hugenholtz, Philip

    2008-01-01

    Members of the uncultured bacterial genus Candidatus Accumulibacter are capable of intracellular accumulation of inorganic phosphate (Pi) in activated sludge wastewater treatment plants (WWTPs) performing enhanced biological phosphorus removal (EBPR), but were also recently shown to inhabit freshwater and estuarine sediments. Additionally, metagenomic sequencing of two bioreactor cultures enriched in Candidatus Accumulibacter, but housed on separate continents, revealed the potential for glob...

  3. Greigite magnetosome membrane ultrastructure in 'Candidatus Magnetoglobus multicellularis'.

    Science.gov (United States)

    Abreu, Fernanda P; Silva, Karen T; Farina, Marcos; Keim, Carolina N; Lins, Ulysses

    2008-06-01

    The ultrastructure of the greigite magnetosome membrane in the multicellular magnetotactic bacteria 'Candidatus Magnetoglobus multicellularis' was studied. Each cell contains 80 membrane-enclosed iron-sulfide magnetosomes. Cytochemistry methods showed that the magnetosomes are enveloped by a structure whose staining pattern and dimensions are similar to those of the cytoplasmic membrane, indicating that the magnetosome membrane likely originates from the cytoplasmic membrane. Freeze-fracture showed intramembrane particles in the vesicles surrounding each magnetosome. Observations of cell membrane invaginations, the trilaminar membrane structure of immature magnetosomes, and empty vesicles together suggested that greigite magnetosome formation begins by invagination of the cell membrane, as has been proposed for magnetite magnetosomes. PMID:18645957

  4. "Candidatus Phytoplasma americanum", a phytoplasma associated with a potato purple top wilt disease complex.

    Science.gov (United States)

    Lee, Ing-Ming; Bottner, Kristi D; Secor, Gary; Rivera-Varas, Viviana

    2006-07-01

    Potato purple top wilt (PPT) is a devastating disease that occurs in various regions of North America and Mexico. At least three distinct phytoplasma strains belonging to three different phytoplasma groups (16SrI, 16SrII and 16SrVI) have been associated with this disease. A new disease with symptoms similar to PPT was recently observed in Texas and Nebraska, USA. Two distinct phytoplasma strain clusters were identified. One belongs to the 16SrI phytoplasma group, subgroup A, and the other is a novel phytoplasma that is most closely related to, and shares 96.6 % 16S rRNA gene sequence similarity with, a member of group 16SrXII. Phylogenetic analysis of 16S rRNA gene sequences of the novel PPT-associated phytoplasma strains, previously described 'Candidatus Phytoplasma' organisms and other distinct unnamed phytoplasmas indicated that the novel phytoplasma, termed American potato purple top wilt (APPTW) phytoplasma, represents a distinct lineage and shares a common ancestor with stolbur phytoplasma, "Candidatus Phytoplasma australiense", "Candidatus Phytoplasma japonicum", "Candidatus Phytoplasma fragariae", bindweed yellows phytoplasma (IBS), "Candidatus Phytoplasma caricae" and "Candidatus Phytoplasma graminis". On the basis of unique 16S rRNA gene sequences and biological properties, it is proposed that the APPTW phytoplasma represents "Candidatus Phytoplasma americanum", with APPTW12-NE as the reference strain. PMID:16825635

  5. Prevalence of 'Candidatus Accumulibacter phosphatis' type II under phosphate limiting conditions.

    Science.gov (United States)

    Welles, L; Lopez-Vazquez, C M; Hooijmans, C M; van Loosdrecht, M C M; Brdjanovic, D

    2016-12-01

    P-limitation in enhanced biological phosphorus removal (EBPR) systems fed with acetate, has generally been considered as a condition leading to enrichment of organisms of the genotype' Candidatus Competibacter phosphatis' expressing the glycogen-accumulating organisms (GAO) phenotype. Recent studies have demonstrated in short-term experiments that organisms of the genotype 'Candidatus Accumulibacter phosphatis' clade I and II, known to express the polyphosphate-accumulating organisms (PAO) phenotype can switch to the GAO phenotype when poly-P is absent, but are performing the HAc-uptake at lower kinetic rates, where clade I showed the lowest rates. The objective of this study was to verify whether organisms of the genotype 'Candidatus Accumulibacter phosphatis' can also be enriched under P-limiting conditions while expressing a GAO phenotype and more specifically to see which specific clade prevails. A sequencing batch reactor was inoculated with activated sludge to enrich an EBPR culture for a cultivation period of 128 days (16 times the solids retention time) under P-limiting conditions. A mixed culture was obtained comprising of 49 % 'Candidatus Accumulibacter phosphatis' clade II and 46 % 'Candidatus Competibacter phosphatis'. The culture performed a full GAO metabolism for anaerobic HAc-uptake, but was still able to switch to a PAO metabolism, taking up excessive amounts of phosphate during the aerobic phase when it became available in the influent. These findings show that P-limitation, often used as strategy for enrichment of 'Candidatus Competibacter phosphatis', does not always lead to enrichment of only 'Candidatus Competibacter phosphatis'. Furthermore, it demonstrates that 'Candidatus Accumulibacter phosphatis' are able to proliferate in activated sludge systems for periods of up to 128 days or longer when the influent phosphate concentrations are just enough for assimilation purposes and no poly-P is formed. The 'Candidatus Accumulibacter

  6. Characterization of an ATP/ADP translocase in the citrus huanglongbing bacterium, Candidatus Liberibacter

    Science.gov (United States)

    Citrus huanglongbing (HLB), a disease currently threatening the citrus industry worldwide, has been associated with three different species of Alphaproteobacteria known as Candidatus Liberibacter. A complete genome sequence was recently obtained via metagenomics for Ca. L. asiaticus (Las), the prom...

  7. Sequence analysis of Candidatus Liberibacter solanacearum (Lso-C) isolated from carrot psyllids collected in Scandinavia

    Science.gov (United States)

    The fastidious prokaryote Candidatus Liberibacter solanacearum (Lso), transmitted by the tomato potato psyllid (Bactericera cockerelli), is associated with the Zebra Chip disease of potato. Plants infected with Liberibacter may experience significant yield losses and these plants also serve as pote...

  8. Transcriptome Analysis of “Candidatus Liberibacter solanacearum” in Its Psyllid Vector, Bactericera cockerelli

    OpenAIRE

    Ibanez, Freddy; Levy, Julien; Tamborindeguy, Cecilia

    2014-01-01

    Candidatus Liberibacter solanacearum” (Lso) is an emergent pathogen of carrots in Europe and solanaceous plants in North and Central America and New Zealand. This bacterium is closely related to other pathogenic Candidatus Liberibacter spp., all vectored by psyllids. In order to understand the molecular interaction of this pathogen and its psyllid vector, Bactericera cockerelli, Illumina sequencing of psyllid harboring Lso was performed to determine if this approach could be used to assess t...

  9. Ubiquity of .i.Polynucleobacter necessarius./i. ssp. .i.asymbioticus./i. in lentic freshwater habitats of a heterogenous 2000 km.sup.2./sup. area

    Czech Academy of Sciences Publication Activity Database

    Jezberová, Jitka; Jezbera, Jan; Brandt, U.; Lindström, E.S.; Langenheder, S.; Hahn, M.W.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 658-669. ISSN 1462-2912. [SAME /11./. Piran, 30.08.09-05.09.09] R&D Projects: GA ČR(CZ) GA206/08/0015 Institutional research plan: CEZ:AV0Z60170517 Keywords : Polynucleobacter * ubiquity * ecotype Subject RIV: EE - Microbiology, Virology Impact factor: 5.537, year: 2010

  10. Draft Genome Sequence of “Candidatus Hamiltonella defensa,” an Endosymbiont of the Whitefly Bemisia tabaci

    OpenAIRE

    Rao, Qiong; Wang, Shuang; Su, Yun-Lin; Bing, Xiao-Li; Liu, Shu-Sheng; Wang, Xiao-Wei

    2012-01-01

    Candidatus Hamiltonella defensa” is a facultative endosymbiont of the whitefly Bemisia tabaci. Herein, we report the first draft genome sequence of “Candidatus Hamiltonella defensa” from the invasive Mediterranean cryptic species of the B. tabaci complex. The 1.84-Mbp genome sequence comprises 404 contigs and contains 1,806 predicted protein-coding genes.

  11. Transcriptional Analyses of Mandarins Seriously Infected by 'Candidatus Liberibacter asiaticus'.

    Science.gov (United States)

    Xu, Meirong; Li, Ya; Zheng, Zheng; Dai, Zehan; Tao, Yang; Deng, Xiaoling

    2015-01-01

    A range of leaf symptoms, including blotchy mottle, yellowing, and small, upright leaves with a variety of chlorotic patterns resembling those induced by zinc deficiencies, are associated with huanglongbing (HLB, yellow shoot disease), a worldwide destructive citrus disease. HLB is presumably caused by the phloem-limited fastidious prokaryotic α-proteobacterium 'Candidatus Liberibacter spp.' Previous studies focused on the proteome and transcriptome analyses of citrus 5 to 35 weeks after 'Ca. L. spp.' inoculation. In this study, gene expression profiles were analyzed from mandarin Citrus reticulate Blanco cv. jiaogan leaves after a 2 year infection with 'Ca. L. asiaticus'. The Affymetrix microarray analysis explored 2,017 differentially expressed genes. Of the 1,364 genes had known functions, 938 (46.5%) were up-regulated. Genes related to photosynthesis, carbohydrate metabolic, and structure were mostly down-regulated, with rates of 92.7%, 61.0%, and 80.2%, respectively. Genes associated with oxidation-reduction and transport were mostly up-regulated with the rates of 75.0% and 64.6%, respectively. Our data analyses implied that the infection of 'Ca. L. asiaticus' could alter hormone crosstalk, inducing the jasmine acid pathway and depressing the ethylene and salicylic acid pathways in the citrus host. This study provides an enhanced insight into the host response of citrus to 'Ca. L. asiaticus' infection at a two-years infection stage. PMID:26196297

  12. Transcriptional Analyses of Mandarins Seriously Infected by 'Candidatus Liberibacter asiaticus'.

    Directory of Open Access Journals (Sweden)

    Meirong Xu

    Full Text Available A range of leaf symptoms, including blotchy mottle, yellowing, and small, upright leaves with a variety of chlorotic patterns resembling those induced by zinc deficiencies, are associated with huanglongbing (HLB, yellow shoot disease, a worldwide destructive citrus disease. HLB is presumably caused by the phloem-limited fastidious prokaryotic α-proteobacterium 'Candidatus Liberibacter spp.' Previous studies focused on the proteome and transcriptome analyses of citrus 5 to 35 weeks after 'Ca. L. spp.' inoculation. In this study, gene expression profiles were analyzed from mandarin Citrus reticulate Blanco cv. jiaogan leaves after a 2 year infection with 'Ca. L. asiaticus'. The Affymetrix microarray analysis explored 2,017 differentially expressed genes. Of the 1,364 genes had known functions, 938 (46.5% were up-regulated. Genes related to photosynthesis, carbohydrate metabolic, and structure were mostly down-regulated, with rates of 92.7%, 61.0%, and 80.2%, respectively. Genes associated with oxidation-reduction and transport were mostly up-regulated with the rates of 75.0% and 64.6%, respectively. Our data analyses implied that the infection of 'Ca. L. asiaticus' could alter hormone crosstalk, inducing the jasmine acid pathway and depressing the ethylene and salicylic acid pathways in the citrus host. This study provides an enhanced insight into the host response of citrus to 'Ca. L. asiaticus' infection at a two-years infection stage.

  13. Predictive sequence analysis of the Candidatus Liberibacter asiaticus proteome.

    Directory of Open Access Journals (Sweden)

    Qian Cong

    Full Text Available Candidatus Liberibacter asiaticus (Ca. L. asiaticus is a parasitic gram-negative bacterium that is closely associated with Huanglongbing (HLB, a worldwide citrus disease. Given the difficulty in culturing the bacterium and thus in its experimental characterization, computational analyses of the whole Ca. L. asiaticus proteome can provide much needed insights into the mechanisms of the disease and guide the development of treatment strategies. In this study, we applied state-of-the-art sequence analysis tools to every Ca. L. asiaticus protein. Our results are available as a public website at http://prodata.swmed.edu/liberibacter_asiaticus/. In particular, we manually curated the results to predict the subcellular localization, spatial structure and function of all Ca. L. asiaticus proteins (http://prodata.swmed.edu/liberibacter_asiaticus/curated/. This extensive information should facilitate the study of Ca. L. asiaticus proteome function and its relationship to disease. Pilot studies based on the information from our website have revealed several potential virulence factors, discussed herein.

  14. Population Structures of 'Candidatus Liberibacter asiaticus' in Southern China.

    Science.gov (United States)

    Ma, W; Liang, M; Guan, L; Xu, M; Wen, X; Deng, X; Chen, J

    2014-02-01

    Huanglongbing (HLB) is a highly detrimental citrus disease associated with 'Candidatus Liberibacter asiaticus', a nonculturable alpha-proteobacterium. Characterization of the bacterial populations is important for development of disease management strategies. In this study, the 'Ca. L. asiaticus' populations in eight provinces in southern China where HLB is endemic were analyzed based on tandem repeat number (TRN) variations in a previously characterized genomic locus CLIBASIA_01645. Of the 224 HLB samples collected, 175 (78.3%) samples yielded single polymerase chain reaction (PCR) amplicons (the single amplicon group, SAG) and 49 (21.7%) samples produced multiple PCR amplicons (the multiple amplicon group, MAG). Variations in SAG are summarized by Nei's diversity index (H) and ratio of TRN ≤ 10/TRN > 10 genotypes (R10). Variations in the MAG are described by the percentage of occurrence (PMAG). At an orchard-level comparison, the 'Ca. L. asiaticus' population from a Guangdong orchard (n = 24) showed H = 0.50, R10 = 23, and PMAG = 0, significantly different from that of the non-Guangdong orchards in Yunnan (n = 23), H = 0.83, R10 = 2.3, and PMAG = 11.5, and in Hainan (n = 35), H = 0.88, R10 = 1.5, and PMAG = 16.7. In a region-level consideration, the Guangdong 'Ca. L. asiaticus' population (n = 78) was H = 0.77, R10 = 25, and PMAG = 1.3, whereas the non-Guangdong population (n = 84) was H = 0.91, R10 = 1.6, and PMAG = 26.9. Overall, significant differences were observed between the 'Ca. L. asiaticus' population from Guangdong Province and those from the other provinces. A strong aggregation of TRN = 6, 7, and 8 genotypes is characteristic to the 'Ca. L. asiaticus' population in Guangdong. Referenced to genome annotation, we propose that rearrangement of tandem repeats at locus CLIBASIA_01645 could be associated with bacterial environmental adaptation. PMID:24093922

  15. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from Guangdong, China

    OpenAIRE

    Z. Zheng; Deng, X.; J. Chen

    2014-01-01

    The draft genome sequence of “Candidatus Liberibacter asiaticus” strain A4, isolated from a mandarin citrus in Guangdong, People’s Republic of China, is reported. The A4 strain has a genome size of 1,208,625 bp, G+C content of 36.4%, 1,107 predicted open reading frames, and 53 RNA genes.

  16. Draft Genome Sequence of “Candidatus Liberibacter asiaticus” from Diaphorina citri in Guangdong, China

    OpenAIRE

    Wu, F.; Z. Zheng; Deng, X.; Cen, Y.; Liang, G; J. Chen

    2015-01-01

    The draft genome sequence of “Candidatus Liberibacter asiaticus” strain YCPsy from an Asian citrus psyllid (Diaphorina citri) in Guangdong, China, is reported here. The YCPsy strain has a genome size of 1,233,647 bp, 36.5% G+C content, 1,171 open reading frames (ORFs), and 53 RNAs.

  17. Draft Genome Sequence of “Candidatus Liberibacter americanus” Bacterium Associated with Citrus Huanglongbing in Brazil

    OpenAIRE

    Lin, Hong; Coletta-Filho, Helvecio D; Han, Cliff S.; Lou, Binghai; Civerolo, Edwin L; Machado, Marcos A; Gupta, Goutam

    2013-01-01

    We report here the draft genome sequence of “Candidatus Liberibacter americanus” strain PW_SP. The 1,176,071-bp genome, with 31.6% G+C content, comprises 948 open reading frames, 38 tRNAs, and three complete rRNAs.

  18. SSR-based Genetic Analysis of “Candidatus Liberibacter asiaticus” isolates from Multiple Continents.

    Science.gov (United States)

    Huanglongbing (HLB) is one of the most devastating citrus diseases that threaten citrus production worldwide. The causal agents are believed to be Candidatus Liberibacter spp. Although substantial efforts have been made toward detection of the presumed pathogens, information regarding to the patho...

  19. Further evidence that U. S. and China populations of “Candidatus Liberibacter asiaticus” are different

    Science.gov (United States)

    Citrus Huanglongbing (HLB) is associated with “Candidatus Liberibacter asiaticus”. Many efforts to detect genetic variation of “Ca. L. asiaticus” in conserved genomic loci such as 16s rDNA have not been successful. A genomic locus with short tandem repeats distinguished “Ca. L. asiaticus” populatio...

  20. Quantitative Distribution of Candidatus Liberibacter asiaticus in Citrus Plants and Fruits Infected by Citrus Huanglongbing

    Science.gov (United States)

    Citrus huanglongbing (HLB), or greening disease, is caused by any of three non culturable Gram-negative bacteria belonging to Candidatus Liberibacter spp. The pathogens are transmitted by citrus psyllids to all commercial varieties of citrus. The diseases are lethal and have recently become widespr...

  1. Whole-genome sequence of “Candidatus Liberibacter solanacearum” strain R1 from California

    Science.gov (United States)

    The draft whole-genome sequence of “Candidatus Liberibacter solanacearum” strain R1, isolated from a tomato plant in California, United States, is reported. The R1 strain genome is 1,204,257 bp in size (G+C content of 35.3%), encoding 1,101 open reading frames and 57 RNA genes....

  2. Should ‘Candidatus Phytoplasma’ be retained within the order Acholeplasmatales?

    Science.gov (United States)

    Phytoplasmas are a diverse but phylogenetically coherent group of cell wall-less bacteria affiliated with the class Mollicutes. Due to difficulties in establishing axenic culture crucial for polyphasic characterization, phytoplasmas were assigned to a provisional genus, ‘Candidatus Phytoplasma’, an...

  3. First Report of “Candidatus Liberibacter asiaticus” Associated with Huanglongbing in Ethiopia

    Science.gov (United States)

    Huanglongbing (HLB) is the most serious disease of citrus worldwide. Three different “Candidatus Liberibacter” species are associated with HLB: “Ca. Liberibacter asiaticus” (Las), “Ca. L. africanus” (Laf), and “Ca. L. americanus” (1). In Africa, Laf and its vector Trioza erytreae are reported in Sou...

  4. Complete Genome Sequence of "Candidatus Viadribacter manganicus" Isolated from a German Floodplain Area.

    Science.gov (United States)

    Braun, Burga; Szewzyk, Ulrich

    2016-01-01

    Iron- and manganese-depositing bacteria occur in many soils and all water systems, and their biogenic depositions of ochre in technical systems may cause severe clogging problems and monetary losses. "Candidatus Viadribacter manganicus" is a small coccoid, iron- and manganese-depositing bacterium isolated from the Lower Oder Valley National Park, Germany. PMID:27587815

  5. Transcriptomic, proteomic and nutritional analyses of potatoes in response to ‘Candidatus Liberibacter solanacearum’ infection

    Science.gov (United States)

    Zebra chip (ZC) is an emerging destructive disease stymying potato production in several parts of the world including the U.S. The disease is associated with the phloem-limited a-protobacterium, ‘Candidatus Liberibacter solanacearum’ (Lso), which is transmitted by the potato psyllid, Bactericera coc...

  6. Draft genome sequence of “Candidatus Liberibacter solanacearum” from a single potato psyllid in California

    Science.gov (United States)

    The draft genome sequence of “Candidatus Liberibacter solanacearum” strain RSTM from a potato psyllid (Bactericera cockerelli) in California is reported. The RSTM strain has the genome size of 1,286,787 bp, GC content of 35.1%, 1,211 predicted open reading frames (ORFs), and 43 RNA genes....

  7. Draft Genome Sequence of "Candidatus Methylacidiphilum kamchatkense" Strain Kam1, a Thermoacidophilic Methanotrophic Verrucomicrobium.

    Science.gov (United States)

    Erikstad, Helge-André; Birkeland, Nils-Kåre

    2015-01-01

    "Candidatus Methylacidiphilum kamchatkense" strain Kam1 is an aerobic methane-oxidizing thermoacidophilic bacterium belonging to the Verrucomicrobia phylum. It was recovered from an acidic geothermal site in Uzon Caldera, Kamchatka, Russian Federation. Its genome possesses three complete pmoCAB gene clusters encoding particulate methane monooxygenase enzymes and a complete Calvin-Benson-Bassham cycle for carbon assimilation. PMID:25745002

  8. Draft Genome Sequence of "Candidatus Methylacidiphilum kamchatkense" Strain Kam1, a Thermoacidophilic Methanotrophic Verrucomicrobium.

    OpenAIRE

    Erikstad, Helge Andre; Birkeland, Nils-Kåre

    2015-01-01

    "Candidatus Methylacidiphilum kamchatkense" strain Kam1 is an aerobic methane-oxidizing thermoacidophilic bacterium belonging to the Verrucomicrobia phylum. It was recovered from an acidic geothermal site in Uzon Caldera, Kamchatka, Russian Federation. Its genome possesses three complete pmoCAB gene clusters encoding particulate methane monooxygenase enzymes and a complete Calvin-Benson-Bassham cycle for carbon assimilation.

  9. Viability of ‘Candidatus Liberibacter asiaticus’ prolonged by addition of citrus juice to culture medium

    Science.gov (United States)

    Huanglongbing, or citrus greening disease, is associated with infection by the phloem-limited bacterium ‘Candidatus Liberibacter asiaticus’ (LAS). Infection with LAS, vectored by the Asian citrus psyllid (Diaphorina citri), is incurable; therefore, knowledge regarding LAS biology and pathogenesis is...

  10. Complete Genome sequence of citrus huanglongbing bacterium, ‘Candidatus Liberibacter asiaticus’ obtained through metagenomics

    Science.gov (United States)

    Citrus huanglongbing (HLB) is the most destructive disease of citrus worldwide. It is spread by the citrus psyllids (Diaphorina citri and Trioza erytreae), and is associated with low-titer, phloem-limited infections by any of the three uncultured species of a-Proteobacteria: 'Candidatus Liberibact...

  11. Complete genome sequence of chinese strain of ‘Candidatus Liberibacter asiaticus’

    Science.gov (United States)

    The complete genome sequence of ‘Candidatus Liberibacter asiaticus’ strain (Las) Guangxi-1(GX-1) was obtained by an Illumina HiSeq 2000. The GX-1 genome comprises 1,268,237 nucleotides, 36.5 % GC content, 1,141 predicted coding sequences, 44 tRNAs, 3 complete copies of ribosomal RNA genes (16S, 23S ...

  12. First Report of ‘Candidatus Liberibacter solanacearum’ Associated with Psyllid-Infested Carrots in Germany

    Science.gov (United States)

    Carrot plants with symptoms resembling those associated with the bacterium “Candidatus Liberibacter solanacearum” were observed in commercial carrot fields in Lower Saxony, Germany in September 2014. The fields were infested with the carrot psyllid Trioza apicalis and the infection rate was about 50...

  13. Transmission and Propagation of ‘Candidatus Liberibacter asiaticus’ by Grafting with Individual Citrus Leaves

    Science.gov (United States)

    Huanglongbing (HLB) is a chronic, progressive decline disease in citrus associated with systemic infection by the bacterium Candidatus Liberibacter asiaticus (CLas). Transmission in the field is by the Asian citrus psyllid (ACP), Diaphorina citri, Kuwayama. Experimental propagation of CLas is done c...

  14. First report of 'Candidatus Liberibacter solanacearum' associated with psyllid-affected carrots in Norway

    Science.gov (United States)

    Carrot (Daucus carota) plants with symptoms resembling those associated with the carrot psyllid Trioza apicalis and the bacterium “Candidatus Liberibacter solanacearum” were observed in 70-80% of commercial fields and experimental plots in southeastern Norway from late July to mid-September 2011; al...

  15. Relationship between plant vascular architecture and within-plant distribution of 'Candidatus Liberibacter solanacearum' in potato

    Science.gov (United States)

    Candidatus Liberibacter solanacearum” is an important pathogen of Solanaceous crops that causes zebra chip disease of potato. This pathogen is transmitted among plants by the potato psyllid Bactericera cockerelli. Within-plant variability in Liberibacter infection impedes the ability to detect Lib...

  16. First detection of tick-borne "Candidatus Neoehrlichia mikurensis" in Denmark 2011

    DEFF Research Database (Denmark)

    Fertner, Mette Ely; Mølbak, Lars; Pihl, Thomas Peter Boye;

    2012-01-01

    This is the first reporting of the tick-borne zoonotic bacterium "Candidatus Neoehrlichia mikurensis" in Denmark. A total of 2,625 Ixodes ricinus ticks from 58 locations in Denmark were collected and analysed for "Ca. Neoehrlichia mikurensis". A nested PCR revealed the presence of the bacterium at...... three geographically separate locations, which indicates that it is widely established in ticks....

  17. First report of 'Candidatus Liberibacter solanacearum' associated with psyllid-affected tobacco in Nicaragua

    Science.gov (United States)

    In April of 2012, tobacco plants with symptoms resembling those associated with the bacterium “Candidatus Liberibacter solanacearum” (Lso) were observed in commercial fields in several Departments in Nicaragua, including Esteli and Nueva Segovia; all cultivars grown were affected, at about 5 to 100%...

  18. Draft Genome Sequence of "Candidatus Mycoplasma haemobos," a Hemotropic Mycoplasma Identified in Cattle in Mexico.

    Science.gov (United States)

    Martínez-Ocampo, Fernando; Rodríguez-Camarillo, Sergio D; Amaro-Estrada, Itzel; Quiroz-Castañeda, Rosa Estela

    2016-01-01

    We present here the draft genome sequence of the first "Candidatus Mycoplasma haemobos" strain found in cattle in Mexico. This hemotropic mycoplasma causes acute and chronic disease in animals. This genome is a starting point for studying the role of this mycoplasma in coinfections and synergistic mechanisms associated with the disease. PMID:27389272

  19. Draft Genome Sequence of "Candidatus Liberibacter asiaticus" from a Citrus Tree in San Gabriel, California.

    Science.gov (United States)

    Wu, F; Kumagai, L; Liang, G; Deng, X; Zheng, Z; Keremane, M; Chen, J

    2015-01-01

    The draft genome sequence of "Candidatus Liberibacter asiaticus" strain SGCA5 from an orange citrus tree in San Gabriel, California, is reported here. SGCA5 has a genome size of 1,201,445 bp, a G+C content of 36.4%, 1,152 predicted open reading frames (ORFs), and 42 RNA genes. PMID:26701083

  20. Complete Genome Sequence of "Candidatus Liberibacter africanus," a Bacterium Associated with Citrus Huanglongbing.

    Science.gov (United States)

    Lin, Hong; Pietersen, Gerhard; Han, Cliff; Read, David Alan; Lou, Binghai; Gupta, Goutam; Civerolo, Edwin L

    2015-01-01

    We report here the complete genome sequence of "Candidatus Liberibacter africanus" strain PTSAPSY. The 1,192,232-bp genome with 34.5% G+C content comprises 1,017 open reading frames, 44 tRNAs, and three complete rRNAs in a circular chromosome. PMID:26184931

  1. Draft Genome Sequence of "Candidatus Liberibacter asiaticus" from Diaphorina citri in Guangdong, China.

    Science.gov (United States)

    Wu, F; Zheng, Z; Deng, X; Cen, Y; Liang, G; Chen, J

    2015-01-01

    The draft genome sequence of "Candidatus Liberibacter asiaticus" strain YCPsy from an Asian citrus psyllid (Diaphorina citri) in Guangdong, China, is reported here. The YCPsy strain has a genome size of 1,233,647 bp, 36.5% G+C content, 1,171 open reading frames (ORFs), and 53 RNAs. PMID:26543132

  2. Influence of nitrite accumulation on "Candidatus Accumulibacter" population structure and enhanced biological phosphorus removal from municipal wastewater.

    Science.gov (United States)

    Zeng, Wei; Li, Boxiao; Wang, Xiangdong; Bai, Xinlong; Peng, Yongzhen

    2016-02-01

    A modified University of Cape Town (MUCT) process was used to treat real municipal wastewater with low carbon to nitrogen ratio (C/N). To our knowledge, this is the first study where the influence of nitrite accumulation on "Candidatus Accumulibacter" clade-level population structure was investigated during nitritation establishment and destruction. Real time quantitative PCR assays were conducted using the polyphosphate kinase 1 gene (ppk1) as a genetic marker. Abundances of total "Candidatus Accumulibacter", the relative distributions and population structure of the five "Candidatus Accumulibacter" clades were characterized. Under complete nitrification, clade I using nitrate as electron acceptor was below 5% of total "Candidatus Accumulibacter". When the reactor was transformed into nitritation, clade I gradually disappeared. Clade IID using nitrite as electron acceptor for denitrifying phosphorus (P) removal was always the dominant "Candidatus Accumulibacter" throughout the operational period. This clade was above 90% on average in total "Candidatus Accumulibacter", even up to nearly 100%, which was associated with good performance of denitrifying P removal via nitrite pathway. The nitrite concentrations affected the abundance of clade IID. The P removal was mainly completed by anoxic P uptake of about 88%. The P removal efficiency clearly had a positive correlation with the nitrite accumulation ratio. Under nitritation, the P removal efficiency was 30% higher than that under complete nitrification, suggesting that nitrite was appropriate as electron acceptor for denitrifying P removal when treating carbon-limited wastewater. PMID:26439519

  3. Clues into the metagenome of Huanglongbing infected Citrus by analysis of ancillary sequences from Ion Torrent whole genome Candidatus Liberibacter asiaticus sequencing

    OpenAIRE

    Morgan, J K; Shatters, R. G.; Stover, E; Duan, Y. P.; Moore, G. A.; Powell, C A; Jarra-Cavieres, A.; Clark, S

    2014-01-01

    Huanglongbing (HLB) is a globally devastating disease of citrus.  Presently, three etiological agents are associated with HLB and include; Candidatus Liberibacter asiaticus (CLas), Candidatus Liberibacter americanus; and Candidatus Liberibacter africanus.  Attempts to determine alternate (non-Liberibacter) associated etiological agents of HLB have been performed, namely by metagenomic analyses with HLB phenotypic citrus of phloem tissue isolated from bark [1] and whole leaf midribs [2].  Thes...

  4. Denitrification capabilities of two biological phosphorus removal sludges dominated by different “Candidatus Accumulibacter” clades

    OpenAIRE

    Flowers, Jason J.; He, Shaomei; Yilmaz, Safak; Noguera, Daniel R.; McMahon, Katherine D.

    2009-01-01

    The capability of “Candidatus Accumulibacter” to use nitrate as an electron acceptor for phosphorus uptake was investigated using two activated sludge communities. The two communities were enriched in Accumulibacter clade IA and clade IIA, respectively. By performing a series of batch experiments, we found that clade IA was able to couple nitrate reduction with phosphorus uptake, but clade IIA could not. These results agree with a previously proposed hypothesis that different populations of A...

  5. Unique Features of a Japanese ‘Candidatus Liberibacter asiaticus’ Strain Revealed by Whole Genome Sequencing

    OpenAIRE

    Hiroshi Katoh; Shin-Ichi Miyata; Hiromitsu Inoue; Toru Iwanami

    2014-01-01

    Citrus greening (huanglongbing) is the most destructive disease of citrus worldwide. It is spread by citrus psyllids and is associated with phloem-limited bacteria of three species of α-Proteobacteria, namely, 'Candidatus Liberibacter asiaticus', 'Ca. L. americanus', and 'Ca. L. africanus'. Recent findings suggested that some Japanese strains lack the bacteriophage-type DNA polymerase region (DNA pol), in contrast to the Floridian psy62 strain. The whole genome sequence of the pol-negative 'C...

  6. Evaluation of antibiotics against the bacteria, Candidatus Liberibacter for control of citrus Huanglongbing

    OpenAIRE

    Zhang, Muqing; Guo, Ying; Powell, Charles A.; Duan, Yongping

    2014-01-01

    Citrus Huanglongbing (HLB) is one of the most serious diseases of citrus worldwide. The present study was undertaken to screen antibiotics against Candidatus Liberibacter asiaticus (Las) while simultaneously assessing phytotoxicity to citrus. Twenty-eight antibiotics from ten classes of medical-antibiotics and three agricultural-antibiotics were tested for in vivo activities against HLB bacterium using the previously optimized graft-based chemotherapy method (Zhang et al., 2012). First, sampl...

  7. The transcriptional activator LdtR from 'Candidatus Liberibacter asiaticus' mediates osmotic stress tolerance.

    OpenAIRE

    Pagliai, Fernando A.; Gardner, Christopher L.; Lora Bojilova; Amanda Sarnegrim; Cheila Tamayo; Potts, Anastasia H.; Max Teplitski; Folimonova, Svetlana Y.; Gonzalez, Claudio F.; Lorca, Graciela L.

    2014-01-01

    The causal agent of Huanglongbing disease, 'Candidatus Liberibacter asiaticus', is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from 'Ca. L. asiaticus' involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR), and a predicted L,D-transpepti...

  8. Candidatus Liberibacter asiaticus’, Causal Agent of Citrus Huanglongbing, Is Reduced by Treatment with Brassinosteroids

    OpenAIRE

    Canales, Eduardo; Coll, Yamilet; Hernández, Ingrid; Portieles, Roxana; Rodríguez García, Mayra; López, Yunior; Aranguren, Miguel; Alonso, Eugenio; Delgado, Roger; Luis, Maritza; Batista, Lochy; Paredes, Camilo; Rodríguez, Meilyn; Pujol, Merardo; Ochagavia, María Elena

    2016-01-01

    Huanglongbing (HLB) constitutes the most destructive disease of citrus worldwide, yet no established efficient management measures exist for it. Brassinosteroids, a family of plant steroidal compounds, are essential for plant growth, development and stress tolerance. As a possible control strategy for HLB, epibrassinolide was applied to as a foliar spray to citrus plants infected with the causal agent of HLB, ‘Candidatus Liberibacter asiaticus’. The bacterial titers were reduced after treatme...

  9. Colonization of Seeds of Citrus Rootstock Varieties by ‘Candidatus Liberibacter asiaticus’

    OpenAIRE

    Hilf, Mark E.

    2014-01-01

    Huanglongbing (HLB) is a disease of citrus associated with a systemic infection by the α-proteobacterium ‘Candidatus Liberibacter asiaticus’.  Infection of an individual tree can occur via psyllids (Diaphorina citri Kuwayama) carrying the bacterium or if the tree is propagated from infected budwood.  Seed transmission is another possible mode of dissemination of the pathogen.  Rootstock varieties are propagated from seed so we assessed the seed transmission among eighteen rootstock varieties ...

  10. Transcriptional Analyses of Mandarins Seriously Infected by ‘Candidatus Liberibacter asiaticus’

    OpenAIRE

    Xu, Meirong; Li, Ya; Zheng, Zheng; Dai, Zehan; Tao, Yang; Deng, Xiaoling

    2015-01-01

    A range of leaf symptoms, including blotchy mottle, yellowing, and small, upright leaves with a variety of chlorotic patterns resembling those induced by zinc deficiencies, are associated with huanglongbing (HLB, yellow shoot disease), a worldwide destructive citrus disease. HLB is presumably caused by the phloem-limited fastidious prokaryotic α-proteobacterium ‘Candidatus Liberibacter spp.’ Previous studies focused on the proteome and transcriptome analyses of citrus 5 to 35 weeks after ‘Ca....

  11. Mandarin and mandarin hybrid genetic transformation for resistance to Candidatus Liberibacter asiaticus

    OpenAIRE

    Soriano, L; Tavano, E. C.R.; R. Harakava; MOURÃO FILHO F.A.A.; B.M.J. Mendes

    2014-01-01

    Brazil is one of the largest producers and exporters of citrus. Currently, Huanglongbing disease (HLB) associated to Candidatus Liberibacter asiaticus (CLas) is the main threat to the citrus industry. The aim of this work is to study the genetic transformation of mandarin/mandarin hybrid 'Thomas' (Citrus reticulata Blanco) and 'Fremont' (C. clementina hort. ex Tanaka x C. reticulata Blanco) with the gene that encodes an attacin antibacterial peptide (attA) driven by phloem-specific promoters....

  12. Changes in Variable Number of Tandem Repeats in ‘Candidatus Liberibacter asiaticus’ through Insect Transmission

    OpenAIRE

    Katoh, Hiroshi; Inoue, Hiromitsu; Iwanami, Toru

    2015-01-01

    Citrus greening (huanglongbing) is the most destructive citrus disease worldwide. The disease is associated with three species of ‘Candidatus Liberibacter’ among which ‘Ca. Liberibacter asiaticus’ has the widest distribution. ‘Ca. L. asiaticus’ is commonly transmitted by a phloem-feeding insect vector, the Asian citrus psyllid Diaphorina citri. A previous study showed that isolates of ‘Ca. L. asiaticus’ were clearly differentiated by variable number of tandem repeat (VNTR) profiles at four lo...

  13. Search for potential vectors of ‘Candidatus Liberibacter solanacearum’: population dynamics in host crops

    OpenAIRE

    Gabriela Teresani; Estrella Hernández; Edson Bertolini; Felipe Siverio; Carlos Marroquín; Jonathan Molina; Alfonso Hermoso de Mendoza; Mariano Cambra

    2015-01-01

    Candidatus Liberibacter solanacearum’ has recently been reported to be associated with vegetative disorders and economic losses in carrot and celery crops in Spain. The bacterium is a carrot seedborne pathogen and it is transmitted by psyllid vector species. From 2011 to 2014 seasonal and occasional surveys in carrot, celery and potato plots were performed. The sticky plant method was used to monitor the arthropods that visited the plants. The collected arthropods were classified into Aphidid...

  14. Changes in Variable Number of Tandem Repeats in ‘Candidatus Liberibacter asiaticus’ through Insect Transmission

    OpenAIRE

    Hiroshi Katoh; Hiromitsu Inoue; Toru Iwanami

    2015-01-01

    Citrus greening (huanglongbing) is the most destructive citrus disease worldwide. The disease is associated with three species of 'Candidatus Liberibacter' among which 'Ca. Liberibacter asiaticus' has the widest distribution. 'Ca. L. asiaticus' is commonly transmitted by a phloem-feeding insect vector, the Asian citrus psyllid Diaphorina citri. A previous study showed that isolates of 'Ca. L. asiaticus' were clearly differentiated by variable number of tandem repeat (VNTR) profiles at four lo...

  15. Genome-wide Expression Profiling in Ponkan Infected by Candidatus Liberibacter asiaticus

    OpenAIRE

    Jiang, Bo; Zhong, Yun; Cheng, Chunzhen; Zeng, Jiwu; ZHONG, Guangyan; Yi, Ganjun

    2014-01-01

    Huanglongbing (HLB) is an economical and destructive disease of citrus in South China, such as in Guangdong, Guangxi that is caused by the bacterium Candidatus Liberibacter asiaticus. The interaction at mRNA level between pathogen and citrus (Ponkan, Citrus reticulata Blanco ) was primarily researched by Digital Gene Expression Tag Profiling. Ponkan leaves at 13 weeks and 26 weeks after HLB inoculation were used for analysis. The numbers of up-regulated genes were increased from 37% in 13 wpi...

  16. XoxF-Type Methanol Dehydrogenase from the Anaerobic Methanotroph “Candidatus Methylomirabilis oxyfera”

    OpenAIRE

    Wu, Ming L.; Wessels, Hans J. C. T.; Pol, Arjan; Op den Camp, Huub J. M.; Mike S.M. Jetten; van Niftrik, Laura; Keltjens, Jan T.

    2014-01-01

    Candidatus Methylomirabilis oxyfera” is a newly discovered anaerobic methanotroph that, surprisingly, oxidizes methane through an aerobic methane oxidation pathway. The second step in this aerobic pathway is the oxidation of methanol. In Gram-negative bacteria, the reaction is catalyzed by pyrroloquinoline quinone (PQQ)-dependent methanol dehydrogenase (MDH). The genome of “Ca. Methylomirabilis oxyfera” putatively encodes three different MDHs that are localized in one large gene cluster: one...

  17. 'Candidatus Competibacter'-lineage genomes retrieved from metagenomes reveal functional metabolic diversity.

    Science.gov (United States)

    McIlroy, Simon J; Albertsen, Mads; Andresen, Eva K; Saunders, Aaron M; Kristiansen, Rikke; Stokholm-Bjerregaard, Mikkel; Nielsen, Kåre L; Nielsen, Per H

    2014-03-01

    The glycogen-accumulating organism (GAO) 'Candidatus Competibacter' (Competibacter) uses aerobically stored glycogen to enable anaerobic carbon uptake, which is subsequently stored as polyhydroxyalkanoates (PHAs). This biphasic metabolism is key for the Competibacter to survive under the cyclic anaerobic-'feast': aerobic-'famine' regime of enhanced biological phosphorus removal (EBPR) wastewater treatment systems. As they do not contribute to phosphorus (P) removal, but compete for resources with the polyphosphate-accumulating organisms (PAO), thought responsible for P removal, their proliferation theoretically reduces the EBPR capacity. In this study, two complete genomes from Competibacter were obtained from laboratory-scale enrichment reactors through metagenomics. Phylogenetic analysis identified the two genomes, 'Candidatus Competibacter denitrificans' and 'Candidatus Contendobacter odensis', as being affiliated with Competibacter-lineage subgroups 1 and 5, respectively. Both have genes for glycogen and PHA cycling and for the metabolism of volatile fatty acids. Marked differences were found in their potential for the Embden-Meyerhof-Parnas and Entner-Doudoroff glycolytic pathways, as well as for denitrification, nitrogen fixation, fermentation, trehalose synthesis and utilisation of glucose and lactate. Genetic comparison of P metabolism pathways with sequenced PAOs revealed the absence of the Pit phosphate transporter in the Competibacter-lineage genomes--identifying a key metabolic difference with the PAO physiology. These genomes are the first from any GAO organism and provide new insights into the complex interaction and niche competition between PAOs and GAOs in EBPR systems. PMID:24173461

  18. A New Huanglongbing Species, “Candidatus Liberibacter psyllaurous,” Found To Infect Tomato and Potato, Is Vectored by the Psyllid Bactericera cockerelli (Sulc)▿

    OpenAIRE

    Hansen, A.K.; Trumble, J T; Stouthamer, R; Paine, T. D.

    2008-01-01

    A new huanglongbing (HLB) “Candidatus Liberibacter” species is genetically characterized, and the bacterium is designated “Candidatus Liberibacter psyllaurous.” This bacterium infects the psyllid Bactericera cockerelli and its solanaceous host plants potato and tomato, potentially resulting in “psyllid yellowing.” Host plant-dependent HLB transmission and variation in psyllid infection frequencies are found.

  19. Genome Sequence of "Candidatus Microthrix parvicella" Bio17-1, a Long-Chain-Fatty-Acid-Accumulating Filamentous Actinobacterium from a Biological Wastewater Treatment Plant

    OpenAIRE

    Muller, Emilie; Pinel, Nicolás; Gillece, John D.; Schupp, James M.; Lance B Price; Engelthaler, David M.; Levantesi, Caterina; Tandoi, Valter; Luong, Kkai; Baliga, Nitin S.; Korlach, Jonas; Keim, Paul S.; Wilmes, Paul

    2012-01-01

    Candidatus Microthrix” bacteria are deeply branching filamentous actinobacteria which occur at the water-air interface of biological wastewater treatment plants, where they are often responsible for foaming and bulking. Here, we report the first draft genome sequence of a strain from this genus: “Candidatus Microthrix parvicella” strain Bio17-1.

  20. Comparative genomics of two 'Candidatus Accumulibacter' clades performing biological phosphorus removal.

    Science.gov (United States)

    Flowers, Jason J; He, Shaomei; Malfatti, Stephanie; del Rio, Tijana Glavina; Tringe, Susannah G; Hugenholtz, Philip; McMahon, Katherine D

    2013-12-01

    Members of the genus Candidatus Accumulibacter are important in many wastewater treatment systems performing enhanced biological phosphorus removal (EBPR). The Accumulibacter lineage can be subdivided phylogenetically into multiple clades, and previous work showed that these clades are ecologically distinct. The complete genome of Candidatus Accumulibacter phosphatis strain UW-1, a member of Clade IIA, was previously sequenced. Here, we report a draft genome sequence of Candidatus Accumulibacter spp. strain UW-2, a member of Clade IA, assembled following shotgun metagenomic sequencing of laboratory-scale bioreactor sludge. We estimate the genome to be 80-90% complete. Although the two clades share 16S rRNA sequence identity of >98.0%, we observed a remarkable lack of synteny between the two genomes. We identified 2317 genes shared between the two genomes, with an average nucleotide identity (ANI) of 78.3%, and accounting for 49% of genes in the UW-1 genome. Unlike UW-1, the UW-2 genome seemed to lack genes for nitrogen fixation and carbon fixation. Despite these differences, metabolic genes essential for denitrification and EBPR, including carbon storage polymer and polyphosphate metabolism, were conserved in both genomes. The ANI from genes associated with EBPR was statistically higher than that from genes not associated with EBPR, indicating a high selective pressure in EBPR systems. Further, we identified genomic islands of foreign origins including a near-complete lysogenic phage in the Clade IA genome. Interestingly, Clade IA appeared to be more phage susceptible based on it containing only a single Clustered Regularly Interspaced Short Palindromic Repeats locus as compared with the two found in Clade IIA. Overall, the comparative analysis provided a genetic basis to understand physiological differences and ecological niches of Accumulibacter populations, and highlights the importance of diversity in maintaining system functional resilience. PMID:23887171

  1. The Transcriptional Activator LdtR from ‘Candidatus Liberibacter asiaticus’ Mediates Osmotic Stress Tolerance

    OpenAIRE

    Pagliai, Fernando A.; Gardner, Christopher L.; Bojilova, Lora; Sarnegrim, Amanda; Tamayo, Cheila; Potts, Anastasia H.; Teplitski, Max; Folimonova, Svetlana Y.; Gonzalez, Claudio F.; Lorca, Graciela L.

    2014-01-01

    The causal agent of Huanglongbing disease, ‘Candidatus Liberibacter asiaticus’, is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from ‘Ca. L. asiaticus’ involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR), and a predicted L,D-transpepti...

  2. Metabolite signature of candidatus liberibacter asiaticus infection in two citrus varieties

    OpenAIRE

    Chin, EL; Mishchuk, DO; Breksa, AP; Slupsky, CM

    2014-01-01

    Huanglongbing (HLB), also known as Citrus Greening Disease, is caused by the bacterium 'Candidatus Liberibacter asiaticus' (CLas) and is a serious threat to the citrus industry. To understand the effect of CLas infection on the citrus metabolome, juice from healthy (n = 18), HLB-asymptomatic (n = 18), and HLB-symptomatic Hamlin (n = 18), as well as from healthy (n = 18) and HLB-symptomatic (n = 18) Valencia sweet oranges (from southern and eastern Florida) were evaluated using 1H NMR-based me...

  3. Unique Features of a Japanese ‘Candidatus Liberibacter asiaticus’ Strain Revealed by Whole Genome Sequencing

    OpenAIRE

    Katoh, Hiroshi; Miyata, Shin-ichi; Inoue, Hiromitsu; Iwanami, Toru

    2014-01-01

    Citrus greening (huanglongbing) is the most destructive disease of citrus worldwide. It is spread by citrus psyllids and is associated with phloem-limited bacteria of three species of α-Proteobacteria, namely, ‘Candidatus Liberibacter asiaticus’, ‘Ca. L. americanus’, and ‘Ca. L. africanus’. Recent findings suggested that some Japanese strains lack the bacteriophage-type DNA polymerase region (DNA pol), in contrast to the Floridian psy62 strain. The whole genome sequence of the pol-negative ‘C...

  4. The Intracellular Citrus Huanglongbing Bacterium, ‘Candidatus Liberibacter asiaticus’ Encodes Two Novel Autotransporters

    OpenAIRE

    Guixia Hao; Michael Boyle; Lijuan Zhou; Yongping Duan

    2013-01-01

    Proteins secreted by the type V secretion system (T5SS), known as autotransporters, are large extracellular virulence proteins localized to the bacterial poles. In this study, we characterized two novel autotransporter proteins of ‘Candidatus Liberibacter asiaticus’ (Las), and redesignated them as LasAI and LasAII in lieu of the previous names HyvI and HyvII. As a phloem-limited, intracellular bacterial pathogen, Las has a significantly reduced genome and causes huanglongbing (HLB), a devasta...

  5. Characteristics of the draft genome of "Candidatus Arsenophonus nilaparvatae", a facultative endosymbiont of Nilaparvata lugens.

    Science.gov (United States)

    Fan, Hai-Wei; Lu, Jia-Bao; Ye, Yu-Xuan; Yu, Xiao-Ping; Zhang, Chuan-Xi

    2016-06-01

    There exists a kind of symbiotic bacterium named "Candidatus Arsenophonus nilaparvatae" in the brown planthopper (BPH), Nilaparvata lugens. After being filtered and assembled from the BPH genome sequencing project, the genome sequence of this bacterial symbiont was obtained. After initial analysis based on the genome, we have found its potential role to synthesize B vitamins for the host. In order to better understand the lifestyle and the genomic changes of this symbiotic bacterium after the symbiotic relationship was established, we further report the characteristics of this draft genome. Compared with several other related bacteria, "Candidatus Arsenophonus nilaparvatae" has proven to be a facultative endosymbiont at the genomic level. Concurrently, the presence of fimbriae and flagella formation related genes indicates this maternally transmitted endosymbiont is most likely to retain the capacity to invade new hosts. Through further analysis of annotated gene sets, we also find evidence of genome reduction in its secretion system and metabolic pathways. These findings reflect its evolutionary trend to be an obligate one and enable a deeper study of microbe-insect interactions. PMID:26792263

  6. Transcriptome analysis of "Candidatus Liberibacter solanacearum" in its psyllid vector, Bactericera cockerelli.

    Directory of Open Access Journals (Sweden)

    Freddy Ibanez

    Full Text Available "Candidatus Liberibacter solanacearum" (Lso is an emergent pathogen of carrots in Europe and solanaceous plants in North and Central America and New Zealand. This bacterium is closely related to other pathogenic Candidatus Liberibacter spp., all vectored by psyllids. In order to understand the molecular interaction of this pathogen and its psyllid vector, Bactericera cockerelli, Illumina sequencing of psyllid harboring Lso was performed to determine if this approach could be used to assess the bacterial transcriptome in this association. Prior to sequencing, psyllid RNA was purified and insect and bacterial rRNA were removed. Mapping of reads to Lso genome revealed that over 92% of the bacterial genes were expressed in the vector, and that the COG categories Translation and Post-translational modification, protein turnover, chaperone functions were the most expressed functional categories. Expression levels of selected Lso genes were confirmed by RT-qPCR. The transcriptomic analysis also helped correct Lso genome annotation by identifying the expression of genes that were not predicted in the genome sequencing effort.

  7. Whole-Genome Sequence of "Candidatus Liberibacter asiaticus" from a Huanglongbing-Affected Citrus Tree in Central Florida.

    Science.gov (United States)

    Zheng, Z; Sun, X; Deng, X; Chen, J

    2015-01-01

    Here, we report the draft genome sequence of "Candidatus Liberibacter asiaticus" strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  8. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    OpenAIRE

    Z. Zheng; X. Sun; Deng, X.; J. Chen

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes.

  9. Complete Genome Sequence of “Candidatus Liberibacter africanus,” a Bacterium Associated with Citrus Huanglongbing

    OpenAIRE

    Lin, Hong; Pietersen, Gerhard; Han, Cliff; Read, David Alan; Lou, Binghai; Gupta, Goutam; Civerolo, Edwin L

    2015-01-01

    We report here the complete genome sequence of “Candidatus Liberibacter africanus” strain PTSAPSY. The 1,192,232-bp genome with 34.5% G+C content comprises 1,017 open reading frames, 44 tRNAs, and three complete rRNAs in a circular chromosome.

  10. Draft Genome Sequence of “Candidatus Liberibacter asiaticus” from a Citrus Tree in San Gabriel, California

    OpenAIRE

    Wu, F.; Kumagai, L.; Liang, G; Deng, X.; Z. Zheng; Keremane, M.; J. Chen

    2015-01-01

    The draft genome sequence of “Candidatus Liberibacter asiaticus” strain SGCA5 from an orange citrus tree in San Gabriel, California, is reported here. SGCA5 has a genome size of 1,201,445 bp, a G+C content of 36.4%, 1,152 predicted open reading frames (ORFs), and 42 RNA genes.

  11. Deciphering the bacterial microbiome of citrus plants in response to ‘Candidatus Liberibacter asiaticus’-infection and antibiotic treatment

    Science.gov (United States)

    Huanglongbing (HLB), the most devastating citrus disease worldwide, is vectored by phloem-feeding insects, and the pathogen in the USA is Candidatus Liberibacter asiaticus (Las). The bacterial microbiome of citrus after Las-infection and treatments with ampicillin (Amp) and gentamicin (Gm) was chara...

  12. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    Science.gov (United States)

    Zheng, Z.; Sun, X.

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  13. Comparative phylogenomics and multi-gene cluster analyses of the Citrus Huanglongbing (HLB-associated bacterium Candidatus Liberibacter

    Directory of Open Access Journals (Sweden)

    Civerolo Edwin L

    2008-08-01

    Full Text Available Abstract Background Huanglongbing (HLB, previously known as citrus greening, is associated with Candidatus Liberibacter species and is a serious threat to citrus production world-wide. The pathogen is a Gram negative, unculturable, phloem-limited bacterium with limited known genomic information. Expanding the genetic knowledge of this organism may provide better understanding of the pathogen and possibly develop effective strategies for control and management of HLB. Results Here, we report cloning and characterization of an additional 14.7 Kb of new genomic sequences from three different genomic regions of the Candidatus Liberibacter asiaticus (Las. Sequence variation analyses among the available Ca. Liberibacter species sequences as well as the newly cloned 1.5 Kb of rpoB gene from different Ca. Liberibacter strains have identified INDELs and SNPs. Phylogenetic analysis of the deduced protein sequences from the cloned regions characterizes the HLB-associated Candidatus Liberibacter as a new clade in the sub-division of the α-proteobacteria. Conclusion Comparative analyses of the cloned gene regions of Candidatus Liberibacter with members of the order Rhizobiales suggest overall gene structure and order conservation, albeit with minor variations including gene decay due to the identified pseudogenes. The newly cloned gene regions contribute to our understanding of the molecular aspects of genomic evolution of Ca. Liberibacter.

  14. Complete Genome Sequence of “Candidatus Liberibacter africanus,” a Bacterium Associated with Citrus Huanglongbing

    Science.gov (United States)

    Pietersen, Gerhard; Han, Cliff; Read, David Alan; Lou, Binghai; Gupta, Goutam; Civerolo, Edwin L.

    2015-01-01

    We report here the complete genome sequence of “Candidatus Liberibacter africanus” strain PTSAPSY. The 1,192,232-bp genome with 34.5% G+C content comprises 1,017 open reading frames, 44 tRNAs, and three complete rRNAs in a circular chromosome. PMID:26184931

  15. Detection of phytoplasma and Candidatus Liberibacter asiaticus in citrus showing Huanglongbing (yellow shoot disease) symptoms in Guangdong, P. R. China

    Science.gov (United States)

    Huanglongbing (HLB) or yellow shoot disease (ex. greening disease) is highly destructive to citrus production worldwide. HLB is currently known to be associated with Candidatus Liberibacter asiaticus in China. However, Koch’s postulates have not been fulfilled. It also remains unclear if other plant...

  16. Novel Molecular Technique for Rapid Cloning of Unknown Sequences From Unculturable Huanglongbing (HLB) Associated Bacterium, Candidatus Liberibacter

    Science.gov (United States)

    Huanglongbing (HLB), previously known as citrus greening disease, is one of the most destructive citrus diseases worldwide. Recent occurrence of citrus Huanglongbing(HLB)in Florida has dramatically increased the threat to the entire US citrus industry. The disease is associated with Candidatus Liber...

  17. Whole genome sequencing of Candidatus Liberibacter asiaticus strain A4 from Guangdong, China, and strain HHCA from California

    Science.gov (United States)

    Candidatus Liberibacter asiaticus” is associated with citrus Huanglongbing (HLB) in both China and the United States. While HLB has been known for over a century in Guangdong, China, the disease was first discovered in California in 2012. To better study the “old” and “new” HLBs, whole genomes of “...

  18. Zebra Chip disease and potato biochemistry: Tuber physiological changes in response to ‘Candidatus Liberibacter solanacearum’ infection over time

    Science.gov (United States)

    Zebra chip disease (ZC), putatively caused by ‘Candidatus Liberibacter solanacearum’ (Lso), is of increasing concern to potato production in Mexico, the United States, and New Zealand. However, little is known about host tuber physiological changes that result in ZC symptom formation. This study exp...

  19. De Novo Genome Sequence of “Candidatus Liberibacter solanacearum” from a Single Potato Psyllid in California

    OpenAIRE

    Wu, F; X. Deng; Liang, G.; Wallis, C; Trumble, J T; Prager, S; Chen, J.

    2015-01-01

    The draft genome sequence of “Candidatus Liberibacter solanacearum” strain RSTM from a potato psyllid (Bactericera cockerelli) in California is reported here. The RSTM strain has a genome size of 1,286,787 bp, a G+C content of 35.1%, 1,211 predicted open reading frames (ORFs), and 43 RNA genes.

  20. Effects of potato-psyllid-vectored ‘Candidatus Liberibacter solanacearum’ infection on potato leaf and stem physiology

    Science.gov (United States)

    The bacterium ‘Candidatus Liberibacter solanacearum’ (Lso) is associated with zebra chip disease (ZC), a threat to potato production in North America and New Zealand. Previous studies observed that Lso infection causes potato tubers to undergo ZC-symptom associated shifts in physiology, such as incr...

  1. Detection of Candidatus Liberibacter asiaticus associated with huanglongbing disease in the salivary glands and alimentary canal of Diaphorina citri

    Science.gov (United States)

    Candidatus Liberibacter asiaticus (Las) has been strongly implicated as the causative agent of huanglongbing (HLB), or citrus greening, which is the most devastating citrus disease in Florida and other parts of the world. HLB is transmitted in a persistent manner by psyllid vectors and in the US and...

  2. Proteomic analysis of the purple sulfur bacterium Candidatus "Thiodictyon syntrophicum" strain Cad16T isolated from Lake Cadagno

    DEFF Research Database (Denmark)

    Storelli, Nicola; Saad, Maged M.; Frigaard, Niels-Ulrik;

    2014-01-01

    Lake Cadagno is characterised by a compact chemocline with high concentrations of purple sulfur bacteria (PSB). 2D-DIGE was used to monitor the global changes in the proteome of Candidatus "Thiodictyon syntrophicum" strain Cad16T both in the presence and absence of light. This study aimed to disc...

  3. Extraction of DNA from orange juice and detection of bacterium Candidatus Liberibacter asiaticus by real-time PCR

    Science.gov (United States)

    Orange juice processed from Huanglongbing (HLB) affected fruit is often associated with bitter taste and/or off-flavor. HLB disease in Florida is associated with Candidatus Liberibacter asiaticus (CLas), a phloem limited bacterium. The current standard to confirm CLas for citrus trees is to take sam...

  4. Draft Genome Sequence of “Candidatus Mycoplasma haemobos,” a Hemotropic Mycoplasma Identified in Cattle in Mexico

    Science.gov (United States)

    Martínez-Ocampo, Fernando; Rodríguez-Camarillo, Sergio D.; Amaro-Estrada, Itzel

    2016-01-01

    We present here the draft genome sequence of the first “Candidatus Mycoplasma haemobos” strain found in cattle in Mexico. This hemotropic mycoplasma causes acute and chronic disease in animals. This genome is a starting point for studying the role of this mycoplasma in coinfections and synergistic mechanisms associated with the disease. PMID:27389272

  5. Draft Genome Sequence of "Candidatus Phytoplasma oryzae" Strain Mbita1, the Causative Agent of Napier Grass Stunt Disease in Kenya.

    Science.gov (United States)

    Fischer, Anne; Santana-Cruz, Ivette; Wambua, Lillian; Olds, Cassandra; Midega, Charles; Dickinson, Matthew; Kawicha, Praphat; Khan, Zeyaur; Masiga, Daniel; Jores, Joerg; Schneider, Bernd

    2016-01-01

    Phytoplasmas are bacterial plant pathogens with devastating impact on agricultural production worldwide. In eastern Africa, Napier grass stunt disease causes serious economic losses in the smallholder dairy industry. This draft genome sequence of " ITALIC! CandidatusPhytoplasma oryzae" strain Mbita1 provides insight into its genomic organization and the molecular basis of pathogenicity. PMID:27103722

  6. Genome Sequences of the Primary Endosymbiont “Candidatus Portiera aleyrodidarum” in the Whitefly Bemisia tabaci B and Q Biotypes

    OpenAIRE

    Jiang, Zi-Feng; Xia, Fangfang; Johnson, Kipp W.; Bartom, Elizabeth; Tuteja, Jigyasa H.; Stevens, Rick; Grossman, Robert L; Brumin, Marina; White, Kevin P.; Ghanim,Murad

    2012-01-01

    Candidatus Portiera aleyrodidarum” is the obligate primary endosymbiotic bacterium of whiteflies, including the sweet potato whitefly Bemisia tabaci, and provides essential nutrients to its host. Here we report two complete genome sequences of this bacterium from the B and Q biotypes of B. tabaci.

  7. 'Candidatus Liberibacter asiaticus', Causal Agent of Citrus Huanglongbing, Is Reduced by Treatment with Brassinosteroids.

    Science.gov (United States)

    Canales, Eduardo; Coll, Yamilet; Hernández, Ingrid; Portieles, Roxana; Rodríguez García, Mayra; López, Yunior; Aranguren, Miguel; Alonso, Eugenio; Delgado, Roger; Luis, Maritza; Batista, Lochy; Paredes, Camilo; Rodríguez, Meilyn; Pujol, Merardo; Ochagavia, María Elena; Falcón, Viviana; Terauchi, Ryohei; Matsumura, Hideo; Ayra-Pardo, Camilo; Llauger, Raixa; Pérez, María del Carmen; Núñez, Mirian; Borrusch, Melissa S; Walton, Jonathan D; Silva, Yussuan; Pimentel, Eulogio; Borroto, Carlos; Borrás-Hidalgo, Orlando

    2016-01-01

    Huanglongbing (HLB) constitutes the most destructive disease of citrus worldwide, yet no established efficient management measures exist for it. Brassinosteroids, a family of plant steroidal compounds, are essential for plant growth, development and stress tolerance. As a possible control strategy for HLB, epibrassinolide was applied to as a foliar spray to citrus plants infected with the causal agent of HLB, 'Candidatus Liberibacter asiaticus'. The bacterial titers were reduced after treatment with epibrassinolide under both greenhouse and field conditions but were stronger in the greenhouse. Known defense genes were induced in leaves by epibrassinolide. With the SuperSAGE technology combined with next generation sequencing, induction of genes known to be associated with defense response to bacteria and hormone transduction pathways were identified. The results demonstrate that epibrassinolide may provide a useful tool for the management of HLB. PMID:26731660

  8. 'Candidatus Liberibacter asiaticus', Causal Agent of Citrus Huanglongbing, Is Reduced by Treatment with Brassinosteroids.

    Directory of Open Access Journals (Sweden)

    Eduardo Canales

    Full Text Available Huanglongbing (HLB constitutes the most destructive disease of citrus worldwide, yet no established efficient management measures exist for it. Brassinosteroids, a family of plant steroidal compounds, are essential for plant growth, development and stress tolerance. As a possible control strategy for HLB, epibrassinolide was applied to as a foliar spray to citrus plants infected with the causal agent of HLB, 'Candidatus Liberibacter asiaticus'. The bacterial titers were reduced after treatment with epibrassinolide under both greenhouse and field conditions but were stronger in the greenhouse. Known defense genes were induced in leaves by epibrassinolide. With the SuperSAGE technology combined with next generation sequencing, induction of genes known to be associated with defense response to bacteria and hormone transduction pathways were identified. The results demonstrate that epibrassinolide may provide a useful tool for the management of HLB.

  9. Candidate gene markers for Candidatus Liberibacter asiaticus for detecting citrus greening disease

    Indian Academy of Sciences (India)

    Madhugiri Nageswara-Rao; Mike Irey; Stephen M Garnsey; Siddarame Gowda

    2013-06-01

    Citrus Huanglongbing (HLB) also known as citrus greening is one of the most devastating diseases of citrus worldwide. The disease is caused by Candidatus Liberibacter bacterium, vectored by the psyllid Diaphorina citri Kuwayama and Trioza erytreae Del Guercio. Citrus plants infected by the HLB bacterium may not show visible symptoms sometimes for years following infection. The aim of this study was to develop effective gene-specific primer pairs for polymerase chain reaction based method for quick screening of HLB disease. Thirty-two different gene-specific primer pairs, across the Ca. Liberibacter asiaticus genome, were successfully developed. The possibility of these primer pairs for cross-genome amplification across `Ca. Liberibacter africanus’ and `Ca. Liberibacter americanus’ were tested. The applicability of these primer pairs for detection and differentiation of Ca Liberibacter spp. is discussed.

  10. Candidatus Liberibacter asiaticus’, Causal Agent of Citrus Huanglongbing, Is Reduced by Treatment with Brassinosteroids

    Science.gov (United States)

    Hernández, Ingrid; Portieles, Roxana; Rodríguez García, Mayra; López, Yunior; Aranguren, Miguel; Alonso, Eugenio; Delgado, Roger; Luis, Maritza; Batista, Lochy; Paredes, Camilo; Rodríguez, Meilyn; Pujol, Merardo; Ochagavia, María Elena; Falcón, Viviana; Terauchi, Ryohei; Matsumura, Hideo; Ayra-Pardo, Camilo; Llauger, Raixa; Pérez, María del Carmen; Núñez, Mirian; Borrusch, Melissa S.; Walton, Jonathan D.; Silva, Yussuan; Pimentel, Eulogio; Borroto, Carlos; Borrás-Hidalgo, Orlando

    2016-01-01

    Huanglongbing (HLB) constitutes the most destructive disease of citrus worldwide, yet no established efficient management measures exist for it. Brassinosteroids, a family of plant steroidal compounds, are essential for plant growth, development and stress tolerance. As a possible control strategy for HLB, epibrassinolide was applied to as a foliar spray to citrus plants infected with the causal agent of HLB, ‘Candidatus Liberibacter asiaticus’. The bacterial titers were reduced after treatment with epibrassinolide under both greenhouse and field conditions but were stronger in the greenhouse. Known defense genes were induced in leaves by epibrassinolide. With the SuperSAGE technology combined with next generation sequencing, induction of genes known to be associated with defense response to bacteria and hormone transduction pathways were identified. The results demonstrate that epibrassinolide may provide a useful tool for the management of HLB. PMID:26731660

  11. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes

    Directory of Open Access Journals (Sweden)

    Fernanda Aparecida Nieri-Bastos

    2014-04-01

    Full Text Available Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul and from horses in the Cerrado biome (state of Piauí in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63 and 66.7% (2/3 of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  12. A Novel Study of Interactions of Arabidopsis thaliana With Candidatus Liberibacter psyllaurous When Transmitted by psyllid Bactericera cockerelli to Develop a Chemical Genomics Based Approach That can aid in Development of Control Strategies for Huanglongbing Disease in Citrus

    OpenAIRE

    Zadgaonkar, Sai

    2015-01-01

    Huanglongbing (HLB) is a bacterial disease associated with Candidatus Liberibacter asiaticus (CLas), Candidatus Liberibacter americanus, and Candidatus Liberibacter africanus. These bacterial species are transmitted by hemipteran psyllids. For many years, this disease has caused substantial damage to citrus around the world and in recent years, it has significantly impacted citrus production in the U.S.A. The lack of effective control and curative measures against psyllids and the pathogen ar...

  13. Temporal progression of 'Candidatus Liberibacter asiaticus' infection in citrus and acquisition efficiency by Diaphorina citri.

    Science.gov (United States)

    Coletta-Filho, Helvecio D; Daugherty, Matthew P; Ferreira, Cléderson; Lopes, João R S

    2014-04-01

    Over the last decade, the plant disease huanglongbing (HLB) has emerged as a primary threat to citrus production worldwide. HLB is associated with infection by phloem-limited bacteria ('Candidatus Liberibacter' spp.) that are transmitted by the Asian citrus psyllid, Diaphorina citri. Transmission efficiency varies with vector-related aspects (e.g., developmental stage and feeding periods) but there is no information on the effects of host-pathogen interactions. Here, acquisition efficiency of 'Candidatus Liberibacter asiaticus' by D. citri was evaluated in relation to temporal progression of infection and pathogen titer in citrus. We graft inoculated sweet orange trees with 'Ca. L. asiaticus'; then, at different times after inoculation, we inspected plants for HLB symptoms, measured bacterial infection levels (i.e., titer or concentration) in plants, and measured acquisition by psyllid adults that were confined on the trees. Plant infection levels increased rapidly over time, saturating at uniformly high levels (≈10(8) copy number of 16S ribosomal DNA/g of plant tissue) near 200 days after inoculation-the same time at which all infected trees first showed disease symptoms. Pathogen acquisition by vectors was positively associated with plant infection level and time since inoculation, with acquisition occurring as early as the first measurement, at 60 days after inoculation. These results suggest that there is ample potential for psyllids to acquire the pathogen from trees during the asymptomatic phase of infection. If so, this could limit the effectiveness of tree rouging as a disease management tool and would likely explain the rapid spread observed for this disease in the field. PMID:24620723

  14. Sequencing of IncX-plasmids suggests ubiquity of mobile forms of a biofilm-promoting gene cassette recruited from Klebsiella pneumoniae.

    Directory of Open Access Journals (Sweden)

    Mette Burmølle

    Full Text Available Plasmids are a highly effective means with which genetic traits that influence human health, such as virulence and antibiotic resistance, are disseminated through bacterial populations. The IncX-family is a hitherto sparsely populated group of plasmids that are able to thrive within Enterobacteriaceae. In this study, a replicon-centric screening method was used to locate strains from wastewater sludge containing plasmids belonging to the IncX-family. A transposon aided plasmid capture method was then employed to transport IncX-plasmids from their original hosts (and co-hosted plasmids into a laboratory strain (Escherichia coli Genehogs® for further study. The nucleotide sequences of the three newly isolated IncX-plasmids (pLN126_33, pMO17_54, pMO440_54 and the hitherto un-sequenced type-plasmid R485 revealed a remarkable occurrence of whole or partial gene cassettes that promote biofilm-formation in Klebsiella pneumonia or E. coli, in all four instances. Two of the plasmids (R485 and pLN126_33 were shown to directly induce biofilm formation in a crystal violet retention assay in E. coli. Sequence comparison revealed that all plasmid-borne forms of the type 3 fimbriae encoding gene cassette mrkABCDF were variations of a composite transposon Tn6011 first described in the E. coli IncX plasmid pOLA52. In conclusion, IncX-plasmids isolated from Enterobacteriaceae over almost 40 years and on three different continents have all been shown to carry a type 3 fimbriae gene cassette mrkABCDF stemming from pathogenic K. pneumoniae. Apart from contributing general knowledge about IncX-plasmids, this study also suggests an apparent ubiquity of a mobile form of an important virulence factor and is an illuminating example of the recruitment, evolution and dissemination of genetic traits through plasmid-mediated horizontal gene transfer.

  15. Prophage-Mediated Dynamics of ‘Candidatus Liberibacter asiaticus’ Populations, the Destructive Bacterial Pathogens of Citrus Huanglongbing

    OpenAIRE

    Lijuan Zhou; Powell, Charles A.; Wenbin Li; Mike Irey; Yongping Duan

    2013-01-01

    Prophages are highly dynamic components in the bacterial genome and play an important role in intraspecies variations. There are at least two prophages in the chromosomes of Candidatus Liberibacter asiaticus' (Las) Floridian isolates. Las is both unculturable and the most prevalent species of Liberibacter pathogens that cause huanglongbing (HLB), a worldwide destructive disease of citrus. In this study, seven new prophage variants resulting from two hyper-variable regions were identified by s...

  16. Candidatus Liberibacter asiaticus causes damage to citrus fibrous roots before visual decline of Huanglongbing-infected citrus trees

    OpenAIRE

    Graham, J. H.; Johnson, E. G.; Gottwald, T. R.; Irey, M. S.

    2014-01-01

    Huanglongbing (HLB), associated with Candidatus Liberibacter asiaticus (Las), was first detected in Florida in late 2005 and is now widely distributed throughout the commercial citrus-growing regions. In recent seasons, concurrent with freeze and drought episodes, symptomatic HLB-infected trees were much more affected by the extremes of temperature and moisture than trees without HLB. Symptoms exhibited by the stressed trees were excessive leaf loss and premature fruit drop even when HLB-infe...

  17. Increases in ‘Candidatus Liberibacter asiaticus’ viability and investigations of biofilm-like structures in citrus juice medium

    OpenAIRE

    Parker, J. K.; Wisotsky, S. R.; Hilf, M E; Sims, K. R.; Cobine, P. A.; de la Fuente, L.

    2014-01-01

    Huanglongbing disease of citrus, associated with infection by the bacterium ‘Candidatus Liberibacter asiaticus’ (LAS), has spread rapidly in the US since 2005. Attempts to culture LAS in vitro have not yielded a consistently reproducible culture method; therefore, obtaining knowledge about the infection process is difficult. To determine conditions which sustain LAS viability, LAS inoculum obtained from seeds of fruit from infected pomelo trees (Citrus grandis ‘Mato Buntan’) was added to diff...

  18. Molecular Interactions between the Citrus Bacterial Pathogen Candidatus Liberbacter asiaticus and Its Insect Vector the Asian Citrus Psyllid Diaphorina citri

    OpenAIRE

    Wang, Linling; Killiny, Nabil

    2014-01-01

    Huanglongbing (HLB), the most serious disease of citrus, is attributed in the United States to Candidatus Liberibacter asiaticus (CLas), a gram-negative, phloem-restricted α-proteobacterium transmitted by the Asian citrus psyllid (Diaphorina citri). Despite the fact that the psyllid is well recognized as the vector of CLas, to the best of our knowledge, little research has so far been conducted on molecular interactions between CLas and the psyllid. Many gram-negative bacterial pathogens have...

  19. Guidelines for Selection of Tissues for Electron Microscopy Confirmation of Candidatus Liberibacter spp. in Huanglongbing-affected Citrus

    OpenAIRE

    Achor, Diann; Davis, Craig L.; Brlansky, Ronald H.; Folimonova, Svetlana Y.

    2014-01-01

    Polymerase chain reaction (PCR) with the pathogen-specific primers and electron microscopy are the two techniques of choice that have been used for detection and identification of Candidatus Liberibacter spp. in the Huanglongbing (HLB)-affected citrus. Due to the low population and uneven distribution of Liberibacter in the diseased citrus trees finding the bacteria with transmission electron microscopy has been a challenge. Work with samples from HLB-affected citrus during the past 5 years h...

  20. Prophage-Mediated Dynamics of ‘Candidatus Liberibacter asiaticus’ Populations, the Destructive Bacterial Pathogens of Citrus Huanglongbing

    OpenAIRE

    Zhou, Lijuan; Powell, Charles A.; Li, Wenbin; Irey, Mike; Duan, Yongping

    2013-01-01

    Prophages are highly dynamic components in the bacterial genome and play an important role in intraspecies variations. There are at least two prophages in the chromosomes of Candidatus Liberibacter asiaticus’ (Las) Floridian isolates. Las is both unculturable and the most prevalent species of Liberibacter pathogens that cause huanglongbing (HLB), a worldwide destructive disease of citrus. In this study, seven new prophage variants resulting from two hyper-variable regions were identified by s...

  1. Manipulation of Plant Defense Responses by the Tomato Psyllid (Bactericerca cockerelli) and Its Associated Endosymbiont Candidatus Liberibacter Psyllaurous

    OpenAIRE

    Casteel, Clare L.; Hansen, Allison K.; Walling, Linda L.; Paine, Timothy D.

    2012-01-01

    Some plant pathogens form obligate relationships with their insect vector and are vertically transmitted via eggs analogous to insect endosymbionts. Whether insect endosymbionts manipulate plant defenses to benefit their insect host remains unclear. The tomato psyllid, Bactericerca cockerelli (Sulc), vectors the endosymbiont “Candidatus Liberibacter psyllaurous” (Lps) during feeding on tomato (Solanum lycopersicum L.). Lps titer in psyllids varied relative to the psyllid developmental stage w...

  2. Latent Period and Transmission of “Candidatus Liberibacter solanacearum” by the Potato Psyllid Bactericera cockerelli (Hemiptera: Triozidae)

    OpenAIRE

    Sengoda, Venkatesan G.; Cooper, W. Rodney; Swisher, Kylie D.; Henne, Donald C.; Munyaneza, Joseph E.

    2014-01-01

    Candidatus Liberibacter solanacearum” (Lso) is an economically important pathogen of solanaceous crops and the putative causal agent of zebra chip disease of potato (Solanum tuberosum L.). This pathogen is transmitted to solanaceous species by the potato psyllid, Bactericera cockerelli (Šulc), but many aspects of the acquisition and transmission processes have yet to be elucidated. The present study was conducted to assess the interacting effects of acquisition access period, incubation peri...

  3. Convenient Detection of the Citrus Greening (Huanglongbing) Bacterium ‘Candidatus Liberibacter asiaticus’ by Direct PCR from the Midrib Extract

    OpenAIRE

    Fujikawa, Takashi; Miyata, Shin-ichi; Iwanami, Toru

    2013-01-01

    A phloem-limited bacterium, ‘Candidatus Liberibacter asiaticus’ (Las) is a major pathogen of citrus greening (huanglongbing), one of the most destructive citrus diseases worldwide. The rapid identification and culling of infected trees and budwoods in quarantine are the most important control measures. DNA amplification including conventional polymerase chain reaction (PCR) has commonly been used for rapid detection and identification. However, long and laborious procedures for DNA extraction...

  4. Candidatus Neoehrlichia mikurensis in ticks and rodents from urban and natural habitats of South-Western Slovakia

    OpenAIRE

    Svitálková, Zuzana Hamšíková; Haruštiaková, Danka; Mahríková, Lenka; Mojšová, Michala; Berthová, Lenka; Slovák, Mirko; Kocianová, Elena; Vayssier-Taussat, Muriel; Kazimírová, Mária

    2016-01-01

    Background Candidatus Neoehrlichia mikurensis (CNM) is an emerging tick-borne pathogen causing severe disease in immunocompromised patients. In Europe, Ixodes ricinus is the primary vector and rodents act as reservoir hosts. New data on the prevalence of CNM in ticks and rodents contribute to the knowledge on the distribution of endemic areas and circulation of the bacterium in natural foci. Methods Questing ticks were collected and rodents were trapped in urban/suburban and natural habitats ...

  5. Dominant and novel clades of Candidatus Accumulibacter phosphatis in 18 globally distributed full-scale wastewater treatment plants

    OpenAIRE

    Yanping Mao; Graham, David W.; Hideyuki Tamaki; Tong Zhang

    2015-01-01

    Here we employed quantitative real-time PCR (qPCR) assays for polyphosphate kinase 1 (ppk1) and 16S rRNA genes to assess relative abundances of dominant clades of Candidatus Accumulibacter phosphatis (referred to Accumulibacter) in 18 globally distributed full-scale wastewater treatment plants (WWTPs) from six countries. Accumulibacter were not only detected in the 6 WWTPs performing biological phosphorus removal, but also inhabited in the other 11 WWTPs employing conventional activated sludg...

  6. The ubiquity of conservative translations

    CERN Document Server

    Jeřábek, Emil

    2011-01-01

    We study the notion of conservative translation between logics introduced by Feitosa and D'Ottaviano. We show that classical propositional logic (CPC) is universal in the sense that every finitary consequence relation over a countable set of formulas can be conservatively translated into CPC. The translation is computable if the consequence relation is decidable. More generally, we show that one can take instead of CPC a broad class of logics (extensions of a certain fragment of full Lambek calculus FL) including most nonclassical logics studied in the literature, hence in a sense, (almost) any two reasonable deductive systems can be conservatively translated into each other. We also provide some counterexamples, in particular the paraconsistent logic LP is not universal.

  7. The ubiquity of conservative translations

    Czech Academy of Sciences Publication Activity Database

    Jeřábek, Emil

    2012-01-01

    Roč. 5, č. 4 (2012), s. 666-678. ISSN 1755-0203 R&D Projects: GA AV ČR IAA100190902; GA MŠk(CZ) 1M0545 Institutional support: RVO:67985840 Keywords : conservative translation * deductive system * nonclassical logic Subject RIV: BA - General Mathematics Impact factor: 0.500, year: 2012 http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=8757256

  8. Identification of genes differentially expressed during interaction of Mexican lime tree infected with "Candidatus Phytoplasma aurantifolia"

    Directory of Open Access Journals (Sweden)

    Nekouei Mojtaba

    2011-01-01

    Full Text Available Abstract Background "Candidatus Phytoplasma aurantifolia", is the causative agent of witches' broom disease in Mexican lime trees (Citrus aurantifolia L., and is responsible for major losses of Mexican lime trees in Southern Iran and Oman. The pathogen is strictly biotrophic, and thus is completely dependent on living host cells for its survival. The molecular basis of compatibility and disease development in this system is poorly understood. Therefore, we have applied a cDNA- amplified fragment length polymorphism (AFLP approach to analyze gene expression in Mexican lime trees infected by "Ca. Phytoplasma aurantifolia". Results We carried out cDNA-AFLP analysis on grafted infected Mexican lime trees of the susceptible cultivar at the representative symptoms stage. Selective amplifications with 43 primer combinations allowed the visualisation of 55 transcript-derived fragments that were expressed differentially between infected and non-infected leaves. We sequenced 51 fragments, 36 of which were identified as lime tree transcripts after homology searching. Of the 36 genes, 70.5% were down-regulated during infection and could be classified into various functional groups. We showed that Mexican lime tree genes that were homologous to known resistance genes tended to be repressed in response to infection. These included the genes for modifier of snc1 and autophagy protein 5. Furthermore, down-regulation of genes involved in metabolism, transcription, transport and cytoskeleton was observed, which included the genes for formin, importin β 3, transducin, L-asparaginase, glycerophosphoryl diester phosphodiesterase, and RNA polymerase β. In contrast, genes that encoded a proline-rich protein, ubiquitin-protein ligase, phosphatidyl glycerol specific phospholipase C-like, and serine/threonine-protein kinase were up-regulated during the infection. Conclusion The present study identifies a number of candidate genes that might be involved in the

  9. Genome reconstruction and gene expression of "Candidatus Accumulibacter phosphatis" Clade IB performing biological phosphorus removal.

    Science.gov (United States)

    Mao, Yanping; Yu, Ke; Xia, Yu; Chao, Yuanqing; Zhang, Tong

    2014-09-01

    We report the first integrated metatranscriptomic and metagenomic analysis of enhanced biological phosphorus removal (EBPR) sludge. A draft genome of Candidatus Accumulibacter spp. strain HKU-1, a member of Clade IB, was retrieved. It was estimated to be ∼90% complete and shared average nucleotide identities of 83% and 88% with the finished genome CAP IIA UW-1 and the draft genome CAP IA UW-2, respectively. Different from CAP IIA UW-1, the phosphotransferase (pap) in polyphosphate metabolism and V-ATPase in orthophosphate transport were absent from CAP IB HKU-1. Additionally, unlike CAP IA UW-2, CAP IB HKU-1 carried the genes for carbon fixation and nitrogen fixation. Despite these differences, the key genes required for acetate uptake, glycolysis and polyhydroxyalkanoate (PHA) synthesis were conserved in all these Accumulibacter genomes. The preliminary metatranscriptomic results revealed that the most significantly up-regulated genes of CAP IB HKU-1 from the anaerobic to the aerobic phase were responsible for assimilatory sulfate reduction, genetic information processing and phosphorus absorption, while the down-regulated genes were related to N2O reduction, PHA synthesis and acetyl-CoA formation. This study yielded another important Accumulibacter genome, revealed the functional difference within the Accumulibacter Type I, and uncovered the genetic responses to EBPR stimuli at a higher resolution. PMID:25089581

  10. The complete genome sequence of 'Candidatus Liberibacter americanus', associated with Citrus huanglongbing.

    Science.gov (United States)

    Wulff, Nelson A; Zhang, Shujian; Setubal, João C; Almeida, Nalvo F; Martins, Elaine C; Harakava, Ricardo; Kumar, Dibyendu; Rangel, Luiz Thiberio; Foissac, Xavier; Bové, Joseph M; Gabriel, Dean W

    2014-02-01

    Liberibacter spp. form a Rhizobiaceae clade of phloem-limited pathogens of limited host range. Two obligately parasitic species have been sequenced: 'Candidatus Liberibacter asiaticus', which causes citrus huanglongbing (HLB) worldwide, and 'Ca. L. solanacearum', which causes potato "zebra chip" disease. A third (proposed) species, Liberibacter crescens, was isolated from mountain papaya, grown in axenic culture, and sequenced. In an effort to identify common host determinants, the complete genomic DNA sequence of a second HLB species, 'Ca. L. americanus' strain 'São Paulo' was determined. The circular genome of 1,195,201 bp had an average 31.12% GC content and 983 predicted protein encoding genes, 800 (81.4%) of which had a predicted function. There were 658 genes common to all sequenced Liberibacter spp. and only 8 genes common to 'Ca. L. americanus' and 'Ca. L. asiaticus' but not found in 'Ca. L. solanacearum'. Surprisingly, most of the lipopolysaccharide biosynthetic genes were missing from the 'Ca. L. americanus' genome, as well as OmpA and a key regulator of flagellin, all indicating a 'Ca. L. americanus' strategy of avoiding production of major pathogen-associated molecular patterns present in 'Ca. L. asiaticus' and 'Ca. L. solanacearum'. As with 'Ca. L. asiaticus', one of two 'Ca. L. americanus' prophages replicated as an excision plasmid and carried potential lysogenic conversion genes that appeared fragmentary or degenerated in 'Ca. L. solanacearum'. PMID:24200077

  11. Reaction of sweet orange cultivars expressing the attacin A gene to 'Candidatus Liberibacter asiaticus' infection

    Directory of Open Access Journals (Sweden)

    Rafaella Teles Arantes Felipe

    2013-11-01

    Full Text Available The objective of this work was to evaluate the reaction of four sweet orange cultivars expressing the attacin A gene to 'Candidatus Liberibacter asiaticus' (Las infection, a bacterium associated to huanglongbing (HLB disease. Transgenic sweet orange plants of Hamlin, Natal, Pêra, and Valência cultivars, as well as nontransgenic controls received inocula by grafting budwood sections of HLB-infected branches. Disease progression was evaluated through observations of leaf symptoms and by polymerase chain reaction (PCR analysis, eight months after inoculation. A completely randomized design was used, with four experiments (one for each cultivar performed simultaneously. Bacteria title was estimated by quantitative PCR (qPCR. HLB symptoms and Las titers were present in nontransgenic and transgenic plants expressing the attacin A gene of the four sweet orange cultivars, eight months after bacteria inoculation. Five transgenic lines (transformation events of 'Pêra' sweet orange expressing the attacin A gene have significantly lower Las titers in comparison with nontransgenic plants of this cultivar.

  12. Prophage-Encoded Peroxidase in 'Candidatus Liberibacter asiaticus' Is a Secreted Effector That Suppresses Plant Defenses.

    Science.gov (United States)

    Jain, Mukesh; Fleites, Laura A; Gabriel, Dean W

    2015-12-01

    'Candidatus Liberibacter asiaticus' is transmitted by psyllids and causes huanglongbing (HLB), a lethal disease of citrus. Most pathogenic 'Ca. L. asiaticus' strains carry two nearly identical prophages similar to SC1 and SC2 in strain UF506. SC2 was observed to replicate as a moderately high-copy excision plasmid encoding a reactive oxygen species-scavenging peroxidase (SC2_gp095), a predicted lysogenic conversion factor. SC2_gp095 was expressed at significantly higher levels in periwinkle than in citrus and was suppressed in psyllids. SC2_gp095 was cloned in a shuttle vector and transformed into Escherichia coli and Liberibacter crescens, a culturable proxy for 'Ca. L. asiaticus'. Transformed L. crescens cells showed 20 to 25% enhanced resistance to H₂O₂on agar plates, 47% greater enzymatic activity, and enhanced growth in liquid cultures. A nonclassical secretion potential was predicted for SC2_gp095 and secretion from L. crescens was confirmed by enzymatic and Western blot analyses. Transient expression of SC2_gp095 in planta resulted in strong transcriptional downregulation of RbohB, the key gatekeeper of the H₂O₂-mediated defense signaling in plants, helping explain the surprisingly long incubation period (years) before HLB symptoms appear in 'Ca. L. asiaticus'-infected citrus. 'Ca. L. asiaticus' peroxidase is likely a secreted, horizontally acquired effector that suppresses host symptom development, a tactic used by most biotrophic plant pathogens. PMID:26313412

  13. Transmission and Propagation of 'Candidatus Liberibacter asiaticus' by Grafting with Individual Citrus Leaves.

    Science.gov (United States)

    Hilf, Mark E; Lewis, Reid S

    2016-05-01

    Huanglongbing (HLB) is a chronic, progressive decline disease in citrus associated with a systemic infection by the bacterium 'Candidatus Liberibacter asiaticus'. Transmission of the bacterium in the field is by the Asian citrus psyllid, Diaphorina citri Kuwayama. Experimental propagation of 'Ca. L. asiaticus' is done primarily by grafting pieces of bud wood from an infected plant. To produce a small-scale model system for investigation of pathogen biology, we investigated grafting single leaves from infected citrus plants as sources of inoculum for propagation of the bacterium. In total, 162 plants ranging in age from 3 to 18 months were grafted. Grafting with intact asymptomatic and HLB-symptomatic leaves resulted in 61 of 78 (78%) and 35 of 41 (85%) of the plants infected with 'Ca. L. asiaticus', respectively. Inoculum consisting of the leaf petiole only or only an inoculum tissue remnant under the bark of the receptor tree resulted in 6 of 12 (50%) and 7 of 31 (23%) infected trees, respectively. Real-time polymerase chain reaction (qPCR) assays verified the infection in plants, a majority of which developed the foliar blotchy mottle symptom considered diagnostic for HLB, while some plants also displayed the stunted, chlorotic shoots for which the disease is named. The qPCR data together with the symptoms displayed demonstrated that individual leaves from infected trees can serve as effective inoculum sources for transmission and propagation of 'Ca. L. asiaticus' via grafting. PMID:26807818

  14. Metabolite signature of Candidatus Liberibacter asiaticus infection in two citrus varieties.

    Science.gov (United States)

    Chin, Elizabeth L; Mishchuk, Darya O; Breksa, Andrew P; Slupsky, Carolyn M

    2014-07-16

    Huanglongbing (HLB), also known as Citrus Greening Disease, is caused by the bacterium 'Candidatus Liberibacter asiaticus' (CLas) and is a serious threat to the citrus industry. To understand the effect of CLas infection on the citrus metabolome, juice from healthy (n = 18), HLB-asymptomatic (n = 18), and HLB-symptomatic Hamlin (n = 18), as well as from healthy (n = 18) and HLB-symptomatic (n = 18) Valencia sweet oranges (from southern and eastern Florida) were evaluated using (1)H NMR-based metabolomics. Differences in the concentration of several metabolites including phenylalanine, histidine, limonin, and synephrine between control or asymptomatic fruit and symptomatic fruit were observed regardless of the citrus variety or location. There were no clear differences between the metabolite profiles of Hamlin fruits classified by PCR as asymptomatic and control, suggesting that some of the control fruit may have been infected. Taken together, these data indicate that infection due to CLas presents a strong metabolic response that is observed across different cultivars and regions, suggesting the potential for generation of metabolite-based biomarkers of CLas infection. PMID:24959841

  15. Changes in Variable Number of Tandem Repeats in ‘Candidatus Liberibacter asiaticus’ through Insect Transmission

    Science.gov (United States)

    2015-01-01

    Citrus greening (huanglongbing) is the most destructive citrus disease worldwide. The disease is associated with three species of ‘Candidatus Liberibacter’ among which ‘Ca. Liberibacter asiaticus’ has the widest distribution. ‘Ca. L. asiaticus’ is commonly transmitted by a phloem-feeding insect vector, the Asian citrus psyllid Diaphorina citri. A previous study showed that isolates of ‘Ca. L. asiaticus’ were clearly differentiated by variable number of tandem repeat (VNTR) profiles at four loci in the genome. In this study, the VNTR analysis was further validated by assessing the stability of these repeats after multiplication of the pathogen upon host-to-host transmission using a ‘Ca. L. asiaticus’ strain from Japan. The results showed that some tandem repeats showed detectable changes after insect transmission. To our knowledge, this is the first report to demonstrate that the repeat numbers VNTR 002 and 077 of ‘Ca. L. asiaticus’ change through psyllid transmission. VNTRs in the recipient plant were apparently unrelated to the growing phase of the vector. In contrast, changes in the number of tandem repeats increased with longer acquisition and inoculation access periods, whereas changes were not observed through psyllid transmission after relatively short acquisition and inoculation access periods, up to 20 and 19 days, respectively. PMID:26402645

  16. Characterization of "Candidatus Liberibacter asiaticus" populations by double-locus analyses.

    Science.gov (United States)

    Deng, X; Lopes, S; Wang, X; Sun, X; Jones, D; Irey, M; Civerolo, E; Chen, J

    2014-10-01

    "Candidatus Liberibacter asiaticus" (CaLas) is associated with citrus Huanglongbing (HLB, yellow shoot disease), which is highly destructive to world citrus production. Understanding the relationships of CaLas isolates from different geographical regions is important for HLB research and development of disease management strategies. In this study, 301 CaLas isolates [85 Brazil, 132 China, and 84 U.S. (83 Florida and 1 California)] were collected, and genomic variations among them were evaluated based on the analyses of two genomic loci: trn1, characteristic of variable tandem repeat numbers (TRNs), and snp1, characteristic of single nucleotide polymorphisms (SNPs). Locus trn1 revealed the homogeneity of all Brazilian isolates, and locus snp1 revealed the homogeneity of most Florida isolates. When the two loci were analyzed simultaneously, i.e., double-locus (DL) analyses, CaLas isolates were clustered mostly according to geographical origins. DL genotype 1 included 97 % of the Chinese isolates, DL genotype 2 included all Brazilian isolates, and DL genotype 3 included 93 % of the U.S. isolates. DL analyses successfully revealed inter-continental overlapping or movement pattern of CaLas isolates. The isolate recently found in California belonged to Asiatic DL genotype 1. PMID:24912994

  17. Amino acids implicated in plant defense are higher in Candidatus Liberibacter asiaticus-tolerant citrus varieties.

    Science.gov (United States)

    Killiny, Nabil; Hijaz, Faraj

    2016-04-01

    Citrus Huanglongbing (HLB), also known as citrus greening, has been threatening the citrus industry since the early 1900's and up to this date there are no effective cures for this disease. Field observations and greenhouse controlled studies demonstrated that some citrus genotypes are more tolerant to Candidatus Liberibacter asiaticus (CLas) pathogen than others. However, the mechanisms underpinning tolerance has not been determined yet. The phloem sap composition of CLas-tolerant and sensitive citrus varieties was studied to identify metabolites that could be responsible for their tolerance to CLas. The citrus phloem sap was collected by centrifugation and was analyzed with gas chromatography-mass spectrometry after methyl chloroformate derivatization. Thirty-three metabolites were detected in the phloem sap of the studied varieties: twenty 20 amino acids, eight 8 organic acids, and five 5 fatty acids. Interestingly, the levels of most amino acids, especially those implicated in plantdefense to pathogens such as phenylalanine, tyrosine, tryptophan, lysine, and asparagine were higher in tolerant varieties. Although the level of organic acids varied between cultivars, this variation was not correlated with citrus resistance to CLas and could be cultivar specific. The fatty acids were found in trace amounts and in most cases their levels were not significantly different among varieties. Better understanding of the mechanisms underpinning citrus tolerance to CLas will help in developing economically tolerant varieties. PMID:27057814

  18. Complete genome sequence of citrus huanglongbing bacterium, 'Candidatus Liberibacter asiaticus' obtained through metagenomics.

    Science.gov (United States)

    Duan, Yongping; Zhou, Lijuan; Hall, David G; Li, Wenbin; Doddapaneni, Harshavardhan; Lin, Hong; Liu, Li; Vahling, Cheryl M; Gabriel, Dean W; Williams, Kelly P; Dickerman, Allan; Sun, Yijun; Gottwald, Tim

    2009-08-01

    Citrus huanglongbing is the most destructive disease of citrus worldwide. It is spread by citrus psyllids and is associated with a low-titer, phloem-limited infection by any of three uncultured species of alpha-Proteobacteria, 'Candidatus Liberibacter asiaticus', 'Ca. L. americanus', and 'Ca. L. africanus'. A complete circular 'Ca. L. asiaticus' genome has been obtained by metagenomics, using the DNA extracted from a single 'Ca. L. asiaticus'-infected psyllid. The 1.23-Mb genome has an average 36.5% GC content. Annotation revealed a high percentage of genes involved in both cell motility (4.5%) and active transport in general (8.0%), which may contribute to its virulence. 'Ca. L. asiaticus' appears to have a limited ability for aerobic respiration and is likely auxotrophic for at least five amino acids. Consistent with its intracellular nature, 'Ca. L. asiaticus' lacks type III and type IV secretion systems as well as typical free-living or plant-colonizing extracellular degradative enzymes. 'Ca. L. asiaticus' appears to have all type I secretion system genes needed for both multidrug efflux and toxin effector secretion. Multi-protein phylogenetic analysis confirmed 'Ca. L. asiaticus' as an early-branching and highly divergent member of the family Rhizobiaceae. This is the first genome sequence of an uncultured alpha-proteobacteria that is both an intracellular plant pathogen and insect symbiont. PMID:19589076

  19. Development of Quantitative Real-time PCR Assays for Different Clades of “Candidatus Accumulibacter”

    Science.gov (United States)

    Zhang, An Ni; Mao, Yanping; Zhang, Tong

    2016-01-01

    We designed novel quantitative real-time polymerase chain reaction (qPCR) primers for the polyphosphate kinase 1 (ppk1) gene, targeting eight individual “Candidatus Accumulibacter” (referred to as Accumulibacter) clades. An evaluation of primer sets was conducted regarding the coverage, specificity, and PCR efficiency. (i) All primer sets were designed to cover all available sequences of the target clade. (ii) The phylogenetic analysis of the sequences retrieved from the qPCR products by each primer set demonstrated a high level of specificity. (iii) All calibration curves presented high PCR efficiencies in the range of 85–112% (R2 = 0.962–0.998). In addition, the possible interference of non-target amplicons was individually examined using the qPCR assay for 13 Accumulibacter clades, which were either undetected or showed negligible detection. With the primers designed by other research groups, a highly selective and sensitive qPCR-based method was developed to quantify all Accumulibacter clades, with the exception of Clade IE, in one assay, which enables more comprehensive insights into the community dynamics. The applicability to environmental samples was demonstrated by profiling the Accumulibacter clades in activated sludge samples of nine full-scale wastewater treatment plants. PMID:27142574

  20. Changes in Variable Number of Tandem Repeats in 'Candidatus Liberibacter asiaticus' through Insect Transmission.

    Directory of Open Access Journals (Sweden)

    Hiroshi Katoh

    Full Text Available Citrus greening (huanglongbing is the most destructive citrus disease worldwide. The disease is associated with three species of 'Candidatus Liberibacter' among which 'Ca. Liberibacter asiaticus' has the widest distribution. 'Ca. L. asiaticus' is commonly transmitted by a phloem-feeding insect vector, the Asian citrus psyllid Diaphorina citri. A previous study showed that isolates of 'Ca. L. asiaticus' were clearly differentiated by variable number of tandem repeat (VNTR profiles at four loci in the genome. In this study, the VNTR analysis was further validated by assessing the stability of these repeats after multiplication of the pathogen upon host-to-host transmission using a 'Ca. L. asiaticus' strain from Japan. The results showed that some tandem repeats showed detectable changes after insect transmission. To our knowledge, this is the first report to demonstrate that the repeat numbers VNTR 002 and 077 of 'Ca. L. asiaticus' change through psyllid transmission. VNTRs in the recipient plant were apparently unrelated to the growing phase of the vector. In contrast, changes in the number of tandem repeats increased with longer acquisition and inoculation access periods, whereas changes were not observed through psyllid transmission after relatively short acquisition and inoculation access periods, up to 20 and 19 days, respectively.

  1. Latent period and transmission of "Candidatus Liberibacter solanacearum" by the potato psyllid Bactericera cockerelli (Hemiptera: Triozidae.

    Directory of Open Access Journals (Sweden)

    Venkatesan G Sengoda

    Full Text Available "Candidatus Liberibacter solanacearum" (Lso is an economically important pathogen of solanaceous crops and the putative causal agent of zebra chip disease of potato (Solanum tuberosum L.. This pathogen is transmitted to solanaceous species by the potato psyllid, Bactericera cockerelli (Šulc, but many aspects of the acquisition and transmission processes have yet to be elucidated. The present study was conducted to assess the interacting effects of acquisition access period, incubation period, and host plant on Lso titer in psyllids, the movement of Lso from the alimentary canal to the salivary glands of the insect, and the ability of psyllids to transmit Lso to non-infected host plants. Following initial pathogen acquisition, the probability of Lso presence in the alimentary canal remained constant from 0 to 3 weeks, but the probability of Lso being present in the salivary glands increased with increasing incubation period. Lso copy numbers in psyllids peaked two weeks after the initial pathogen acquisition and psyllids were capable of transmitting Lso to non-infected host plants only after a two-week incubation period. Psyllid infectivity was associated with colonization of insect salivary glands by Lso and with Lso copy numbers >10,000 per psyllid. Results of our study indicate that Lso requires a two-week latent period in potato psyllids and suggest that acquisition and transmission of Lso by psyllids follows a pattern consistent with a propagative, circulative, and persistent mode of transmission.

  2. Candidatus Accumulibacter phosphatis clades enriched under cyclic anaerobic and microaerobic conditions simultaneously use different electron acceptors.

    Science.gov (United States)

    Camejo, Pamela Y; Owen, Brian R; Martirano, Joseph; Ma, Juan; Kapoor, Vikram; Santo Domingo, Jorge; McMahon, Katherine D; Noguera, Daniel R

    2016-10-01

    Lab- and pilot-scale simultaneous nitrification, denitrification and phosphorus removal-sequencing batch reactors were operated under cyclic anaerobic and micro-aerobic conditions. The use of oxygen, nitrite, and nitrate as electron acceptors by Candidatus Accumulibacter phosphatis during the micro-aerobic stage was investigated. A complete clade-level characterization of Accumulibacter in both reactors was performed using newly designed qPCR primers targeting the polyphosphate kinase gene (ppk1). In the lab-scale reactor, limited-oxygen conditions led to an alternated dominance of Clade IID and IC over the other clades. Results from batch tests when Clade IC was dominant (i.e., >92% of Accumulibacter) showed that this clade was capable of using oxygen, nitrite and nitrate as electron acceptors for P uptake. A more heterogeneous distribution of clades was found in the pilot-scale system (Clades IIA, IIB, IIC, IID, IA, and IC), and in this reactor, oxygen, nitrite and nitrate were also used as electron acceptors coupled to phosphorus uptake. However, nitrite was not an efficient electron acceptor in either reactor, and nitrate allowed only partial P removal. The results from the Clade IC dominated reactor indicated that either organisms in this clade can simultaneously use multiple electron acceptors under micro-aerobic conditions, or that the use of multiple electron acceptors by Clade IC is due to significant microdiversity within the Accumulibacter clades defined using the ppk1 gene. PMID:27340814

  3. Localization of 'Candidatus Liberibacter solanacearum' and Evidence for Surface Appendages in the Potato Psyllid Vector.

    Science.gov (United States)

    Cicero, J M; Fisher, T W; Brown, J K

    2016-02-01

    The potato psyllid Bactericera cockerelli is implicated as the vector of the causal agent of zebra chip of potato and vein-greening of tomato diseases. Until now, visual identification of bacteria in the genus 'Candidatus Liberibacter' has relied on direct imaging by light and electron microscopy without labeling, or with whole-organ fluorescence labeling only. In this study, aldehyde fixative followed by a coagulant fixative, was used to process adult psyllids for transmission electron microscopy (TEM) colloidal gold in situ hybridization experiments. Results indicated that 'Ca. Liberibacter solanacearum' (CLso)-specific DNA probes annealed to a bacterium that formed extensive, monocultural biofilms on gut, salivary gland, and oral region tissues, confirming that it is one morphotype of potentially others, that is rod-shaped, approximately 2.5 µm in diameter and of variable length, and has a rough, granular cytosol. In addition, CLso, prepared from shredded midguts, and negatively stained for TEM, possessed pili- and flagella-like surface appendages. Genes implicating coding capacity for both types of surface structures are encoded in the CLso genome sequence. Neither type was seen for CLso associated with biofilms within or on digestive organs, suggesting that their production is stimulated only in certain environments, putatively, in the gut during adhesion leading to multiplication, and in hemolymph to afford systemic invasion. PMID:26551449

  4. Polymerase chain reaction detection of candidatus liberibacter asiatic associated with citrus huanglonbing

    Directory of Open Access Journals (Sweden)

    G.P. Jagtap

    2012-08-01

    Full Text Available Polymerase chain reaction diagnosis of Candidatus liberibacter asiatic associated with citrus Huanglonbing disease is molecular technique which is used for detection of disease when pathogen present is very low concentration in disease sample. Among these three DNA isolation methods viz., commercial kit method, sodium sulphite method and membrane bard nucleic acid technique, sodium sulphite method is cost effective for commercial use. In nucleic acid membrane method for DNA extraction isolation there is no use of liquid nitrogen. Polymerase chain reaction detection of disease is based on principal of thermal cycling in which PCR instrument allow to run generally 60-65 thermal cycle, during PCR operation it allow different stages of cycle at different temperatures for different period of time i.e. initiation (940C, denaturation (940C, primer annealing (600C, extension/elongation step (720C, final elongation (720C and holding temperature (40C. PCR based diagnosis system is developed for detection of greening bacteria. The comparative cost of detection by various combinations of reagent and sampling time was determined and cost effective technology was standardized and validated.

  5. Similarities and differences in physiological responses to 'Candidatus Liberibacter solanacearum' infection among different potato cultivars.

    Science.gov (United States)

    Wallis, C M; Rashed, A; Wallingford, A K; Paetzold, L; Workneh, F; Rush, C M

    2014-02-01

    Zebra chip disease (ZC), putatively caused by the fastidious bacterium 'Candidatus Liberibacter solanacearum', is a threat to potato growers worldwide. However, little is known about biochemical shifts in different potato genotypes in response to 'Ca. L. solanacearum' infection. To address this, 'Red La Soda', 'Russet Norkotah', and 'FL 1867' potato were infected with 'Ca. L. solanacearum' 4, 3, 2, and 1 weeks before harvest to observe variability in cultivar responses to 'Ca. L. solanacearum' infection. ZC symptoms, 'Ca. L. solanacearum' titers, and tuber biochemistry were assessed. Red La Soda tubers exhibited greater symptoms when infected for 4 weeks than Russet Norkotah or FL 1867 tubers. 'Ca. L. solanacearum' titers did not vary among cultivars. Tuber levels of amino acids, carbohydrates, and phenolics varied among cultivars but no consistent trends were observed. Individual amino acids and phenolics were greater in FL 1867 than Red La Soda, whereas others were greater in Red La Soda or Russet Norkotah than FL 1867. Most amino acids, carbohydrates, and phenolics were positively associated with infection duration and symptoms regardless of cultivar. Associations between most of the evaluated compounds and 'Ca. L. solanacearum' titer were positive in Red La Soda. However, no associations between 'Ca. L. solanacearum' quantity and compounds were observed in FL 1867 and Russet Norkotah. PMID:23941779

  6. Cell adhesion, multicellular morphology, and magnetosome distribution in the multicellular magnetotactic prokaryote Candidatus Magnetoglobus multicellularis.

    Science.gov (United States)

    Abreu, Fernanda; Silva, Karen Tavares; Leão, Pedro; Guedes, Iame Alves; Keim, Carolina Neumann; Farina, Marcos; Lins, Ulysses

    2013-06-01

    Candidatus Magnetoglobus multicellularis is an uncultured magnetotactic multicellular prokaryote composed of 17-40 Gram-negative cells that are capable of synthesizing organelles known as magnetosomes. The magnetosomes of Ca. M. multicellularis are composed of greigite and are organized in chains that are responsible for the microorganism's orientation along magnetic field lines. The characteristics of the microorganism, including its multicellular life cycle, magnetic field orientation, and swimming behavior, and the lack of viability of individual cells detached from the whole assembly, are considered strong evidence for the existence of a unique multicellular life cycle among prokaryotes. It has been proposed that the position of each cell within the aggregate is fundamental for the maintenance of its distinctive morphology and magnetic field orientation. However, the cellular organization of the whole organism has never been studied in detail. Here, we investigated the magnetosome organization within a cell, its distribution within the microorganism, and the intercellular relationships that might be responsible for maintaining the cells in the proper position within the microorganism, which is essential for determining the magnetic properties of Ca. M. multicellularis during its life cycle. The results indicate that cellular interactions are essential for the determination of individual cell shape and the magnetic properties of the organism and are likely directly associated with the morphological changes that occur during the multicellular life cycle of this species. PMID:23551897

  7. Transcriptional Analyses of Mandarins Seriously Infected by ‘Candidatus Liberibacter asiaticus’

    Science.gov (United States)

    Zheng, Zheng; Dai, Zehan; Tao, Yang; Deng, Xiaoling

    2015-01-01

    A range of leaf symptoms, including blotchy mottle, yellowing, and small, upright leaves with a variety of chlorotic patterns resembling those induced by zinc deficiencies, are associated with huanglongbing (HLB, yellow shoot disease), a worldwide destructive citrus disease. HLB is presumably caused by the phloem-limited fastidious prokaryotic α-proteobacterium ‘Candidatus Liberibacter spp.’ Previous studies focused on the proteome and transcriptome analyses of citrus 5 to 35 weeks after ‘Ca. L. spp.’ inoculation. In this study, gene expression profiles were analyzed from mandarin Citrus reticulate Blanco cv. jiaogan leaves after a 2 year infection with ‘Ca. L. asiaticus’. The Affymetrix microarray analysis explored 2,017 differentially expressed genes. Of the 1,364 genes had known functions, 938 (46.5%) were up-regulated. Genes related to photosynthesis, carbohydrate metabolic, and structure were mostly down-regulated, with rates of 92.7%, 61.0%, and 80.2%, respectively. Genes associated with oxidation-reduction and transport were mostly up-regulated with the rates of 75.0% and 64.6%, respectively. Our data analyses implied that the infection of ‘Ca. L. asiaticus’ could alter hormone crosstalk, inducing the jasmine acid pathway and depressing the ethylene and salicylic acid pathways in the citrus host. This study provides an enhanced insight into the host response of citrus to ‘Ca. L. asiaticus’ infection at a two-years infection stage. PMID:26196297

  8. Development of Quantitative Real-time PCR Assays for Different Clades of “Candidatus Accumulibacter”

    Science.gov (United States)

    Zhang, An Ni; Mao, Yanping; Zhang, Tong

    2016-05-01

    We designed novel quantitative real-time polymerase chain reaction (qPCR) primers for the polyphosphate kinase 1 (ppk1) gene, targeting eight individual “Candidatus Accumulibacter” (referred to as Accumulibacter) clades. An evaluation of primer sets was conducted regarding the coverage, specificity, and PCR efficiency. (i) All primer sets were designed to cover all available sequences of the target clade. (ii) The phylogenetic analysis of the sequences retrieved from the qPCR products by each primer set demonstrated a high level of specificity. (iii) All calibration curves presented high PCR efficiencies in the range of 85–112% (R2 = 0.962–0.998). In addition, the possible interference of non-target amplicons was individually examined using the qPCR assay for 13 Accumulibacter clades, which were either undetected or showed negligible detection. With the primers designed by other research groups, a highly selective and sensitive qPCR-based method was developed to quantify all Accumulibacter clades, with the exception of Clade IE, in one assay, which enables more comprehensive insights into the community dynamics. The applicability to environmental samples was demonstrated by profiling the Accumulibacter clades in activated sludge samples of nine full-scale wastewater treatment plants.

  9. Development of Quantitative Real-time PCR Assays for Different Clades of "Candidatus Accumulibacter".

    Science.gov (United States)

    Zhang, An Ni; Mao, Yanping; Zhang, Tong

    2016-01-01

    We designed novel quantitative real-time polymerase chain reaction (qPCR) primers for the polyphosphate kinase 1 (ppk1) gene, targeting eight individual "Candidatus Accumulibacter" (referred to as Accumulibacter) clades. An evaluation of primer sets was conducted regarding the coverage, specificity, and PCR efficiency. (i) All primer sets were designed to cover all available sequences of the target clade. (ii) The phylogenetic analysis of the sequences retrieved from the qPCR products by each primer set demonstrated a high level of specificity. (iii) All calibration curves presented high PCR efficiencies in the range of 85-112% (R(2) = 0.962-0.998). In addition, the possible interference of non-target amplicons was individually examined using the qPCR assay for 13 Accumulibacter clades, which were either undetected or showed negligible detection. With the primers designed by other research groups, a highly selective and sensitive qPCR-based method was developed to quantify all Accumulibacter clades, with the exception of Clade IE, in one assay, which enables more comprehensive insights into the community dynamics. The applicability to environmental samples was demonstrated by profiling the Accumulibacter clades in activated sludge samples of nine full-scale wastewater treatment plants. PMID:27142574

  10. Unique features of a Japanese 'Candidatus Liberibacter asiaticus' strain revealed by whole genome sequencing.

    Directory of Open Access Journals (Sweden)

    Hiroshi Katoh

    Full Text Available Citrus greening (huanglongbing is the most destructive disease of citrus worldwide. It is spread by citrus psyllids and is associated with phloem-limited bacteria of three species of α-Proteobacteria, namely, 'Candidatus Liberibacter asiaticus', 'Ca. L. americanus', and 'Ca. L. africanus'. Recent findings suggested that some Japanese strains lack the bacteriophage-type DNA polymerase region (DNA pol, in contrast to the Floridian psy62 strain. The whole genome sequence of the pol-negative 'Ca. L. asiaticus' Japanese isolate Ishi-1 was determined by metagenomic analysis of DNA extracted from 'Ca. L. asiaticus'-infected psyllids and leaf midribs. The 1.19-Mb genome has an average 36.32% GC content. Annotation revealed 13 operons encoding rRNA and 44 tRNA genes, but no typical bacterial pathogenesis-related genes were located within the genome, similar to the Floridian psy62 and Chinese gxpsy. In contrast to other 'Ca. L. asiaticus' strains, the genome of the Japanese Ishi-1 strain lacks a prophage-related region.

  11. Changes in Variable Number of Tandem Repeats in 'Candidatus Liberibacter asiaticus' through Insect Transmission.

    Science.gov (United States)

    Katoh, Hiroshi; Inoue, Hiromitsu; Iwanami, Toru

    2015-01-01

    Citrus greening (huanglongbing) is the most destructive citrus disease worldwide. The disease is associated with three species of 'Candidatus Liberibacter' among which 'Ca. Liberibacter asiaticus' has the widest distribution. 'Ca. L. asiaticus' is commonly transmitted by a phloem-feeding insect vector, the Asian citrus psyllid Diaphorina citri. A previous study showed that isolates of 'Ca. L. asiaticus' were clearly differentiated by variable number of tandem repeat (VNTR) profiles at four loci in the genome. In this study, the VNTR analysis was further validated by assessing the stability of these repeats after multiplication of the pathogen upon host-to-host transmission using a 'Ca. L. asiaticus' strain from Japan. The results showed that some tandem repeats showed detectable changes after insect transmission. To our knowledge, this is the first report to demonstrate that the repeat numbers VNTR 002 and 077 of 'Ca. L. asiaticus' change through psyllid transmission. VNTRs in the recipient plant were apparently unrelated to the growing phase of the vector. In contrast, changes in the number of tandem repeats increased with longer acquisition and inoculation access periods, whereas changes were not observed through psyllid transmission after relatively short acquisition and inoculation access periods, up to 20 and 19 days, respectively. PMID:26402645

  12. Transient Expression of Candidatus Liberibacter Asiaticus Effector Induces Cell Death in Nicotiana benthamiana.

    Science.gov (United States)

    Pitino, Marco; Armstrong, Cheryl M; Cano, Liliana M; Duan, Yongping

    2016-01-01

    Candidatus Liberibacter asiaticus "Las" is a phloem-limited bacterial plant pathogen, and the most prevalent species of Liberibacter associated with citrus huanglongbing (HLB), a devastating disease of citrus worldwide. Although, the complete sequence of the Las genome provides the basis for studying functional genomics of Las and molecular mechanisms of Las-plant interactions, the functional characterization of Las effectors remains a slow process since remains to be cultured. Like other plant pathogens, Las may deliver effector proteins into host cells and modulate a variety of host cellular functions for their infection progression. In this study, we identified 16 putative Las effectors via bioinformatics, and transiently expressed them in Nicotiana benthamiana. Diverse subcellular localization with different shapes and aggregation patterns of the effector candidates were revealed by UV- microscopy after transient expression in leaf tissue. Intriguingly, one of the 16 candidates, Las5315mp (mature protein), was localized in the chloroplast and induced cell death at 3 days post inoculation (dpi) in N. benthamiana. Moreover, Las5315mp induced strong callose deposition in plant cells. This study provides new insights into the localizations and potential roles of these Las effectors in planta. PMID:27458468

  13. Symbiotic adaptation drives genome streamlining of the cyanobacterial sponge symbiont "Candidatus Synechococcus pongiarum"

    KAUST Repository

    Gao, Zhao-Ming

    2014-04-01

    "Candidatus Synechococcus spongiarum" is a cyanobacterial symbiont widely distributed in sponges, but its functions at the genome level remain unknown. Here, we obtained the draft genome (1.66 Mbp, 90% estimated genome recovery) of "Ca. Synechococcus spongiarum" strain SH4 inhabiting the Red Sea sponge Carteriospongia foliascens. Phylogenomic analysis revealed a high dissimilarity between SH4 and free-living cyanobacterial strains. Essential functions, such as photosynthesis, the citric acid cycle, and DNA replication, were detected in SH4. Eukaryoticlike domains that play important roles in sponge-symbiont interactions were identified exclusively in the symbiont. However, SH4 could not biosynthesize methionine and polyamines and had lost partial genes encoding low-molecular-weight peptides of the photosynthesis complex, antioxidant enzymes, DNA repair enzymes, and proteins involved in resistance to environmental toxins and in biosynthesis of capsular and extracellular polysaccharides. These genetic modifications imply that "Ca. Synechococcus spongiarum" SH4 represents a low-light-adapted cyanobacterial symbiont and has undergone genome streamlining to adapt to the sponge\\'s mild intercellular environment. 2014 Gao et al.

  14. Relación entre Bactericera cockerelli y presencia de Candidatus Liberibacter psyllaurous en lotes comerciales de papa Relation between Bactericera cockerelli and presence of Candidatus Liberibacter psyllaurous in commercial fields of potato

    Directory of Open Access Journals (Sweden)

    Oswaldo Ángel Rubio-Covarrubias

    2011-02-01

    Full Text Available La brotación anormal de los tubérculos (sin brotes o brotes ahilados y el pardeamiento interno de los tubérculos, son síntomas de una enfermedad que está afectando la producción de papa en México, en el suroeste de Estados Unidos y América central. Esta enfermedad ha sido asociada con el psilido de la papa Bactericera cockerelli Sulc. Con el objetivo de dilucidar las causas de esta enfermedad, en 2007 se llevó a cabo un muestreo en 11 lotes comerciales de papa localizados en un transecto altitudinal entre 2 600 y 3 500 m en la región productora de papa de Toluca. La población de B. cockerelli fue determinada mediante muestreos semanales de los insectos adultos atrapados en trampas amarillas pegajosas. Al final del periodo de crecimiento del cultivo, los tubérculos producidos en cada lote fueron muestreados y almacenados por 6 meses. Después de este tiempo, se determinó el porcentaje de tubérculos con brotación anormal y se hicieron análisis con PCR para determinar la presencia de Candidatus Liberibacter psyllaurous y de fitoplasmas en los tubérculos. Los resultados indican que la población de B. cockerelli y de los síntomas de la punta morada de la papa disminuyeron con la altura, en alturas superiores a 3 200 msnm no se presentaron problemas significativas de la enfermedad. El 36% de los tubérculos con brotes finos presentó el pardeamiento interno y 58% de los tubérculos sin brotes presentó el mismo síntoma. El 54% de los tubérculos con brotación anormal fue positivo a Candidatus Liberibacter psyllaurous y sólo 3.5% a fitoplasmas. Estos resultados indican que Candidatus Liberibacter psyllaurous está asociada con los síntomas de la punta morada de la papa en la región de Toluca.The abnormal sprouting of tubers (without sprouts or with threadlike sprouts and the internal browning of the potatoes are symptoms of a disease which is affecting the potato production in Mexico, in southwestern United States and Central

  15. Metagenome analysis of a complex community reveals the metabolic blueprint of anammox bacterium ‘Candidatus Jettenia asiatica’

    Directory of Open Access Journals (Sweden)

    ZiyeHu

    2012-10-01

    Full Text Available Anammox bacteria are key players in the global nitrogen cycle and responsible for up to 50% of global nitrogen loss. Because of their cost effective application in anaerobic nitrogen removal, the anammox bacteria are widely implemented in wastewater treatment. Currently, five genera of anammox bacteria have been identified, together forming a deep branching order in the Planctomycetes-Verrucomicrobium- Chlamydiae (PVC superphylum. Members of all genera have been detected in wastewater treatment plants, but metagenomic information is not yet available for all genera. Here we report the metagenomic analysis of an enrichment dominated by ‘Candidatus Jettenia asiatica’. The whole microbial community o\tf a granular sludge anammox reactor was sequenced using both illumina and 454 pyrosequencing. The sludge was previously shown to have a ~50% enrichment of the anammox bacterium ‘Candidatus Jettenia asiatica’ by 16S rRNA gene analysis. After de novo assembly 37,432 contigs with an average length of 571 nt were obtained. The contigs were then analyzed by BLASTx searches against the protein sequences of ‘Candidatus Kuenenia stuttgartiensis’ and a set of 25 genes essential in anammox metabolism were detected. Additionally all reads were mapped to the genome of an anammox strain KSU-1 and de novo assembly was performed again using the reads that could be mapped on KSU-1. Using this approach, a gene encoding copper-containing nitrite reductase NirK was identified in the genome, instead of cytochrome cd1-type nitrite reductase NirS that is responsible for the nitrite reduction of ‘Ca. Kuenenia stuttgartiensis’ and ‘Ca. Scalindua profunda’. Finally, the community composition was investigated through MetaCluster analysis, 16S rRNA gene analysis and read mapping, which showed the presence of other important community members such as aerobic ammonia-oxidizing bacteria, methane producing microorganisms and denitrifying methanotroph 'Ca

  16. Effective antibiotics against 'Candidatus Liberibacter asiaticus' in HLB-affected citrus plants identified via the graft-based evaluation.

    Directory of Open Access Journals (Sweden)

    Muqing Zhang

    Full Text Available Citrus huanglongbing (HLB, caused by three species of fastidious, phloem-limited 'Candidatus Liberibacter', is one of the most destructive diseases of citrus worldwide. To date, there is no established cure for this century-old and yet, newly emerging disease. As a potential control strategy for citrus HLB, 31 antibiotics were screened for effectiveness and phytotoxicity using the optimized graft-based screening system with 'Candidatus Liberibacter asiaticus' (Las-infected citrus scions. Actidione and Oxytetracycline were the most phytotoxic to citrus with less than 10% of scions surviving and growing; therefore, this data was not used in additional analyses. Results of principal component (PCA and hierarchical clustering analyses (HCA demonstrated that 29 antibiotics were clustered into 3 groups: highly effective, partly effective, and not effective. In spite of different modes of actions, a number of antibiotics such as, Ampicillin, Carbenicillin, Penicillin, Cefalexin, Rifampicin and Sulfadimethoxine were all highly effective in eliminating or suppressing Candidatus Liberibacter asiaticus indicated by both the lowest Las infection rate and titers of the treated scions and inoculated rootstock. The non-effective group, including 11 antibiotics alone with three controls, such as Amikacin, Cinoxacin, Gentamicin, Kasugamycin, Lincomycin, Neomycin, Polymixin B and Tobramycin, did not eliminate or suppress Las in the tested concentrations, resulting in plants with increased titers of Las. The other 12 antibiotics partly eliminated or suppressed Las in the treated and graft-inoculated plants. The effective and non-phytotoxic antibiotics could be potential candidates for control of citrus HLB, either for the rescue of infected citrus germplasm or for restricted field application.

  17. Natural variation in SAR11 marine bacterioplankton genomes inferred from metagenomic data

    Directory of Open Access Journals (Sweden)

    Wilhelm Larry J

    2007-11-01

    Full Text Available Abstract Background One objective of metagenomics is to reconstruct information about specific uncultured organisms from fragmentary environmental DNA sequences. We used the genome of an isolate of the marine alphaproteobacterium SAR11 ('Candidatus Pelagibacter ubique'; strain HTCC1062, obtained from the cold, productive Oregon coast, as a query sequence to study variation in SAR11 metagenome sequence data from the Sargasso Sea, a warm, oligotrophic ocean gyre. Results The average amino acid identity of SAR11 genes encoded by the metagenomic data to the query genome was only 71%, indicating significant evolutionary divergence between the coastal isolates and Sargasso Sea populations. However, an analysis of gene neighbors indicated that SAR11 genes in the Sargasso Sea metagenomic data match the gene order of the HTCC1062 genome in 96% of cases (> 85,000 observations, and that rearrangements are most frequent at predicted operon boundaries. There were no conserved examples of genes with known functions being found in the coastal isolates, but not the Sargasso Sea metagenomic data, or vice versa, suggesting that core regions of these diverse SAR11 genomes are relatively conserved in gene content. However, four hypervariable regions were observed, which may encode properties associated with variation in SAR11 ecotypes. The largest of these, HVR2, is a 48 kb region flanked by the sole 5S and 23S genes in the HTCC1062 genome, and mainly encodes genes that determine cell surface properties. A comparison of two closely related 'Candidatus Pelagibacter' genomes (HTCC1062 and HTCC1002 revealed a number of "gene indels" in core regions. Most of these were found to be polymorphic in the metagenomic data and showed evidence of purifying selection, suggesting that the same "polymorphic gene indels" are maintained in physically isolated SAR11 populations. Conclusion These findings suggest that natural selection has conserved many core features of SAR11

  18. Identification of small molecule inhibitors against SecA of Candidatus Liberibacter asiaticus by structure based design

    OpenAIRE

    Akula, Nagaraju; Trivedi, Pankaj; Han, Frank Q.; Wang, Nian

    2014-01-01

    Huanglongbing is the most devastating disease of citrus caused by Candidatus Liberibacter asiaticus (Las) (1, 2). In the present study, we report the discovery of novel small molecule inhibitors against SecA ATPase of Las by using structure based design methods. We built the homology model of SecA protein structure of Las based on the SecA of Escherichia coli. The model was used for in-silico screening of commercially available compounds from ZINC database. Using the glide flexible molecular ...

  19. Proteomic analysis of the purple sulfur bacterium Candidatus “Thiodictyon syntrophicum” strain Cad16T isolated from Lake Cadagno

    Directory of Open Access Journals (Sweden)

    Nicola Storelli

    2014-03-01

    Full Text Available Lake Cadagno is characterised by a compact chemocline with high concentrations of purple sulfur bacteria (PSB. 2D-DIGE was used to monitor the global changes in the proteome of Candidatus “Thiodictyon syntrophicum” strain Cad16T both in the presence and absence of light. This study aimed to disclose details regarding the dark CO2 assimilation of the PSB, as this mechanism is often observed but is not yet sufficiently understood. Our results showed the presence of 17 protein spots that were more abundant in the dark, including three enzymes that could be part of the autotrophic dicarboxylate/4-hydroxybutyrate cycle, normally observed in archaea.

  20. The hyperparasite of the rickettsiales-like prokaryote, Candidatus Xenohaliotis californiensis has morphological characteristics of a Siphoviridae (Caudovirales).

    Science.gov (United States)

    Cruz-Flores, Roberto; Cáceres-Martínez, Jorge

    2016-01-01

    Transmission electron microscopy analysis (TEM) of the rickettsiales-like prokaryote, Candidatus Xenohaliotis californiensis (CXc), pathogen of Haliotis spp. from the West Coast of North America, were found to be infected by a bacteriophage hyperparasite previously described in red abalone from California. The hyperparasite has an icosahedrical-like capsid with a narrow long flexible tail, this morphological characteristic tentatively place this virus in the Family Siphoviridae from the order Caudovirales. TEM images also showed the bacteriophage in different stages of assembly in the cytoplasm of CXc, demonstrating its lytic cycle. PMID:26585301

  1. A microdiversity study of anammox bacteria reveals a novel Candidatus Scalindua phylotype in marine oxygen minimum zones

    Digital Repository Service at National Institute of Oceanography (India)

    Woebken, D.; Lam, P.; Kuypers, M.M.M.; Naqvi, S.W.A.; Kartal, B.; Strous, M.; Jetten, M.S.M.; Fuchs, B.M.; Amann, R.

    to the subspecies level (Gürtler and Stanisich, 1996; Normand et al., 1996). Results Phylogenetic analysis based on 16S rRNA gene sequences From the five clone libraries constructed with the planctomycete-specific primer Pla46F and the universal primer1037R,1384... affiliated to the Candidatus genera of anammox bacteria and were further analysed. Sequences related to known anammox bacteria. 16S rRNA gene-ITS clone libraries of the three OMZs and the Black Sea suboxic water column constructed with primer Pla46F and 1037R...

  2. Metatranscriptomic insights on gene expression and regulatory controls in Candidatus Accumulibacter phosphatis.

    Science.gov (United States)

    Oyserman, Ben O; Noguera, Daniel R; del Rio, Tijana Glavina; Tringe, Susannah G; McMahon, Katherine D

    2016-04-01

    Previous studies on enhanced biological phosphorus removal (EBPR) have focused on reconstructing genomic blueprints for the model polyphosphate-accumulating organism Candidatus Accumulibacter phosphatis. Here, a time series metatranscriptome generated from enrichment cultures of Accumulibacter was used to gain insight into anerobic/aerobic metabolism and regulatory mechanisms within an EBPR cycle. Co-expressed gene clusters were identified displaying ecologically relevant trends consistent with batch cycle phases. Transcripts displaying increased abundance during anerobic acetate contact were functionally enriched in energy production and conversion, including upregulation of both cytoplasmic and membrane-bound hydrogenases demonstrating the importance of transcriptional regulation to manage energy and electron flux during anerobic acetate contact. We hypothesized and demonstrated hydrogen production after anerobic acetate contact, a previously unknown strategy for Accumulibacter to maintain redox balance. Genes involved in anerobic glycine utilization were identified and phosphorus release after anerobic glycine contact demonstrated, suggesting that Accumulibacter routes diverse carbon sources to acetyl-CoA formation via previously unrecognized pathways. A comparative genomics analysis of sequences upstream of co-expressed genes identified two statistically significant putative regulatory motifs. One palindromic motif was identified upstream of genes involved in PHA synthesis and acetate activation and is hypothesized to be a phaR binding site, hence representing a hypothetical PHA modulon. A second motif was identified ~35 base pairs (bp) upstream of a large and diverse array of genes and hence may represent a sigma factor binding site. This analysis provides a basis and framework for further investigations into Accumulibacter metabolism and the reconstruction of regulatory networks in uncultured organisms. PMID:26555245

  3. "Candidatus Liberibacter asiaticus" prophage late genes may limit host range and culturability.

    Science.gov (United States)

    Fleites, Laura A; Jain, Mukesh; Zhang, Shujian; Gabriel, Dean W

    2014-10-01

    "Candidatus Liberibacter asiaticus" is an uncultured alphaproteobacterium that systemically colonizes its insect host both inter- and intracellularly and also causes a severe, crop-destroying disease of citrus called huanglongbing, or citrus "greening." In planta, "Ca. Liberibacter asiaticus" is also systemic but phloem limited. "Ca. Liberibacter asiaticus" strain UF506 carries two predicted prophages, SC1 and SC2. Bacteriophage particles have been observed in experimentally "Ca. Liberibacter asiaticus"-infected periwinkle but not in any other host. Comparative gene expression analysis of predicted SC1 late genes showed a much higher level of late gene expression, including holin transcripts (SC1_gp110), in "Ca. Liberibacter asiaticus"-infected periwinkle relative to "Ca. Liberibacter asiaticus"-infected citrus. To functionally characterize predicted holin and endolysin activity, SC1_gp110 and two predicted endolysins, one within SC1 (SC1_gp035) and another well outside the predicted prophage region (CLIBASIA_04790), were cloned and expressed in Escherichia coli. Both SC1 genes inhibited bacterial growth consistent with holin and endolysin function. The holin (SC1_gp110) promoter region was fused with a uidA reporter on pUFR071, a wide bacterial host range (repW) replicon, and used to transform Liberibacter crescens strain BT-1 by electroporation. BT-1 is the only liberibacter strain cultured to date and was used as a proxy for "Ca. Liberibacter asiaticus." pUFR071 was >95% stable without selection in BT-1 for over 20 generations. The reporter construct exhibited strong constitutive glucuronidase (GUS) activity in culture-grown BT-1 cells. However, GUS reporter activity in BT-1 was suppressed in a dose-dependent manner by crude aqueous extracts from psyllids. Taken together with plant expression data, these observations indicate that "Ca. Liberibacter asiaticus" prophage activation may limit "Ca. Liberibacter asiaticus" host range and culturability. PMID:25063651

  4. Genetic Diversity of Candidatus Liberibacter asiaticus Based on Two Hypervariable Effector Genes in Thailand

    Science.gov (United States)

    Puttamuk, Thamrongjet; Zhou, Lijuan; Thaveechai, Niphone; Zhang, Shouan; Armstrong, Cheryl M.; Duan, Yongping

    2014-01-01

    Huanglongbing (HLB), also known as citrus greening, is one of the most destructive diseases of citrus worldwide. HLB is associated with three species of ‘Candidatus Liberibacter’ with ‘Ca. L. asiaticus’ (Las) being the most widely distributed around the world, and the only species detected in Thailand. To understand the genetic diversity of Las bacteria in Thailand, we evaluated two closely-related effector genes, lasAI and lasAII, found within the Las prophages from 239 infected citrus and 55 infected psyllid samples collected from different provinces in Thailand. The results indicated that most of the Las-infected samples collected from Thailand contained at least one prophage sequence with 48.29% containing prophage 1 (FP1), 63.26% containing prophage 2 (FP2), and 19.38% containing both prophages. Interestingly, FP2 was found to be the predominant population in Las-infected citrus samples while Las-infected psyllids contained primarily FP1. The multiple banding patterns that resulted from amplification of lasAI imply extensive variation exists within the full and partial repeat sequence while the single band from lasAII indicates a low amount of variation within the repeat sequence. Phylogenetic analysis of Las-infected samples from 22 provinces in Thailand suggested that the bacterial pathogen may have been introduced to Thailand from China and the Philippines. This is the first report evaluating the genetic variation of a large population of Ca. L. asiaticus infected samples in Thailand using the two effector genes from Las prophage regions. PMID:25437428

  5. The transcriptional activator LdtR from 'Candidatus Liberibacter asiaticus' mediates osmotic stress tolerance.

    Science.gov (United States)

    Pagliai, Fernando A; Gardner, Christopher L; Bojilova, Lora; Sarnegrim, Amanda; Tamayo, Cheila; Potts, Anastasia H; Teplitski, Max; Folimonova, Svetlana Y; Gonzalez, Claudio F; Lorca, Graciela L

    2014-04-01

    The causal agent of Huanglongbing disease, 'Candidatus Liberibacter asiaticus', is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from 'Ca. L. asiaticus' involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR), and a predicted L,D-transpeptidase (ldtP). In Sinorhizobium meliloti, mutation of ldtR resulted in morphological changes (shortened rod-type phenotype) and reduced tolerance to osmotic stress. A biochemical approach was taken to identify small molecules that modulate LdtR activity. The LdtR ligands identified by thermal shift assays were validated using DNA binding methods. The biological impact of LdtR inactivation by the small molecules was then examined in Sinorhizobium meliloti and Liberibacter crescens, where a shortened-rod phenotype was induced by growth in presence of the ligands. A new method was also developed to examine the effects of small molecules on the viability of 'Ca. Liberibacter asiaticus', using shoots from HLB-infected orange trees. Decreased expression of ldtRLas and ldtPLas was observed in samples taken from HLB-infected shoots after 6 h of incubation with the LdtR ligands. These results provide strong proof of concept for the use of small molecules that target LdtR, as a potential treatment option for Huanglongbing disease. PMID:24763829

  6. Transcriptional and microscopic analyses of citrus stem and root responses to Candidatus Liberibacter asiaticus infection.

    Directory of Open Access Journals (Sweden)

    Valente Aritua

    Full Text Available Huanglongbing (HLB is the most destructive disease that affects citrus worldwide. The disease has been associated with Candidatus Liberibacter. HLB diseased citrus plants develop a multitude of symptoms including zinc and copper deficiencies, blotchy mottle, corky veins, stunting, and twig dieback. Ca. L. asiaticus infection also seriously affects the roots. Previous study focused on gene expression of leaves and fruit to Ca. L. asiaticus infection. In this study, we compared the gene expression levels of stems and roots of healthy plants with those in Ca. L. asiaticus infected plants using microarrays. Affymetrix microarray analysis showed a total of 988 genes were significantly altered in expression, of which 885 were in the stems, and 111 in the roots. Of these, 551 and 56 were up-regulated, while 334 and 55 were down-regulated in the stem and root samples of HLB diseased trees compared to healthy plants, respectively. Dramatic differences in the transcriptional responses were observed between citrus stems and roots to Ca. L. asiaticus infection, with only 8 genes affected in both the roots and stems. The affected genes are involved in diverse cellular functions, including carbohydrate metabolism, cell wall biogenesis, biotic and abiotic stress responses, signaling and transcriptional factors, transportation, cell organization, protein modification and degradation, development, hormone signaling, metal handling, and redox. Microscopy analysis showed the depletion of starch in the roots of the infected plants but not in healthy plants. Collapse and thickening of cell walls were observed in HLB affected roots, but not as severe as in the stems. This study provides insight into the host response of the stems and roots to Ca. L. asiaticus infection.

  7. The transcriptional activator LdtR from 'Candidatus Liberibacter asiaticus' mediates osmotic stress tolerance.

    Directory of Open Access Journals (Sweden)

    Fernando A Pagliai

    2014-04-01

    Full Text Available The causal agent of Huanglongbing disease, 'Candidatus Liberibacter asiaticus', is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from 'Ca. L. asiaticus' involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR, and a predicted L,D-transpeptidase (ldtP. In Sinorhizobium meliloti, mutation of ldtR resulted in morphological changes (shortened rod-type phenotype and reduced tolerance to osmotic stress. A biochemical approach was taken to identify small molecules that modulate LdtR activity. The LdtR ligands identified by thermal shift assays were validated using DNA binding methods. The biological impact of LdtR inactivation by the small molecules was then examined in Sinorhizobium meliloti and Liberibacter crescens, where a shortened-rod phenotype was induced by growth in presence of the ligands. A new method was also developed to examine the effects of small molecules on the viability of 'Ca. Liberibacter asiaticus', using shoots from HLB-infected orange trees. Decreased expression of ldtRLas and ldtPLas was observed in samples taken from HLB-infected shoots after 6 h of incubation with the LdtR ligands. These results provide strong proof of concept for the use of small molecules that target LdtR, as a potential treatment option for Huanglongbing disease.

  8. Identifying Potential Mechanisms Enabling Acidophily in the Ammonia-Oxidizing Archaeon “Candidatus Nitrosotalea devanaterra”

    Science.gov (United States)

    Sayavedra-Soto, Luis A.; Gallois, Nicolas; Schouten, Stefan; Stein, Lisa Y.; Prosser, James I.; Nicol, Graeme W.

    2016-01-01

    Ammonia oxidation is the first and rate-limiting step in nitrification and is dominated by two distinct groups of microorganisms in soil: ammonia-oxidizing archaea (AOA) and ammonia-oxidizing bacteria (AOB). AOA are often more abundant than AOB and dominate activity in acid soils. The mechanism of ammonia oxidation under acidic conditions has been a long-standing paradox. While high rates of ammonia oxidation are frequently measured in acid soils, cultivated ammonia oxidizers grew only at near-neutral pH when grown in standard laboratory culture. Although a number of mechanisms have been demonstrated to enable neutrophilic AOB growth at low pH in the laboratory, these have not been demonstrated in soil, and the recent cultivation of the obligately acidophilic ammonia oxidizer “Candidatus Nitrosotalea devanaterra” provides a more parsimonious explanation for the observed high rates of activity. Analysis of the sequenced genome, transcriptional activity, and lipid content of “Ca. Nitrosotalea devanaterra” reveals that previously proposed mechanisms used by AOB for growth at low pH are not essential for archaeal ammonia oxidation in acidic environments. Instead, the genome indicates that “Ca. Nitrosotalea devanaterra” contains genes encoding both a predicted high-affinity substrate acquisition system and potential pH homeostasis mechanisms absent in neutrophilic AOA. Analysis of mRNA revealed that candidate genes encoding the proposed homeostasis mechanisms were all expressed during acidophilic growth, and lipid profiling by high-performance liquid chromatography–mass spectrometry (HPLC-MS) demonstrated that the membrane lipids of “Ca. Nitrosotalea devanaterra” were not dominated by crenarchaeol, as found in neutrophilic AOA. This study for the first time describes a genome of an obligately acidophilic ammonia oxidizer and identifies potential mechanisms enabling this unique phenotype for future biochemical characterization. PMID:26896134

  9. Identifying Potential Mechanisms Enabling Acidophily in the Ammonia-Oxidizing Archaeon "Candidatus Nitrosotalea devanaterra".

    Science.gov (United States)

    Lehtovirta-Morley, Laura E; Sayavedra-Soto, Luis A; Gallois, Nicolas; Schouten, Stefan; Stein, Lisa Y; Prosser, James I; Nicol, Graeme W

    2016-05-01

    Ammonia oxidation is the first and rate-limiting step in nitrification and is dominated by two distinct groups of microorganisms in soil: ammonia-oxidizing archaea (AOA) and ammonia-oxidizing bacteria (AOB). AOA are often more abundant than AOB and dominate activity in acid soils. The mechanism of ammonia oxidation under acidic conditions has been a long-standing paradox. While high rates of ammonia oxidation are frequently measured in acid soils, cultivated ammonia oxidizers grew only at near-neutral pH when grown in standard laboratory culture. Although a number of mechanisms have been demonstrated to enable neutrophilic AOB growth at low pH in the laboratory, these have not been demonstrated in soil, and the recent cultivation of the obligately acidophilic ammonia oxidizer "Candidatus Nitrosotalea devanaterra" provides a more parsimonious explanation for the observed high rates of activity. Analysis of the sequenced genome, transcriptional activity, and lipid content of "Ca Nitrosotalea devanaterra" reveals that previously proposed mechanisms used by AOB for growth at low pH are not essential for archaeal ammonia oxidation in acidic environments. Instead, the genome indicates that "Ca Nitrosotalea devanaterra" contains genes encoding both a predicted high-affinity substrate acquisition system and potential pH homeostasis mechanisms absent in neutrophilic AOA. Analysis of mRNA revealed that candidate genes encoding the proposed homeostasis mechanisms were all expressed during acidophilic growth, and lipid profiling by high-performance liquid chromatography-mass spectrometry (HPLC-MS) demonstrated that the membrane lipids of "Ca Nitrosotalea devanaterra" were not dominated by crenarchaeol, as found in neutrophilic AOA. This study for the first time describes a genome of an obligately acidophilic ammonia oxidizer and identifies potential mechanisms enabling this unique phenotype for future biochemical characterization. PMID:26896134

  10. In-vineyard population structure of 'Candidatus Phytoplasma solani' using multilocus sequence typing analysis.

    Science.gov (United States)

    Murolo, Sergio; Romanazzi, Gianfranco

    2015-04-01

    'Candidatus Phytoplasma solani' is a phytoplasma of the stolbur group (16SrXII subgroup A) that is associated with 'Bois noir' and causes heavy damage to the quality and quantity of grapevine yields in several European countries, and particularly in the Mediterranean area. Analysis of 'Ca. P. solani' genetic diversity was carried out for strains infecting a cv. 'Chardonnay' vineyard, through multilocus sequence typing analysis for the vmp1, stamp and secY genes. Several types per gene were detected: seven out of 20 types for vmp1, six out of 17 for stamp, and four out of 16 for secY. High correlations were seen among the vmp1, stamp and secY typing with the tuf typing. However, no correlations were seen among the tuf and vmp1 types and the Bois noir severity in the surveyed grapevines. Grouping the 'Ca. P. solani' sequences on the basis of their origins (i.e., study vineyard, Italian regions, Euro-Mediterranean countries), dN/dS ratio analysis revealed overall positive selection for stamp (3.99, P=0.019) and vmp1 (2.28, P=0.001). For secY, the dN/dS ratio was 1.02 (P=0.841), showing neutral selection across this gene. Using analysis of the nucleotide sequencing by a Bayesian approach, we determined the population structure of 'Ca. P. solani', which appears to be structured in 3, 5 and 6 subpopulations, according to the secY, stamp and vmp1 genes, respectively. The high genetic diversity of 'Ca. P. solani' from a single vineyard reflects the population structure across wider geographical scales. This information is useful to trace inoculum source and movement of pathogen strains at the local level and over long distances. PMID:25660034

  11. Sexual transmission of a plant pathogenic bacterium, Candidatus Liberibacter asiaticus, between conspecific insect vectors during mating.

    Directory of Open Access Journals (Sweden)

    Rajinder S Mann

    Full Text Available Candidatus Liberibacter asiaticus is a fastidious, phloem-inhabiting, gram-negative bacterium transmitted by Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae. The bacterium is the presumed causal agent of huanglongbing (HLB, one of the most destructive and economically important diseases of citrus. We investigated whether Las is transmitted between infected and uninfected D. citri adults during courtship. Our results indicate that Las was sexually transmitted from Las-infected male D. citri to uninfected females at a low rate (<4% during mating. Sexual transmission was not observed following mating of infected females and uninfected males or among adult pairs of the same sex. Las was detected in genitalia of both sexes and also in eggs of infected females. A latent period of 7 days or more was required to detect the bacterium in recipient females. Rod shaped as well as spherical structures resembling Las were observed in ovaries of Las-infected females with transmission electron microscopy, but were absent in ovaries from uninfected D. citri females. The size of the rod shaped structures varied from 0.39 to 0.67 µm in length and 0.19 to 0.39 µm in width. The spherical structures measured from 0.61 to 0.80 µm in diameter. This investigation provides convincing evidence that a plant pathogenic bacterium is sexually transmitted from male to female insects during courtship and established evidence that bacteria persist in reproductive organs. Moreover, these findings provide an alternative sexually horizontal mechanism for the spread of Las within populations of D. citri, even in the absence of infected host trees.

  12. The complete genome sequence of 'Candidatus Liberibacter solanacearum', the bacterium associated with potato zebra chip disease.

    Directory of Open Access Journals (Sweden)

    Hong Lin

    Full Text Available Zebra Chip (ZC is an emerging plant disease that causes aboveground decline of potato shoots and generally results in unusable tubers. This disease has led to multi-million dollar losses for growers in the central and western United States over the past decade and impacts the livelihood of potato farmers in Mexico and New Zealand. ZC is associated with 'Candidatus Liberibacter solanacearum', a fastidious alpha-proteobacterium that is transmitted by a phloem-feeding psyllid vector, Bactericera cockerelli Sulc. Research on this disease has been hampered by a lack of robust culture methods and paucity of genome sequence information for 'Ca. L. solanacearum'. Here we present the sequence of the 1.26 Mbp metagenome of 'Ca. L. solanacearum', based on DNA isolated from potato psyllids. The coding inventory of the 'Ca. L. solanacearum' genome was analyzed and compared to related Rhizobiaceae to better understand 'Ca. L. solanacearum' physiology and identify potential targets to develop improved treatment strategies. This analysis revealed a number of unique transporters and pathways, all potentially contributing to ZC pathogenesis. Some of these factors may have been acquired through horizontal gene transfer. Taxonomically, 'Ca. L. solanacearum' is related to 'Ca. L. asiaticus', a suspected causative agent of citrus huanglongbing, yet many genome rearrangements and several gene gains/losses are evident when comparing these two Liberibacter. species. Relative to 'Ca. L. asiaticus', 'Ca. L. solanacearum' probably has reduced capacity for nucleic acid modification, increased amino acid and vitamin biosynthesis functionalities, and gained a high-affinity iron transport system characteristic of several pathogenic microbes.

  13. Genetic diversity of Candidatus Liberibacter asiaticus based on two hypervariable effector genes in Thailand.

    Directory of Open Access Journals (Sweden)

    Thamrongjet Puttamuk

    Full Text Available Huanglongbing (HLB, also known as citrus greening, is one of the most destructive diseases of citrus worldwide. HLB is associated with three species of 'Candidatus Liberibacter' with 'Ca. L. asiaticus' (Las being the most widely distributed around the world, and the only species detected in Thailand. To understand the genetic diversity of Las bacteria in Thailand, we evaluated two closely-related effector genes, lasAI and lasAII, found within the Las prophages from 239 infected citrus and 55 infected psyllid samples collected from different provinces in Thailand. The results indicated that most of the Las-infected samples collected from Thailand contained at least one prophage sequence with 48.29% containing prophage 1 (FP1, 63.26% containing prophage 2 (FP2, and 19.38% containing both prophages. Interestingly, FP2 was found to be the predominant population in Las-infected citrus samples while Las-infected psyllids contained primarily FP1. The multiple banding patterns that resulted from amplification of lasAI imply extensive variation exists within the full and partial repeat sequence while the single band from lasAII indicates a low amount of variation within the repeat sequence. Phylogenetic analysis of Las-infected samples from 22 provinces in Thailand suggested that the bacterial pathogen may have been introduced to Thailand from China and the Philippines. This is the first report evaluating the genetic variation of a large population of Ca. L. asiaticus infected samples in Thailand using the two effector genes from Las prophage regions.

  14. Search for potential vectors of ‘Candidatus Liberibacter solanacearum’: population dynamics in host crops

    Directory of Open Access Journals (Sweden)

    Gabriela Teresani

    2015-03-01

    Full Text Available Candidatus Liberibacter solanacearum’ has recently been reported to be associated with vegetative disorders and economic losses in carrot and celery crops in Spain. The bacterium is a carrot seedborne pathogen and it is transmitted by psyllid vector species. From 2011 to 2014 seasonal and occasional surveys in carrot, celery and potato plots were performed. The sticky plant method was used to monitor the arthropods that visited the plants. The collected arthropods were classified into Aphididae and Cicadellidae, and the superfamily Psylloidea was identified to the species level. The superfamily Psylloidea represented 35.45% of the total arthropods captured on celery in Villena and 99.1% on carrot in Tenerife (Canary Islands. The maximum flight of psyllid species was in summer, both in mainland Spain and the Canary Islands, reaching a peak of 570 specimens in August in Villena and 6,063 in July in Tenerife. The main identified psyllid species were as follows: Bactericera trigonica Hodkinson, B. tremblayi Wagnerand B. nigricornis Förster. B. trigonica represented more than 99% of the psyllids captured in the Canary Islands and 75% and 38% in 2011 and 2012 in Villena, respectively. In addition, Trioza urticae Linnaeus, Bactericera sp.,Ctenarytaina sp., Cacopsylla sp., Trioza sp. and Psylla sp. were captured. ‘Ca. L. solanacearum’ targets were detected by squash real-time PCR in 19.5% of the psyllids belonging to the different Bactericera species. This paper reports at least three new psyllid species that carry the bacterium and can be considered as potential vectors.

  15. "Candidatus Borrelia kalaharica" Detected from a Febrile Traveller Returning to Germany from Vacation in Southern Africa.

    Directory of Open Access Journals (Sweden)

    Volker Fingerle

    2016-03-01

    Full Text Available A 26 year-old female patient presented to the Tropical Medicine outpatient unit of the Ludwig Maximilians-University in Munich with febrile illness after returning from Southern Africa, where she contracted a bite by a large mite-like arthropod, most likely a soft-tick. Spirochetes were detected in Giemsa stained blood smears and treatment was started with doxycycline for suspected tick-borne relapsing fever. The patient eventually recovered after developing a slight Jarisch-Herxheimer reaction during therapy. PCR reactions performed from EDTA-blood revealed a 16S rRNA sequence with 99.4% similarity to both, Borrelia duttonii, and B. parkeri. Further sequences obtained from the flagellin gene (flaB demonstrated genetic distances of 0.066 and 0.097 to B. parkeri and B. duttonii, respectively. Fragments of the uvrA gene revealed genetic distance of 0.086 to B. hermsii in genetic analysis and only distant relations with classic Old World relapsing fever species. This revealed the presence of a novel species of tick-borne relapsing fever spirochetes that we propose to name "Candidatus Borrelia kalaharica", as it was contracted from an arthropod bite in the Kalahari Desert belonging to both, Botswana and Namibia, a region where to our knowledge no relapsing fever has been described so far. Interestingly, the novel species shows more homology to New World relapsing fever Borrelia such as B. parkeri or B. hermsii than to known Old World species such as B. duttonii or B. crocidurae.

  16. Metatranscriptomic insights on gene expression and regulatory controls in Candidatus Accumulibacter phosphatis

    Science.gov (United States)

    Oyserman, Ben O; Noguera, Daniel R; del Rio, Tijana Glavina; Tringe, Susannah G; McMahon, Katherine D

    2016-01-01

    Previous studies on enhanced biological phosphorus removal (EBPR) have focused on reconstructing genomic blueprints for the model polyphosphate-accumulating organism Candidatus Accumulibacter phosphatis. Here, a time series metatranscriptome generated from enrichment cultures of Accumulibacter was used to gain insight into anerobic/aerobic metabolism and regulatory mechanisms within an EBPR cycle. Co-expressed gene clusters were identified displaying ecologically relevant trends consistent with batch cycle phases. Transcripts displaying increased abundance during anerobic acetate contact were functionally enriched in energy production and conversion, including upregulation of both cytoplasmic and membrane-bound hydrogenases demonstrating the importance of transcriptional regulation to manage energy and electron flux during anerobic acetate contact. We hypothesized and demonstrated hydrogen production after anerobic acetate contact, a previously unknown strategy for Accumulibacter to maintain redox balance. Genes involved in anerobic glycine utilization were identified and phosphorus release after anerobic glycine contact demonstrated, suggesting that Accumulibacter routes diverse carbon sources to acetyl-CoA formation via previously unrecognized pathways. A comparative genomics analysis of sequences upstream of co-expressed genes identified two statistically significant putative regulatory motifs. One palindromic motif was identified upstream of genes involved in PHA synthesis and acetate activation and is hypothesized to be a phaR binding site, hence representing a hypothetical PHA modulon. A second motif was identified ~35 base pairs (bp) upstream of a large and diverse array of genes and hence may represent a sigma factor binding site. This analysis provides a basis and framework for further investigations into Accumulibacter metabolism and the reconstruction of regulatory networks in uncultured organisms. PMID:26555245

  17. The intracellular citrus huanglongbing bacterium, 'Candidatus Liberibacter asiaticus' encodes two novel autotransporters.

    Directory of Open Access Journals (Sweden)

    Guixia Hao

    Full Text Available Proteins secreted by the type V secretion system (T5SS, known as autotransporters, are large extracellular virulence proteins localized to the bacterial poles. In this study, we characterized two novel autotransporter proteins of 'Candidatus Liberibacter asiaticus' (Las, and redesignated them as LasAI and LasAII in lieu of the previous names HyvI and HyvII. As a phloem-limited, intracellular bacterial pathogen, Las has a significantly reduced genome and causes huanglongbing (HLB, a devastating disease of citrus worldwide. Bioinformatic analyses revealed that LasAI and LasAII share the structural features of an autotransporter family containing large repeats of a passenger domain and a unique C-terminal translocator domain. When fused to the GFP gene and expressed in E. coli, the LasAI C-terminus and the full length LasAII were localized to the bacterial poles, similar to other members of autotransporter family. Despite the absence of a typical signal peptide, LasAI was found to localize at the cell surface by immuno-dot blot using a monoclonal antibody against the partial LasAI protein. Its surface localization was also confirmed by the removal of the LasAI antigen using a proteinase K treatment of the intact bacterial cells. When co-inoculated with a P19 gene silencing suppressor and transiently expressed in tobacco leaves, the GFP-LasAI translocator targeted to the mitochondria. This is the first report that Las encodes novel autotransporters that target to mitochondria when expressed in the plants. These findings may lead to a better understanding of the pathogenesis of this intracellular bacterium.

  18. Prophage-mediated dynamics of 'Candidatus Liberibacter asiaticus' populations, the destructive bacterial pathogens of citrus huanglongbing.

    Directory of Open Access Journals (Sweden)

    Lijuan Zhou

    Full Text Available Prophages are highly dynamic components in the bacterial genome and play an important role in intraspecies variations. There are at least two prophages in the chromosomes of Candidatus Liberibacter asiaticus' (Las Floridian isolates. Las is both unculturable and the most prevalent species of Liberibacter pathogens that cause huanglongbing (HLB, a worldwide destructive disease of citrus. In this study, seven new prophage variants resulting from two hyper-variable regions were identified by screening clone libraries of infected citrus, periwinkle and psyllids. Among them, Types A and B share highly conserved sequences and localize within the two prophages, FP1 and FP2, respectively. Although Types B and C were abundant in all three libraries, Type A was much more abundant in the libraries from the Las-infected psyllids than from the Las-infected plants, and Type D was only identified in libraries from the infected host plants but not from the infected psyllids. Sequence analysis of these variants revealed that the variations may result from recombination and rearrangement events. Conventional PCR results using type-specific molecular markers indicated that A, B, C and D are the four most abundant types in Las-infected citrus and periwinkle. However, only three types, A, B and C are abundant in Las-infected psyllids. Typing results for Las-infected citrus field samples indicated that mixed populations of Las bacteria present in Floridian isolates, but only the Type D population was correlated with the blotchy mottle symptom. Extended cloning and sequencing of the Type D region revealed a third prophage/phage in the Las genome, which may derive from the recombination of FP1 and FP2. Dramatic variations in these prophage regions were also found among the global Las isolates. These results are the first to demonstrate the prophage/phage-mediated dynamics of Las populations in plant and insect hosts, and their correlation with insect transmission and

  19. Molecular characterization of a mosaic locus in the genome of 'Candidatus Liberibacter asiaticus'

    Directory of Open Access Journals (Sweden)

    Wang Xuefeng

    2012-01-01

    Full Text Available Abstract Background Huanglongbing (HLB is a highly destructive disease of citrus production worldwide. 'Candidatus Liberibacter asiaticus', an unculturable alpha proteobacterium, is a putative pathogen of HLB. Information about the biology and strain diversity of 'Ca. L. asiaticus' is currently limited, inhibiting the scope of HLB research and control. Results A genomic region (CLIBASIA_05640 to CLIBASIA_05650 of 'Ca. L. asiaticus' showing hyper-sequence variation or locus mosaicism was identified and investigated using 262 bacterial strains (188 from China and 74 from Florida. Based on the characteristic electrophoretic profiles of PCR amplicons generated by a specific primer set, eight electrophoretic types (E-types were identified, six E-types (A, B, C, D, E, and F in China and four E-types (A, C, G, and H in Florida. The 'Ca. L. asiaticus' strains from China consisted predominately of E-type A (71.3% and E-type B (19.7%. In contrast, the 'Ca. L. asiaticus' strains from Florida was predominated by E-type G (82.4%. Diversity of 'Ca. L. asiaticus' in China was also evidenced. Strains from the high altitude Yunnan Province consisted of five E-types with E-type B being the majority (62.8%, whereas strains from the low altitude coastal Guangdong Province consisted of only two E-types with E-type A as the majority (97.0%. Sequence analyses revealed that variation of DNA amplicons was due to insertion/deletion events at CLIBASIA_05650 and the downstream intergenic region. Conclusions This study demonstrated the genomic mosaicism of 'Ca. L. asiaticus' resulted from active DNA insertion/deletion activities. Analyses of strain variation depicted the significant inter- and intra-continent diversity of 'Ca. L. asiaticus'.

  20. 'Candidatus Rickettsia mendelii', a novel basal group rickettsia detected in Ixodes ricinus ticks in the Czech Republic.

    Science.gov (United States)

    Hajduskova, Eva; Literak, Ivan; Papousek, Ivo; Costa, Francisco B; Novakova, Marketa; Labruna, Marcelo B; Zdrazilova-Dubska, Lenka

    2016-04-01

    A novel rickettsial sequence in the citrate synthase gltA gene indicating a novel Rickettsia species has been detected in 7 out of 4524 Ixodes ricinus ticks examined within several surveys performed in the Czech Republic from 2005 to 2009. This new Candidatus Rickettsia sp. sequence has been found in 2 nymphs feeding on wild birds (Luscinia megarhynchos and Erithacus rubecula), in a male tick from vegetation, and 4 ticks feeding on a dog (3 males, 1 female tick). Portions of the ompA, ompB, sca4, and htrA genes were not amplifiable in these samples. A maximum likelihood tree of rickettsiae based on comparisons of partial amino acid sequences of citrate synthase and nucleotide sequences of 16S rDNA genes and phylogenetic analysis revealed a basal position of the novel species in the proximity of R. bellii and R. canadensis. The novel species has been named 'Candidatus Rickettsia mendelii' after the founder of genetics, Gregor Mendel. PMID:26873811

  1. Genetic diversity of European phytoplasmas of the 16SrV taxonomic group and proposal of 'Candidatus Phytoplasma rubi'.

    Science.gov (United States)

    Malembic-Maher, Sylvie; Salar, Pascal; Filippin, Luisa; Carle, Patricia; Angelini, Elisa; Foissac, Xavier

    2011-09-01

    In addition to the grapevine flavescence dorée phytoplasmas, other members of taxonomic group 16SrV phytoplasmas infect grapevines, alders and species of the genera Clematis and Rubus in Europe. In order to investigate which phytoplasmas constitute discrete, species-level taxa, several strains were analysed by comparing their 16S rRNA gene sequences and a set of five housekeeping genes. Whereas 16S rRNA gene sequence similarity values were >97.5 %, the proposed threshold to distinguish two 'Candidatus Phytoplasma' taxa, phylogenetic analysis of the combined sequences of the tuf, rplV-rpsC, rplF-rplR, map and uvrB-degV genetic loci showed that two discrete phylogenetic clusters could be clearly distinguished. The first cluster grouped flavescence dorée (FD) phytoplasmas, alder yellows (AldY) phytoplasmas, Clematis (CL) phytoplasmas and the Palatinate grapevine yellows (PGY) phytoplasmas. The second cluster comprised Rubus stunt (RS) phytoplasmas. In addition to the specificity of the insect vector, the Rubus stunt phytoplasma contained specific sequences in the 16S rRNA gene. Hence, the Rubus stunt phytoplasma 16S rRNA gene was sufficiently differentiated to represent a novel putative taxon: 'Candidatus Phytoplasma rubi'. PMID:20889771

  2. A unique disease phenotype -‘yellow shoot without blotchy mottle’ was associated with a low titer of Candidatus Liberibacter asiaticus in Florida

    Science.gov (United States)

    Citrus huanglongbing (HLB) is one of the most devastating diseases of citrus worldwide. The disease is associated with three different species of Candidatus Liberibacter: Ca. L. asiaticus, Ca. L. americanus and Ca. L. africanus. Ca. L. asiaticus (Las), first detected in Florida in 2005, has been d...

  3. The potential role of 'Candidatus Microthrix parvicella' in phosphorus removal during sludge bulking in two full-scale enhanced biological phosphorus removal plants.

    Science.gov (United States)

    Wang, Juan; Qi, Rong; Liu, Miaomiao; Li, Qian; Bao, Haipeng; Li, Yaming; Wang, Shen; Tandoi, Valter; Yang, Min

    2014-01-01

    We investigated the bacterial community compositions and phosphorus removal performance under sludge bulking and non-bulking conditions in two biological wastewater treatment systems (conventional A²/O (anaerobic/anoxic/aerobic) and inverted A²/O (anoxic/anaerobic/aerobic) processes) receiving the same raw wastewater. Sludge bulking resulted in significant shift in bacterial compositions from Proteobacteria dominance to Actinobacteria dominance, characterized by the significant presence of filamentous 'Candidatus Microthrix parvicella'. Quantitative real-time polymerase chain reaction (PCR) analysis revealed that the relative abundance of 'Candidatus Accumulibacter phosphatis', a key polyphosphate-accumulating organism responsible for phosphorus removal, with respect to 16s rRNA genes of total bacteria was 0.8 and 0.7%, respectively, for the conventional and inverted A²/O systems when sludge bulking occurred, which increased to 8.2 and 12.3% during the non-bulking period. However, the total phosphorus removal performance during the bulking period (2-week average: 97 ± 1 and 96 ± 1%, respectively) was not adversely affected comparable to that during the non-bulking period (2-week average: 96 ± 1 and 96 ± 1%, respectively). Neisser staining revealed the presence of large polyphosphate granules in 'Candidatus Microthrix parvicella', suggesting that this microbial group might have been responsible for phosphorus removal during the sludge bulking period when 'Candidatus Accumulibacter phosphatis' was excluded from the systems. PMID:25051486

  4. Molecular detection of aster yellows phytoplasma and 'Candidatus Liberibacter solanacearum' in carrots affected by the psyllid Trioza apicalis (Hemiptera: triozidae) in Finland

    Science.gov (United States)

    Carrot psyllid (Trioza apicalis Förster) causes considerable damage to carrot (Daucus carota L.) in many parts of Europe. It was recently established that the new bacterium “Candidatus Liberibacter solanacearum” is associated with carrot psyllid and plants affected by this insect pest. No other path...

  5. Incidence of huanglongbing-associated ‘Candidatus Liberibacter Asiaticus’ in Diaphorina citri (Hemiptera: Psyllidae) collected from plants for sale in Florida

    Science.gov (United States)

    The Asian citrus psyllid, Diaphorina citri Kuwayama, was reported for the first time in Florida in June 1998, and huanglongbing (HLB, citrus greening), vectored by D. citri, was detected in Florida for the first time in Aug 2005. In Florida, the only known HLB pathogen is ‘Candidatus Liberibacter as...

  6. A rapid method for preparation of nucleic acid extracts from potato psyllids for detection of 'Candidatus Liberibacter solancearum' and molecular analysis

    Science.gov (United States)

    A rapid method has been developed and validated for PCR analysis of potato psyllids for Candidatus Liberibacter solanacearum (Lso), the causal agent of zebra chip disease of potatoes. The method is also suitable for PCR amplification and high resolution melting analysis of the cytochrome oxidase I ...

  7. A single prophage carrying a CRISPR/cas system in ‘Candidatus Liberibacter asiaticus’ strain A4 from Guangdong, China

    Science.gov (United States)

    Candidatus Liberibacter asiaticus” (CLas) is an unculturable a-proteobacterium associated with citrus huanglongbing (HLB, yellow shoot disease), a highly destructive disease that affects citrus production worldwide. HLB was observed in Guangdong Province of China over a hundred years ago and remain...

  8. Draft Genome Sequence of “Candidatus Methanomethylophilus” sp. 1R26, Enriched from Bovine Rumen, a Methanogenic Archaeon Belonging to the Methanomassiliicoccales Order

    Science.gov (United States)

    Højberg, Ole; Urich, Tim

    2016-01-01

    Here, we present the draft genome of “Candidatus Methanomethylophilus” sp. 1R26, a member of the newly described Methanomassiliicoccales order of Euryarcheaota. The enrichment culture was established from bovine rumen contents and produced methane from trimethylamine and methanol. The draft genome contains genes for methanogenesis from methylated compounds. PMID:26893425

  9. Draft Genome Sequence of “Candidatus Phytoplasma oryzae” Strain Mbita1, the Causative Agent of Napier Grass Stunt Disease in Kenya

    Science.gov (United States)

    Fischer, Anne; Santana-Cruz, Ivette; Wambua, Lillian; Olds, Cassandra; Midega, Charles; Dickinson, Matthew; Kawicha, Praphat; Khan, Zeyaur; Masiga, Daniel; Schneider, Bernd

    2016-01-01

    Phytoplasmas are bacterial plant pathogens with devastating impact on agricultural production worldwide. In eastern Africa, Napier grass stunt disease causes serious economic losses in the smallholder dairy industry. This draft genome sequence of “Candidatus Phytoplasma oryzae” strain Mbita1 provides insight into its genomic organization and the molecular basis of pathogenicity. PMID:27103722

  10. Comparison of the Genome Sequences of “Candidatus Portiera aleyrodidarum” Primary Endosymbionts of the Whitefly Bemisia tabaci B and Q Biotypes

    OpenAIRE

    Jiang, Zi-Feng; Xia, Fangfang; Johnson, Kipp W.; Brown, Christopher D.; Bartom, Elizabeth; Tuteja, Jigyasa H.; Stevens, Rick; Grossman, Robert L; Brumin, Marina; White, Kevin P.; Ghanim,Murad

    2013-01-01

    Candidatus Portiera aleyrodidarum” is the primary endosymbiont of whiteflies. We report two complete genome sequences of this bacterium from the worldwide invasive B and Q biotypes of the whitefly Bemisia tabaci. Differences in the two genome sequences may add insights into the complex differences in the biology of both biotypes.

  11. Complete Genome Sequence of “Candidatus Portiera aleyrodidarum” BT-QVLC, an Obligate Symbiont That Supplies Amino Acids and Carotenoids to Bemisia tabaci

    OpenAIRE

    Santos-Garcia, Diego; Farnier, Pierre-Antoine; Beitia, Francisco; Zchori-Fein, Einat; Vavre, Fabrice; Mouton, Laurence; Moya, Andrés; Latorre, Amparo; Silva, Francisco J.

    2012-01-01

    The genome of “Candidatus Portiera aleyrodidarum,” the primary endosymbiont of the whitefly Bemisia tabaci (Mediterranean species), is reported. It presents a reduced genome (357 kb) encoding the capability to synthetize, or participate in the synthesis of, several amino acids and carotenoids, being the first insect endosymbiont capable of supplying carotenoids.

  12. Draft Genome Sequence of “Candidatus Methanomethylophilus” sp. 1R26, Enriched from Bovine Rumen, a Methanogenic Archaeon Belonging to the Methanomassiliicoccales Order

    OpenAIRE

    Noel, Samantha Joan; Højberg, Ole; Urich, Tim; Poulsen, Morten

    2016-01-01

    Here, we present the draft genome of “Candidatus Methanomethylophilus” sp. 1R26, a member of the newly described Methanomassiliicoccales order of Euryarcheaota. The enrichment culture was established from bovine rumen contents and produced methane from trimethylamine and methanol. The draft genome contains genes for methanogenesis from methylated compounds.

  13. Draft Genome Sequence of "Candidatus Methanomethylophilus" sp. 1R26, Enriched from Bovine Rumen, a Methanogenic Archaeon Belonging to the Methanomassiliicoccales Order.

    Science.gov (United States)

    Noel, Samantha Joan; Højberg, Ole; Urich, Tim; Poulsen, Morten

    2016-01-01

    Here, we present the draft genome of "Candidatus Methanomethylophilus" sp. 1R26, a member of the newly described Methanomassiliicoccales order of Euryarcheaota. The enrichment culture was established from bovine rumen contents and produced methane from trimethylamine and methanol. The draft genome contains genes for methanogenesis from methylated compounds. PMID:26893425

  14. Shotgun metagenomic data reveals signifcant abundance but low diversity of Candidatus Scalindua marine anammox bacteria in the Arabian Sea oxygen minimum zone

    Directory of Open Access Journals (Sweden)

    laura eVillanueva

    2014-02-01

    Full Text Available Anaerobic ammonium oxidizing (anammox bacteria are responsible for a significant portion of the loss of fixed nitrogen from the oceans, making them important players in the global nitrogen cycle. To date, marine anammox bacteria found in both water columns and sediments worldwide belong almost exclusively to Candidatus Scalindua species. Recently the genome assembly of a marine anammox enrichment culture dominated by Candidatus Scalindua profunda became available and can now be used as a template to study metagenome data obtained from various oxygen minimum zones. Here, we sequenced genomic DNA from suspended particulate matter recovered at the upper (170 m deep and center (600 m area of the oxygen minimum zone in the Arabian Sea by SOLiD and Ion Torrent technology. The genome of Candidatus Scalindua profunda served as a template to collect reads. Based on the mapped reads marine anammox Abundance was estimated to be at least 0.4% in the upper and 1.7% in the center area. Single nucleotide variation (SNV analysis was performed to assess diversity of the Candidatus Scalindua populations. Most highly covered were the two diagnostic anammox genes hydrazine synthase (scal_01318c, hzsA and hydrazine dehydrogenase (scal_03295, hdh, while other genes involved in anammox metabolism (narGH, nirS, amtB, focA and ACS had a lower coverage but could still be assembled and analyzed. The results show that Candidatus Scalindua is abundantly present in the Arabian Sea OMZ, but that the diversity within the ecosystem is relatively low.

  15. Distribution of 'Candidatus Liberibacter asiaticus' Above and Below Ground in Texas Citrus.

    Science.gov (United States)

    Louzada, Eliezer S; Vazquez, Omar Ed; Braswell, W Evan; Yanev, George; Devanaboina, Madhavi; Kunta, Madhurababu

    2016-07-01

    Detection of 'Candidatus Liberibacter asiaticus' represents one of the most difficult, yet critical, steps of controlling Huanglongbing disease. Efficient detection relies on understanding the underlying distribution of bacteria within trees. To that end, we studied the distribution of 'Ca. L. asiaticus' in leaves of 'Rio Red' grapefruit trees and in roots of 'Valencia' sweet orange trees grafted onto sour orange rootstock. We performed two sets of leaf collection on grapefruit trees; the first a selective sampling targeting symptomatic leaves and their neighbors and the second a systematic collection disregarding symptomology. From uprooted orange trees, we exhaustively sampled fibrous roots. In this study, the presence of 'Ca. L. asiaticus' was detected in leaves using real-time polymerase chain reaction (PCR) targeting the 16S ribosomal gene and in roots using the rpIJ/rpIL ribosomal protein genes and was confirmed with conventional PCR and sequencing of the rpIJ/rpIL gene in both tissues. Among randomly collected leaves, 'Ca. L. asiaticus' was distributed in a patchy fashion. Detection of 'Ca. L. asiaticus' varied with leaf symptomology with symptomatic leaves showing the highest frequency (74%) followed by their neighboring asymptomatic leaves (30%), while randomly distributed asymptomatic leaves had the lowest frequency (20%). Among symptomatic leaves, we found statistically significant differences in mean number of bacterial cells with respect to both increasing distance of the leaf from the trunk and cardinal direction. The titer of 'Ca. L. asiaticus' cells was significantly greater on the north side of trees than on the south and west sides. Moreover, these directions showed different spatial distributions of 'Ca. L. asiaticus' with higher titers near the trunk on the south and west sides as opposed to further from the trunk on the north side. Similarly, we found spatial variation in 'Ca. L. asiaticus' distribution among root samples. 'Ca. L. asiaticus

  16. The frontier between cell and organelle: genome analysis of Candidatus Carsonella ruddii

    Directory of Open Access Journals (Sweden)

    Peretó Juli

    2007-10-01

    Full Text Available Abstract Background Bacterial symbioses are widespread among insects. The early establishment of such symbiotic associations has probably been one of the key factors for the evolutionary success of insects, since it may have allowed access to novel ecological niches and to new imbalanced food resources, such as plant sap or blood. Several genomes of bacterial endosymbionts of different insect species have been recently sequenced, and their biology has been extensively studied. Recently, the complete genome sequence of Candidatus Carsonella ruddii, considered the primary endosymbiont of the psyllid Pachpsylla venusta, has been published. This genome consists of a circular chromosome of 159,662 bp and has been proposed as the smallest bacterial endosymbiont genome known to date. Results The detailed analysis of the gene content of C. ruddii shows that the extensive degradation of the genome is not compatible with its consideration as a mutualistic endosymbiont and, even more, as a living organism. The ability to perform most essential functions for a cell to be considered alive is heavily impaired by the lack of genes involved in DNA replication, transcription and translation. Furthermore, the shortening of genes causes, in some cases, the loss of essential domains and functional residues needed to fulfill such vital functions. In addition, at least half of the pathways towards the biosynthesis of essential amino acids, its proposed symbiotic function, are completely or partially lost. Conclusion We propose that this strain of C. ruddii can be viewed as a further step towards the degeneration of the former primary endosymbiont and its transformation in a subcellular new entity between living cells and organelles. Although the transition of genes from C. ruddii to the host nucleus has been proposed, the amount of genes that should have been transferred to the germinal line of the insect would be so big that it would be more plausible to consider

  17. The linear chromosome of the plant-pathogenic mycoplasma 'Candidatus Phytoplasma mali'

    Directory of Open Access Journals (Sweden)

    Migdoll Alexander M

    2008-06-01

    Full Text Available Abstract Background Phytoplasmas are insect-transmitted, uncultivable bacterial plant pathogens that cause diseases in hundreds of economically important plants. They represent a monophyletic group within the class Mollicutes (trivial name mycoplasmas and are characterized by a small genome with a low GC content, and the lack of a firm cell wall. All mycoplasmas, including strains of 'Candidatus (Ca. Phytoplasma asteris' and 'Ca. P. australiense', examined so far have circular chromosomes, as is the case for almost all walled bacteria. Results Our work has shown that 'Ca. Phytoplasma mali', the causative agent of apple proliferation disease, has a linear chromosome. Linear chromosomes were also identified in the closely related provisional species 'Ca. P. pyri' and 'Ca. P. prunorum'. The chromosome of 'Ca. P. mali' strain AT is 601,943 bp in size and has a GC content of 21.4%. The chromosome is further characterized by large terminal inverted repeats and covalently closed hairpin ends. Analysis of the protein-coding genes revealed that glycolysis, the major energy-yielding pathway supposed for 'Ca. P. asteris', is incomplete in 'Ca. P. mali'. Due to the apparent lack of other metabolic pathways present in mycoplasmas, it is proposed that maltose and malate are utilized as carbon and energy sources. However, complete ATP-yielding pathways were not identified. 'Ca. P. mali' also differs from 'Ca. P. asteris' by a smaller genome, a lower GC content, a lower number of paralogous genes, fewer insertions of potential mobile DNA elements, and a strongly reduced number of ABC transporters for amino acids. In contrast, 'Ca. P. mali' has an extended set of genes for homologous recombination, excision repair and SOS response than 'Ca. P. asteris'. Conclusion The small linear chromosome with large terminal inverted repeats and covalently closed hairpin ends, the extremely low GC content and the limited metabolic capabilities reflect unique features of 'Ca

  18. Multilocus microsatellite analysis of 'Candidatus Liberibacter asiaticus' associated with citrus Huanglongbing worldwide

    Directory of Open Access Journals (Sweden)

    Islam Md-Sajedul

    2012-03-01

    Full Text Available Abstract Background Huanglongbing (HLB is one of the most destructive citrus diseases in the world. The disease is associated with the presence of a fastidious, phloem-limited α- proteobacterium, 'Candidatus Liberibacter asiaticus', 'Ca. Liberibacter africanus' or 'Ca. Liberibacter americanus'. HLB-associated Liberibacters have spread to North America and South America in recent years. While the causal agents of HLB have been putatively identified, information regarding the worldwide population structure and epidemiological relationships for 'Ca. L. asiaticus' is limited. The availability of the 'Ca. L. asiaticus' genome sequence has facilitated development of molecular markers from this bacterium. The objectives of this study were to develop microsatellite markers and conduct genetic analyses of 'Ca. L. asiaticus' from a worldwide collection. Two hundred eighty seven isolates from USA (Florida, Brazil, China, India, Cambodia, Vietnam, Taiwan, Thailand, and Japan were analyzed. Results A panel of seven polymorphic microsatellite markers was developed for 'Ca. L. asiaticus'. Microsatellite analyses across the samples showed that the genetic diversity of 'Ca. L. asiaticus' is higher in Asia than Americas. UPGMA and STRUCTURE analyses identified three major genetic groups worldwide. Isolates from India were genetically distinct. East-southeast Asian and Brazilian isolates were generally included in the same group; a few members of this group were found in Florida, but the majority of the isolates from Florida were clustered separately. eBURST analysis predicted three founder haplotypes, which may have given rise to three groups worldwide. Conclusions Our results identified three major genetic groups of 'Ca. L. asiaticus' worldwide. Isolates from Brazil showed similar genetic makeup with east-southeast Asian dominant group, suggesting the possibility of a common origin. However, most of the isolates recovered from Florida were clustered in a

  19. Dominant and novel clades of Candidatus Accumulibacter phosphatis in 18 globally distributed full-scale wastewater treatment plants

    Science.gov (United States)

    Mao, Yanping; Graham, David W.; Tamaki, Hideyuki; Zhang, Tong

    2015-07-01

    Here we employed quantitative real-time PCR (qPCR) assays for polyphosphate kinase 1 (ppk1) and 16S rRNA genes to assess relative abundances of dominant clades of Candidatus Accumulibacter phosphatis (referred to Accumulibacter) in 18 globally distributed full-scale wastewater treatment plants (WWTPs) from six countries. Accumulibacter were not only detected in the 6 WWTPs performing biological phosphorus removal, but also inhabited in the other 11 WWTPs employing conventional activated sludge (AS) with abundances ranging from 0.02% to 7.0%. Among the AS samples, clades IIC and IID were found to be dominant among the five Accumulibacter clades. The relative abundance of each clade in the Accumulibacter lineage significantly correlated (p biological phosphorus removal (EBPR) WWTPs. The results deepened our understanding of the Accumulibacter diversity in environmental samples.

  20. Dominant and novel clades of Candidatus Accumulibacter phosphatis in 18 globally distributed full-scale wastewater treatment plants

    Science.gov (United States)

    Mao, Yanping; Graham, David W.; Tamaki, Hideyuki; Zhang, Tong

    2015-07-01

    Here we employed quantitative real-time PCR (qPCR) assays for polyphosphate kinase 1 (ppk1) and 16S rRNA genes to assess relative abundances of dominant clades of Candidatus Accumulibacter phosphatis (referred to Accumulibacter) in 18 globally distributed full-scale wastewater treatment plants (WWTPs) from six countries. Accumulibacter were not only detected in the 6 WWTPs performing biological phosphorus removal, but also inhabited in the other 11 WWTPs employing conventional activated sludge (AS) with abundances ranging from 0.02% to 7.0%. Among the AS samples, clades IIC and IID were found to be dominant among the five Accumulibacter clades. The relative abundance of each clade in the Accumulibacter lineage significantly correlated (p phosphorus removal (EBPR) WWTPs. The results deepened our understanding of the Accumulibacter diversity in environmental samples.

  1. Genetic Diversity of the Indian Populations of 'Candidatus Liberibacter asiaticus' Based on the Tandem Repeat Variability in a Genomic Locus.

    Science.gov (United States)

    Ghosh, Dilip Kumar; Bhose, Sumit; Motghare, Manali; Warghane, Ashish; Mukherjee, Krishanu; Ghosh, Dipak Kumar; Sharma, Ashwani Kumar; Ladaniya, Milind Shivratan; Gowda, Siddarame

    2015-08-01

    Citrus huanglongbing (HLB, citrus greening disease) is an extremely destructive disease affecting citrus and causes severe economic loss to the crop yield worldwide. The disease is caused by a phloem-limited, noncultured, gram-negative bacteria Candidatus Liberibacter spp., the widely present and most destructive species being 'Candidatus Liberibacter asiaticus'. Although the disease has been reported from almost all citrus growing regions of India, knowledge on the molecular variability of the pathogen 'Ca. L. asiaticus' populations from different geographical regions and cultivars is limited. In the present study, variability of the Indian 'Ca. L. asiaticus' based on the tandem repeats at the genomic locus CLIBASIA_01645 was characterized and categorized into four classes based on the tandem repeat number (TRN); Class I (TRN≤5), Class II (TRN>5≤10), Class III (TRN>10≤15), and Class IV (TRN>15). The study revealed that the Indian population of 'Ca. L. asiaticus' is more diverse than reported for Florida and Guangdong populations, which showed less diversity. While Florida and Guangdong populations were dominated by a TRN5 and TRN7 genotype, respectively, the Indian 'Ca. L. asiaticus' populations with TRN copy numbers 9, 10, 11, 12, and 13 were widely distributed throughout the country. Additionally, TRN2 and TRN17 genotypes were also observed among the Indian 'Ca. L. asiaticus' populations. The predominant 'Ca. L. asiaticus' genotypes from the northeastern region of India were TRN6 and TRN7 (53.12%) and surprisingly similar to neighboring South China populations. Preliminary results showed absence of preference of citrus cultivars to any specific 'Ca. L. asiaticus' genotype. PMID:25760522

  2. An abundant 'Candidatus Phytoplasma solani' tuf b strain is associated with grapevine, stinging nettle and Hyalesthes obsoletus.

    Science.gov (United States)

    Aryan, A; Brader, G; Mörtel, J; Pastar, M; Riedle-Bauer, M

    2014-10-01

    Bois noir (BN) associated with 'Candidatus Phytoplasma solani' (Stolbur) is regularly found in Austrian vine growing regions. Investigations between 2003 and 2008 indicated sporadic presence of the confirmed disease vector Hyalesthes obsoletus and frequent infections of bindweed and grapevine. Infections of nettles were rare. In contrast present investigations revealed a mass occurrence of H. obsoletus almost exclusively on stinging nettle. The high population densities of H. obsoletus on Urtica dioica were accompanied by frequent occurrence of 'Ca. P. solani' in nettles and planthoppers. Sequence analysis of the molecular markers secY, stamp, tuf and vmp1 of stolbur revealed a single genotype named CPsM4_At1 in stinging nettles and more than 64 and 90 % abundance in grapevine and H. obsoletus, respectively. Interestingly, this genotype showed tuf b type restriction pattern previously attributed to bindweed associated 'Ca. P. solani' strains, but a different sequence assigned as tuf b2 compared to reference tuf b strains. All other marker genes of CPsM4_At1 clustered with tuf a and nettle derived genotypes verifying distinct nettle phytoplasma genotypes. Transmission experiments with H. obsoletus and Anaceratagallia ribauti resulted in successful transmission of five different strains including the major genotype to Catharanthus roseus and in transmission of the major genotype to U. dioica. Altogether, five nettle and nine bindweed associated genotypes were described. Bindweed types were verified in 34 % of grapevine samples, in few positive Reptalus panzeri, rarely in bindweeds and occasionally in Catharanthus roseus infected by H. obsoletus or A. ribauti. 'Candidatus Phytoplasma convolvuli' (bindweed yellows) was ascertained in nettle and bindweed samples. PMID:25309042

  3. Deciphering the bacterial microbiome of citrus plants in response to 'Candidatus Liberibacter asiaticus'-infection and antibiotic treatments.

    Directory of Open Access Journals (Sweden)

    Muqing Zhang

    Full Text Available The bacterial microbiomes of citrus plants were characterized in response to 'Candidatus Liberibacter asiaticus' (Las-infection and treatments with ampicillin (Amp and gentamicin (Gm by Phylochip-based metagenomics. The results revealed that 7,407 of over 50,000 known Operational Taxonomic Units (OTUs in 53 phyla were detected in citrus leaf midribs using the PhyloChip™ G3 array, of which five phyla were dominant, Proteobacteria (38.7%, Firmicutes (29.0%, Actinobacteria (16.1%, Bacteroidetes (6.2% and Cyanobacteria (2.3%. The OTU62806, representing 'Candidatus Liberibacter', was present with a high titer in the plants graft-inoculated with Las-infected scions treated with Gm at 100 mg/L and in the water-treated control (CK1. However, the Las bacterium was not detected in the plants graft-inoculated with Las-infected scions treated with Amp at 1.0 g/L or in plants graft-inoculated with Las-free scions (CK2. The PhyloChip array demonstrated that more OTUs, at a higher abundance, were detected in the Gm-treated plants than in the other treatment and the controls. Pairwise comparisons indicated that 23 OTUs from the Achromobacter spp. and 12 OTUs from the Methylobacterium spp. were more abundant in CK2 and CK1, respectively. Ten abundant OTUs from the Stenotrophomonas spp. were detected only in the Amp-treatment. These results provide new insights into microbial communities that may be associated with the progression of citrus huanglongbing (HLB and the potential effects of antibiotics on the disease and microbial ecology.

  4. "Candidatus Propionivibrio aalborgensis": A Novel Glycogen Accumulating Organism Abundant in Full-Scale Enhanced Biological Phosphorus Removal Plants.

    Science.gov (United States)

    Albertsen, Mads; McIlroy, Simon J; Stokholm-Bjerregaard, Mikkel; Karst, Søren M; Nielsen, Per H

    2016-01-01

    Enhanced biological phosphorus removal (EBPR) is widely used to remove phosphorus from wastewater. The process relies on polyphosphate accumulating organisms (PAOs) that are able to take up phosphorus in excess of what is needed for growth, whereby phosphorus can be removed from the wastewater by wasting the biomass. However, glycogen accumulating organisms (GAOs) may reduce the EBPR efficiency as they compete for substrates with PAOs, but do not store excessive amounts of polyphosphate. PAOs and GAOs are thought to be phylogenetically unrelated, with the model PAO being the betaproteobacterial "Candidatus Accumulibacter phosphatis" (Accumulibacter) and the model GAO being the gammaproteobacterial "Candidatus Competibacter phosphatis". Here, we report the discovery of a GAO from the genus Propionivibrio, which is closely related to Accumulibacter. Propionivibrio sp. are targeted by the canonical fluorescence in situ hybridization probes used to target Accumulibacter (PAOmix), but do not store excessive amounts of polyphosphate in situ. A laboratory scale reactor, operated to enrich for PAOs, surprisingly contained co-dominant populations of Propionivibrio and Accumulibacter. Metagenomic sequencing of multiple time-points enabled recovery of near complete population genomes from both genera. Annotation of the Propionivibrio genome confirmed their potential for the GAO phenotype and a basic metabolic model is proposed for their metabolism in the EBPR environment. Using newly designed fluorescence in situ hybridization (FISH) probes, analyses of full-scale EBPR plants revealed that Propionivibrio is a common member of the community, constituting up to 3% of the biovolume. To avoid overestimation of Accumulibacter abundance in situ, we recommend the use of the FISH probe PAO651 instead of the commonly applied PAOmix probe set. PMID:27458436

  5. Candidatus Propionivibrio aalborgensis”: A Novel Glycogen Accumulating Organism Abundant in Full-Scale Enhanced Biological Phosphorus Removal Plants

    Science.gov (United States)

    Albertsen, Mads; McIlroy, Simon J.; Stokholm-Bjerregaard, Mikkel; Karst, Søren M.; Nielsen, Per H.

    2016-01-01

    Enhanced biological phosphorus removal (EBPR) is widely used to remove phosphorus from wastewater. The process relies on polyphosphate accumulating organisms (PAOs) that are able to take up phosphorus in excess of what is needed for growth, whereby phosphorus can be removed from the wastewater by wasting the biomass. However, glycogen accumulating organisms (GAOs) may reduce the EBPR efficiency as they compete for substrates with PAOs, but do not store excessive amounts of polyphosphate. PAOs and GAOs are thought to be phylogenetically unrelated, with the model PAO being the betaproteobacterial “Candidatus Accumulibacter phosphatis” (Accumulibacter) and the model GAO being the gammaproteobacterial “Candidatus Competibacter phosphatis”. Here, we report the discovery of a GAO from the genus Propionivibrio, which is closely related to Accumulibacter. Propionivibrio sp. are targeted by the canonical fluorescence in situ hybridization probes used to target Accumulibacter (PAOmix), but do not store excessive amounts of polyphosphate in situ. A laboratory scale reactor, operated to enrich for PAOs, surprisingly contained co-dominant populations of Propionivibrio and Accumulibacter. Metagenomic sequencing of multiple time-points enabled recovery of near complete population genomes from both genera. Annotation of the Propionivibrio genome confirmed their potential for the GAO phenotype and a basic metabolic model is proposed for their metabolism in the EBPR environment. Using newly designed fluorescence in situ hybridization (FISH) probes, analyses of full-scale EBPR plants revealed that Propionivibrio is a common member of the community, constituting up to 3% of the biovolume. To avoid overestimation of Accumulibacter abundance in situ, we recommend the use of the FISH probe PAO651 instead of the commonly applied PAOmix probe set. PMID:27458436

  6. 巴西柑橘黄龙病相关细菌“Candidatus Liberibacter americanus”的基因组草图序列

    Institute of Scientific and Technical Information of China (English)

    Hong Lin; Helvecio D.Coletta-Filho; Cliff S.Han; 娄兵海; Edwin L.Civerolo; Marcos A.Machado; Goutam Gupta

    2014-01-01

    Hong Lin,Helvecio D.Coletta-Filho,CliffS.Han,Binghai Lou,EdwinL.Civerolo,Marcos A.Machado,and Goutam Gupta.Draft genome sequence of"Candidatus Liberibacter americanus" bacterium associated with citrus huanglongbing in Brazil.Genome Announcements,2013,1(3):e00275-13.在此,我们报道“Candidatus Liberibacter americanus" PW_SP株系基因组草图序列.大小为1,176,071bp的基因组,G+C含量为31.6%,包含948个开放阅读框,38个tRNA,3个完整的rRNA.

  7. Complete Genome Sequence of “Candidatus Tremblaya princeps” Strain PCVAL, an Intriguing Translational Machine below the Living-Cell Status

    OpenAIRE

    López-Madrigal, Sergio; Latorre, Amparo; Porcar, Manuel; Moya, Andrés; Gil Benso, Rosario

    2011-01-01

    The sequence of the genome of “Candidatus Tremblaya princeps” strain PCVAL, the primary endosymbiont of the citrus mealybug Planococcus citri, has been determined. “Ca. Tremblaya princeps” presents an unusual nested endosymbiosis and harbors a gammaproteobacterial symbiont within its cytoplasm in all analyzed mealybugs. The genome sequence reveals that “Ca. Tremblaya princeps” cannot be considered an independent organism but that the consortium with its gammaproteobacterial symbiotic associat...

  8. Lflg22, a Pathogen-Associated Molecular Pattern (PAMP) of Candidatus Liberibacter asiaticus, initiated differential PAMP-Triggered Immunity (PTI) in Grapefruit and Sun Chu Sha

    OpenAIRE

    Shi, Qingchun; Febres, Vicente J; Khalaf, Abeer; Moore, Gloria A.

    2014-01-01

    ‘Duncan’ Grapefruit (Citrus paradisi Macf.) and ‘Sun Chu Sha’ mandarin (C. reticulalta Blanco) represent two citrus genotypes that have different levels of tolerance to citrus greening or huanglongbing (HLB), a bacterial disease caused by Candidatus Liberibacter sp. In this study, the response of the two genotypes to the conserved 22 amino acid domain of the Liberibacter flagellin (Lflg22), a Pathogen-Associated Molecular Pattern (PAMP), were compared. The expression levels of citrus defense-...

  9. Visualization of ‘Candidatus Liberibacter asiaticus’ Cells in Citrus Seed Coats with Fluorescence In Situ Hybridization and Transmission Electron Microscopy

    OpenAIRE

    Hilf, M E; Sims, K. R.; Folimonova, S. Y.; Achor, D. S.

    2014-01-01

    Candidatus Liberibacter asiaticus’ is bacterium implicated as the causal agent of the economically damaging disease of citrus called huanglongbing (HLB).  The bacterium is spread by movement of infected citrus propagation material and by the Asian citrus psyllid, Diaphorina citri Kuwayama.  Seed transmission is a possible additional route of dissemination for the pathogen.  Some published studies on seed transmission found abundant bacterial DNA in seed coats but no infections of germinated ...

  10. Genome Sequence of “Candidatus Mycoplasma haemolamae” Strain Purdue, a Red Blood Cell Pathogen of Alpacas (Vicugna pacos) and Llamas (Lama glama)

    OpenAIRE

    Guimaraes, Ana M. S.; Toth, Balazs; Santos, Andrea P.; do Nascimento, Naíla C; Kritchevsky, Janice E.; Joanne B Messick

    2012-01-01

    We report the complete genome sequence of “Candidatus Mycoplasma haemolamae,” an endemic red-cell pathogen of camelids. The single, circular chromosome has 756,845 bp, a 39.3% G+C content, and 925 coding sequences (CDSs). A great proportion (49.1%) of these CDSs are organized into paralogous gene families, which can now be further explored with regard to antigenic variation.

  11. Molecular and Physiological Properties Associated with Zebra Complex Disease in Potatoes and Its Relation with Candidatus Liberibacter Contents in Psyllid Vectors

    OpenAIRE

    Alvarado, Veria Y.; Odokonyero, Denis; Duncan, Olivia; Mirkov, T. Erik; Scholthof, Herman B.

    2012-01-01

    Zebra complex (ZC) disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs), an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc). The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to health...

  12. Use of Electrical Penetration Graph Technology to Examine Transmission of ‘Candidatus Liberibacter solanacearum’ to Potato by Three Haplotypes of Potato Psyllid (Bactericera cockerelli; Hemiptera: Triozidae)

    OpenAIRE

    Mustafa, Tariq; Horton, David R.; Cooper, W. Rodney; Swisher, Kylie D.; Zack, Richard S.; Pappu, Hanu R.; Munyaneza, Joseph E.

    2015-01-01

    The potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae), is a vector of the phloem-limited bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG) technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern). All haploty...

  13. Asian Citrus Psyllid Expression Profiles Suggest Candidatus Liberibacter Asiaticus-Mediated Alteration of Adult Nutrition and Metabolism, and of Nymphal Development and Immunity

    OpenAIRE

    Vyas, Meenal; Tonja W. Fisher; He, Ruifeng; Nelson, William; Yin, Guohua; Joseph M. Cicero; Willer, Mark; Kim, Ryan; Kramer, Robin; Greg A. May; John A. Crow; Soderlund, Carol A.; Gang, David R.; Brown, Judith K.

    2015-01-01

    The Asian citrus psyllid (ACP) Diaphorina citri Kuwayama (Hemiptera: Psyllidae) is the insect vector of the fastidious bacterium Candidatus Liberibacter asiaticus (CLas), the causal agent of citrus greening disease, or Huanglongbing (HLB). The widespread invasiveness of the psyllid vector and HLB in citrus trees worldwide has underscored the need for non-traditional approaches to manage the disease. One tenable solution is through the deployment of RNA interference technology to silence prote...

  14. Complete Genome Sequences of the Obligate Symbionts “Candidatus Sulcia muelleri” and “Ca. Nasuia deltocephalinicola” from the Pestiferous Leafhopper Macrosteles quadripunctulatus (Hemiptera: Cicadellidae)

    Science.gov (United States)

    Abbà, Simona; Kube, Michael; Marzachì, Cristina

    2016-01-01

    Two bacterial symbionts of the European pest leafhopper, Macrosteles quadripunctulatus (Hemiptera: Cicadellidae), were fully sequenced. “Candidatus Sulcia muelleri” and “Ca. Nasuia deltocephalinicola” represent two of the smallest known bacterial genomes at 190 kb and 112 kb, respectively. Genome sequences are nearly identical to strains reported from the closely related host species, M. quadrilineatus. PMID:26798106

  15. Molecular detection and occurrence of 'Candidatus Mycoplasma haemobos' in dairy cattle of Southern Brazil Detecção molecular e ocorrência de 'Candidatus Mycoplasma haemobos' em bovinos de leite do Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Aline Girotto

    2012-09-01

    Full Text Available Bovine hemoplasmas are bacteria found on the erythrocyte surface or free in the plasma of cattle. The aim of the present study was to evaluate the occurrence of 'Candidatus Mycoplasma haemobos' ('C. M. haemobos' in Holstein and Jersey cattle raised in Londrina and surroundings, northern region of the State of Parana, Southern Brazil. PCR testing directed to 16S rRNA gene fragment was performed to investigate the occurrence and characterize the molecular identity of 'C. M. haemobos'. A total of 264/433 (60.97% blood samples were positive by PCR. Further alignment of 500-bp amplicons to available sequences at the GenBank database showed high identity (100% to 'C. M. haemobos'. To the author's knowledge, this is the first molecular confirmation of the hemoplasma 'C. M. haemobos' in cattle from Brazil. Moreover, 'C. M. haemobos' was observed in high occurrence in dairy cattle, and may have significant impact in livestock production.Hemoplasmas de bovinos são bactérias encontradas na superfície de hemácias, ou livre no plasma de bovinos. O objetivo do presente estudo foi avaliar a ocorrência de Candidatus Mycoplasma haemobos' ('C. M. haemobos' em bovinos das raças Holandesa e Jersey da região de Londrina, norte do Paraná, sul do Brasil. Para investigar a ocorrência e caracterizar a identidade molecular do 'C. M haemobos' uma PCR baseada no fragmento do gene 16S rRNA foi realizada. A PCR identificou como positivas 264/433 (61% amostras de sangue testadas. O alinhamento deste fragmento de 500 pb com seqüências disponíveis no GenBank mostrou 100% de identidade 'C. M. haemobos'. Pela bibliografia consultada, esta é a primeira confirmação molecular do hemoplasma 'C. M. haemobos' em bovinos no Brasil. Além disso, foi observada uma alta prevalência deste hemoplasma em bovinos de leite, que pode ter um impacto importante na pecuária bovina.

  16. Quantitative real-time PCR for detection and identification of Candidatus Liberibacter species associated with citrus huanglongbing.

    Science.gov (United States)

    Li, Wenbin; Hartung, John S; Levy, Laurene

    2006-07-01

    Citrus huanglongbing (HLB, ex greening) is one of the most serious diseases of citrus. Different forms of the disease are caused by different Candidatus Liberobacter species, Candidatus Liberibacter asiaticus (Las), Ca. L. africanus (Laf) and Ca. L. americanus (Lam). The pathogen is transmitted by psyllid insects and by budding with contaminated plant materials. The vector psyllid Diaphorina citri can transmit both Las and Lam. Establishment of this vector into Florida, reports of Lam and Las in Brazil in 2004, and recent confirmation of HLB in Florida in September 2005 is of great concern to the citrus industry. Research on HLB has been hampered by the unculturable nature of the causal bacterium in artificial media. It has also been difficult to detect and identify the pathogens, possibly because of low concentration and uneven distribution in host plants and vector psyllids. In this study, we developed quantitative TaqMan PCR using 16S rDNA-based TaqMan primer-probe sets specific to the different Ca. Liberobacter spp. An additional primer-probe set based on plant cytochrome oxidase (COX) was used as a positive internal control to assess the quality of the DNA extracts. The assays do not cross-react with other pathogens or endophytes commonly resident in citrus plants, and are very sensitive. HLB pathogen DNA was successfully amplified from the equivalent of 20 ng of midrib tissue from symptomatic leaves. The consistent results of the assays with DNA extracted from plants infected by various Ca. Liberibacter species grown in greenhouses and in the field demonstrated a degree of reproducibility for these TaqMan assays. Inhibitors of the PCR that are frequently present in plant extracts did not affect the assay results. The population of the pathogens was estimated to be 5 x 10(7) and 2 x 10(6) cells/g of fresh midribs of symptomatic sweet orange leaves infected by Las and Lam, respectively. The ratio of pathogen DNA to host plant DNA was estimated by to be 1

  17. Comparison of community structures of Candidatus Methylomirabilis oxyfera-like bacteria of NC10 phylum in different freshwater habitats.

    Science.gov (United States)

    Shen, Li-Dong; Wu, Hong-Sheng; Gao, Zhi-Qiu; Liu, Xu; Li, Ji

    2016-01-01

    Methane oxidation coupled to nitrite reduction is mediated by 'Candidatus Methylomirabilis oxyfera' (M. oxyfera), which belongs to the NC10 phylum. In this study, the community composition and diversity of M. oxyfera-like bacteria of NC10 phylum were examined and compared in four different freshwater habitats, including reservoir sediments (RS), pond sediments (PS), wetland sediments (WS) and paddy soils (PAS), by using Illumina-based 16S rRNA gene sequencing. The recovered NC10-related sequences accounted for 0.4-2.5% of the 16S rRNA pool in the examined habitats, and the highest percentage was found in WS. The diversity of NC10 bacteria were the highest in RS, medium in WS, and lowest in PS and PAS. The observed number of OTUs (operational taxonomic unit; at 3% cut-off) were 97, 46, 61 and 40, respectively, in RS, PS, WS and PAS. A heterogeneous distribution of NC10 bacterial communities was observed in the examined habitats, though group B members were the dominant bacteria in each habitat. The copy numbers of NC10 bacterial 16S rRNA genes ranged between 5.8 × 10(6) and 3.2 × 10(7) copies g(-1) sediment/soil in the examined habitats. These results are helpful for a systematic understanding of NC10 bacterial communities in different types of freshwater habitats. PMID:27157928

  18. Convenient detection of the citrus greening (huanglongbing bacterium 'Candidatus Liberibacter asiaticus' by direct PCR from the midrib extract.

    Directory of Open Access Journals (Sweden)

    Takashi Fujikawa

    Full Text Available A phloem-limited bacterium, 'Candidatus Liberibacter asiaticus' (Las is a major pathogen of citrus greening (huanglongbing, one of the most destructive citrus diseases worldwide. The rapid identification and culling of infected trees and budwoods in quarantine are the most important control measures. DNA amplification including conventional polymerase chain reaction (PCR has commonly been used for rapid detection and identification. However, long and laborious procedures for DNA extraction have greatly reduced the applicability of this method. In this study, we found that the Las bacterial cells in the midribs of infected leaves were extracted rapidly and easily by pulverization and centrifugation with mini homogenization tubes. We also found that the Las bacterial cells in the midrib extract were suitable for highly sensitive direct PCR. The performance of direct PCR using this extraction method was not inferior to that of conventional PCR. Thus, the direct PCR method described herein is characterized by its simplicity, sensitivity, and robustness, and is applicable to quarantine testing.

  19. Amino acid-assimilating phototrophic heliobacteria from soda lake environments: Heliorestis acidaminivorans sp. nov. and 'Candidatus Heliomonas lunata'.

    Science.gov (United States)

    Asao, Marie; Takaichi, Shinichi; Madigan, Michael T

    2012-07-01

    Two novel taxa of heliobacteria, Heliorestis acidaminivorans sp. nov. strain HR10B(T) and 'Candidatus Heliomonas lunata' strain SLH, were cultured from shoreline sediments/soil of Lake El Hamra (Egypt) and lake water/benthic sediments of Soap Lake (USA), respectively; both are highly alkaline soda lakes. Cells of strain HR10B were straight rods, while cells of strain SLH were curved rods. Both organisms were obligate anaerobes, produced bacteriochlorophyll g, and lacked intracytoplasmic photosynthetic membrane systems. Although the absorption spectrum of strain HR10B was typical of other heliobacteria, that of strain SLH showed unusually strong absorbance of the OH-chlorophyll a component. Major carotenoids of both organisms were OH-diaponeurosporene glucosyl esters, as in other alkaliphilic heliobacteria, and both displayed an alkaliphilic and mesophilic phenotype. Strain HR10B was remarkable among heliobacteria in its capacity to photoassimilate a number of carbon sources, including several amino acids. Nitrogenase activity was observed in strain HR10B, but not in strain SLH. The 16S ribosomal RNA gene tree placed strain HR10B within the genus Heliorestis, but distinct from other described species. By contrast, strain SLH was phylogenetically more closely related to neutrophilic heliobacteria and is the first alkaliphilic heliobacterium known outside of the genus Heliorestis. PMID:22588563

  20. Loop-Mediated Isothermal Amplification Procedure (LAMP) for Detection of the Potato Zebra Chip Pathogen "Candidatus Liberibacter solanacearum".

    Science.gov (United States)

    Ravindran, Aravind; Lévy, Julien; Pierson, Elizabeth; Gross, Dennis C

    2015-01-01

    An efficient loop-mediated isothermal amplification procedure (LAMP) for the detection of "Candidatus Liberibacter solanacearum" (Lso), the bacterial causal agent of potato zebra chip (ZC) disease, is described in this chapter. Similar to the polymerase chain reaction (PCR), the LAMP employs a bacterial polymerase to amplify specific DNA sequences. However, the method differs from conventional PCR in that it uses six primers specific to the target region to generate a loop structure and autocycling strand displacement rather than thermocycling for sequence amplification. Moreover, unlike PCR that requires agarose gel electrophoresis for resolution, the positive LAMP results can be visualized directly as a precipitate within the reaction tubes. The 16S rDNA gene of "Ca. Liberibacter solanacearum" was used as the target for the design of the six LAMP primers. The LAMP technique is a reliable, rapid, and cost-effective method of detecting the "Ca. Liberibacter solanacearum" pathogen in the potato/tomato psyllid, Bactericera cockerelli, and in field-grown potato plants and tubers. PMID:25981248

  1. Manipulation of plant defense responses by the tomato psyllid (Bactericerca cockerelli and its associated endosymbiont Candidatus Liberibacter psyllaurous.

    Directory of Open Access Journals (Sweden)

    Clare L Casteel

    Full Text Available Some plant pathogens form obligate relationships with their insect vector and are vertically transmitted via eggs analogous to insect endosymbionts. Whether insect endosymbionts manipulate plant defenses to benefit their insect host remains unclear. The tomato psyllid, Bactericerca cockerelli (Sulc, vectors the endosymbiont "Candidatus Liberibacter psyllaurous" (Lps during feeding on tomato (Solanum lycopersicum L.. Lps titer in psyllids varied relative to the psyllid developmental stage with younger psyllids harboring smaller Lps populations compared to older psyllids. In the present study, feeding by different life stages of B. cockerelli infected with Lps, resulted in distinct tomato transcript profiles. Feeding by young psyllid nymphs, with lower Lps levels, induced tomato genes regulated by jasmonic acid (JA and salicylic acid (SA (Allene oxide synthase, Proteinase inhibitor 2, Phenylalanine ammonia-lyase 5, Pathogenesis-related protein 1 compared to feeding by older nymphs and adults, where higher Lps titers were found. In addition, inoculation of Lps without insect hosts suppressed accumulation of these defense transcripts. Collectively, these data suggest that the endosymbiont-like pathogen Lps manipulates plant signaling and defensive responses to benefit themselves and the success of their obligate insect vector on their host plant.

  2. Horizontal Transmission of "Candidatus Liberibacter solanacearum" by Bactericera cockerelli (Hemiptera: Triozidae on Convolvulus and Ipomoea (Solanales: Convolvulaceae.

    Directory of Open Access Journals (Sweden)

    Glenda L Torres

    Full Text Available "Candidatus Liberibacter solanacearum" (Proteobacteria is an important pathogen of solanaceous crops (Solanales: Solanaceae in North America and New Zealand, and is the putative causal agent of zebra chip disease of potato. This phloem-limited pathogen is transmitted to potato and other solanaceous plants by the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae. While some plants in the Convolvulaceae (Solanales are also known hosts for B. cockerelli, previous efforts to detect Liberibacter in Convolvulaceae have been unsuccessful. Moreover, studies to determine whether Liberibacter can be acquired from these plants by B. cockerelli are lacking. The goal of this study was to determine whether horizontal transmission of Liberibacter occurs among potato psyllids on two species of Convolvulaceae, sweet potato (Ipomoea batatas and field bindweed (Convolvulus arvensis, which grows abundantly in potato growing regions of the United States. Results indicated that uninfected psyllids acquired Liberibacter from both I. batatas and C. arvensis if infected psyllids were present on plants concurrently with the uninfected psyllids. Uninfected psyllids did not acquire Liberibacter from plants if the infected psyllids were removed from the plants before the uninfected psyllids were allowed access. In contrast with previous reports, PCR did detect the presence of Liberibacter DNA in some plants. However, visible amplicons were faint and did not correspond with acquisition of the pathogen by uninfected psyllids. None of the plants exhibited disease symptoms. Results indicate that horizontal transmission of Liberibacter among potato psyllids can occur on Convolvulaceae, and that the association between Liberibacter and Convolvulaceae merits additional attention.

  3. Isolation of 'Candidatus Nitrosocosmicus franklandus', a novel ureolytic soil archaeal ammonia oxidiser with tolerance to high ammonia concentration.

    Science.gov (United States)

    Lehtovirta-Morley, Laura E; Ross, Jenna; Hink, Linda; Weber, Eva B; Gubry-Rangin, Cécile; Thion, Cécile; Prosser, James I; Nicol, Graeme W

    2016-05-01

    Studies of the distribution of ammonia oxidising archaea (AOA) and bacteria (AOB) suggest distinct ecological niches characterised by ammonia concentration and pH, arising through differences in substrate affinity and ammonia tolerance. AOA form five distinct phylogenetic clades, one of which, the 'Nitrososphaera sister cluster', has no cultivated isolate. A representative of this cluster, named 'Candidatus Nitrosocosmicus franklandus', was isolated from a pH 7.5 arable soil and we propose a new cluster name:'Nitrosocosmicus' While phylogenetic analysis of amoA genes indicates its association with the Nitrososphaera sister cluster, analysis of 16S rRNA genes provided no support for a relative branching that is consistent with a 'sister cluster', indicating placement within a lineage of the order Nitrososphaerales 'Ca.N. franklandus' is capable of ureolytic growth and its tolerances to nitrite and ammonia are higher than in other AOA and similar to those of typical soil AOB. Similarity of other growth characteristics of 'Ca.N. franklandus' with those of typical soil AOB isolates reduces support for niche differentiation between soil AOA and AOB and suggests that AOA have a wider physiological diversity than previously suspected. In particular, the high ammonia tolerance of 'Ca.N. franklandus' suggests potential contributions to nitrification in fertilised soils. PMID:26976843

  4. Isolation of ‘Candidatus Nitrosocosmicus franklandus’, a novel ureolytic soil archaeal ammonia oxidiser with tolerance to high ammonia concentration

    Science.gov (United States)

    Lehtovirta-Morley, Laura E.; Ross, Jenna; Hink, Linda; Weber, Eva B.; Gubry-Rangin, Cécile; Thion, Cécile; Prosser, James I.; Nicol, Graeme W.

    2016-01-01

    Studies of the distribution of ammonia oxidising archaea (AOA) and bacteria (AOB) suggest distinct ecological niches characterised by ammonia concentration and pH, arising through differences in substrate affinity and ammonia tolerance. AOA form five distinct phylogenetic clades, one of which, the ‘Nitrososphaera sister cluster’, has no cultivated isolate. A representative of this cluster, named ‘Candidatus Nitrosocosmicus franklandus’, was isolated from a pH 7.5 arable soil and we propose a new cluster name: ‘Nitrosocosmicus’. While phylogenetic analysis of amoA genes indicates its association with the Nitrososphaera sister cluster, analysis of 16S rRNA genes provided no support for a relative branching that is consistent with a ‘sister cluster’, indicating placement within a lineage of the order Nitrososphaerales. ‘Ca. N. franklandus’ is capable of ureolytic growth and its tolerances to nitrite and ammonia are higher than in other AOA and similar to those of typical soil AOB. Similarity of other growth characteristics of ‘Ca. N. franklandus’ with those of typical soil AOB isolates reduces support for niche differentiation between soil AOA and AOB and suggests that AOA have a wider physiological diversity than previously suspected. In particular, the high ammonia tolerance of ‘Ca. N. franklandus’ suggests potential contributions to nitrification in fertilised soils. PMID:26976843

  5. Zebra chip disease and potato biochemistry: tuber physiological changes in response to 'Candidatus Liberibacter solanacearum' infection over time.

    Science.gov (United States)

    Rashed, A; Wallis, C M; Paetzold, L; Workneh, F; Rush, C M

    2013-05-01

    Zebra chip disease, putatively caused by the bacterium 'Candidatus Liberibacter solanacearum', is of increasing concern to potato production in Mexico, the United States, and New Zealand. However, little is known about the etiology of this disease and changes that occur within host tubers that result in its symptoms. Previous studies found that increased levels of phenolics, amino acids, defense proteins, and carbohydrates in 'Ca. L. solanacearum'-infected tubers are associated with symptoms of zebra chip. This study was conducted to quantify variations in levels of these biochemical components in relation to the time of infestation, symptom severity, and 'Ca. L. solanacearum' titer. Levels of phenolics, peroxidases, polyphenol oxidases, and reducing sugars (glucose and, to some extent, fructose) changed during infection, with higher levels occurring in tubers infected at least 5 weeks before harvest than in those infected only a week before harvest and those of controls. Compared with the apical tuber ends, greater levels of phenolics, peroxidases, and sucrose occurred at the basal (stolon attachment) end of infected tubers. With the exception of phenolics, concentrations of the evaluated compounds were not associated with 'Ca. L. solanacearum' titer. However, there were significant associations between biochemical responses and symptom severity. The lack of a linear correlation between most plant biochemical responses and 'Ca. L. solanacearum' titer suggests that shifts in metabolic profiles are independent of variations in 'Ca. L. solanacearum' levels. PMID:23425237

  6. Intravascular hemolysis associated with Candidatus Mycoplasma hematoparvum in a non-splenectomized dog in the south region of Iran.

    Science.gov (United States)

    Sharifiyazdi, Hassan; Abbaszadeh Hasiri, Mohammad; Amini, Amin Hosein

    2014-01-01

    A 2-year-old male Pekingese dog was referred to Shiraz University's Veterinary Teaching Hospital for anorexia and depression. The case had no history of surgery. Physical examination revealed no abnormalities except mild depression and fever. Small, coccoid, epicellular bacteria were detected on erythrocytes by microscopic examination of the Giemsa-stained blood smears. Abnormalities noted in the complete blood count included regenerative anemia characterized by a marked reticulocytosis. Examination of the plasma showed visual evidence of slight intra vascular hemolysis. In addition, Howell-Jolly bodies, nucleated RBCs, increased immature neutrophils and thrombocytosis were found in this case. The urine was strongly positive for bilirubin, and the urine sediment had abundant bilirubin crystals. For polymerase chain reaction (PCR) purpose, total DNA was extracted from blood sample collected from dog. PCR was positive and phylogenetic analysis of concatenated data showed our isolate clustered within Candidatus Mycoplasma hematoparvum group. Treatment was performed by oral ciprofloxacin and prednisolone. The clinical signs improved after three days. Two month follow-up showed no recurrence. In conclusion, hemoplasmosis should be considered as a differential diagnosis in dogs with hemolytic process and pyrexia. The PCR evaluation for hemoplasma DNA should be included in the investigation of such cases to enable the rapid detection of this infection, which may be more common than previously estimated. Besides, ciprofloxacin might have an effect on treatment of hemoplasma in dogs, however, conducting further case studies are necessary to recommend successful treatment. PMID:25568726

  7. The destructive citrus pathogen, 'Candidatus Liberibacter asiaticus' encodes a functional flagellin characteristic of a pathogen-associated molecular pattern.

    Directory of Open Access Journals (Sweden)

    Huasong Zou

    Full Text Available Huanglongbing (HLB is presently the most devastating citrus disease worldwide. As an intracellular plant pathogen and insect symbiont, the HLB bacterium, 'Candidatus Liberibacter asiaticus' (Las, retains the entire flagellum-encoding gene cluster in its significantly reduced genome. Las encodes a flagellin and hook-associated protein (Fla of 452 amino acids that contains a conserved 22 amino acid domain (flg22 at positions 29 to 50 in the N-terminus. The phenotypic alteration in motility of a Sinorhizobium meliloti mutant lacking the fla genes was partially restored by constitutive expression of Fla(Las. Agrobacterium-mediated transient expression in planta revealed that Fla(Las induced cell death and callose deposition in Nicotiana benthamiana, and that the transcription of BAK1 and SGT1, which are associated with plant innate immunity, was upregulated. Amino acid substitution experiments revealed that residues 38 (serine and 39 (aspartate of Fla(Las were essential for callose induction. The synthetic flg22(Las peptide could not induce plant cell death but retained the ability to induce callose deposition at a concentration of 20 µM or above. This demonstrated that the pathogen-associated molecular pattern (PAMP activity of flg22 in Las was weaker than those in other well-studied plant pathogenic bacteria. These results indicate that Fla(Las acts as a PAMP and may play an important role in triggering host plant resistance to the HLB bacteria.

  8. Effective Antibiotics against ‘Candidatus Liberibacter asiaticus’ in HLB-Affected Citrus Plants Identified via the Graft-Based Evaluation

    Science.gov (United States)

    Powell, Charles A.; Doud, Melissa S.; Yang, Chuanyu; Duan, Yongping

    2014-01-01

    Citrus huanglongbing (HLB), caused by three species of fastidious, phloem-limited ‘Candidatus Liberibacter’, is one of the most destructive diseases of citrus worldwide. To date, there is no established cure for this century-old and yet, newly emerging disease. As a potential control strategy for citrus HLB, 31 antibiotics were screened for effectiveness and phytotoxicity using the optimized graft-based screening system with ‘Candidatus Liberibacter asiaticus’ (Las)-infected citrus scions. Actidione and Oxytetracycline were the most phytotoxic to citrus with less than 10% of scions surviving and growing; therefore, this data was not used in additional analyses. Results of principal component (PCA) and hierarchical clustering analyses (HCA) demonstrated that 29 antibiotics were clustered into 3 groups: highly effective, partly effective, and not effective. In spite of different modes of actions, a number of antibiotics such as, Ampicillin, Carbenicillin, Penicillin, Cefalexin, Rifampicin and Sulfadimethoxine were all highly effective in eliminating or suppressing Candidatus Liberibacter asiaticus indicated by both the lowest Las infection rate and titers of the treated scions and inoculated rootstock. The non-effective group, including 11 antibiotics alone with three controls, such as Amikacin, Cinoxacin, Gentamicin, Kasugamycin, Lincomycin, Neomycin, Polymixin B and Tobramycin, did not eliminate or suppress Las in the tested concentrations, resulting in plants with increased titers of Las. The other 12 antibiotics partly eliminated or suppressed Las in the treated and graft-inoculated plants. The effective and non-phytotoxic antibiotics could be potential candidates for control of citrus HLB, either for the rescue of infected citrus germplasm or for restricted field application. PMID:25372135

  9. Phylogenetic analysis identifies a 'Candidatus Phytoplasma oryzae'-related strain associated with yellow leaf disease of areca palm (Areca catechu L.) in India.

    Science.gov (United States)

    Ramaswamy, Manimekalai; Nair, Smita; Soumya, V P; Thomas, George V

    2013-04-01

    Yellow leaf disease (YLD) with phytoplasmal aetiology is a serious disease of arecanut palm in India. The present study was undertaken to characterize the 16S rRNA and secA gene sequences of the Indian arecanut YLD phytoplasma for 'Candidatus Phytoplasma' species assignment and 16Sr group/subgroup classification. Phytoplasma 16S rRNA genes were amplified using three sets of semi-nested/nested primers, 1F7/7R3-1F7/7R2, 4Fwd/3Rev-4Fwd/5Rev and P1/P7-R16F2n/R16R2, producing amplicons of 491, 1150 and 1250 bp, respectively, from diseased samples. The amplicons were cloned and sequenced. A blast search showed that the sequences had 99 % similarity with sugar cane white leaf phytoplasma (16SrXI) and Napier grass stunt phytoplasma (16SrXI). Phylogenetic analysis based on the 16S rRNA gene revealed the clustering of YLD phytoplasma with the rice yellow dwarf and Bermuda grass white leaf groups. The YLD phytoplasma F2nR2 sequence shared 97.5 % identity with that of 'Candidatus Phytoplasma oryzae' and 97.8 % identity with that of 'Candidatus Phytoplasma cynodontis'. Hence, for finer differentiation, we examined the secA gene-based phylogeny, where the YLD phytoplasma clustered with Napier grass stunt and sugar cane grassy shoot phytoplasmas, both belonging to the rice yellow dwarf group. Hence, we are assigning the Indian arecanut YLD phytoplasma as a 'Candidatus Phytoplasma oryzae'-related strain. Virtual RFLP analysis of a 1.2 kb fragment of the 16S rRNA gene (F2nR2 region) identified the Indian arecanut YLD phytoplasma as a member of 16SrXI-B subgroup. We name the phytoplasma Indian yellow leaf disease phytoplasma, to differentiate it from the Hainan YLD phytoplasma, which belongs to group 16SrI. PMID:22843718

  10. Disrupt the bacterial growth in the insect vector to block the transmission of Candidatus Liberibacter asiaticus to citrus, the causal agent of citrus greening disease

    OpenAIRE

    Killiny, N.; Hajeri, S.; Gowda, S.; Davis, M. J.

    2014-01-01

    The genome of Candidatus Liberibacter asiaticus (CLas) reveals the presence of luxR, encodingLuxR protein, one of a two component cell-to-cell communication system. However, the genome lacks the second component, luxl, that produces acyl-homoserine lactones (AHLs), suggesting that CLas has a solo LuxR system. Interestingly, we detected compounds that may act as AHLs in the insect vector (psyllids) that are healthy or infected with CLas, but not in the citrus plants. This finding suggests that...

  11. First Report of ‘Candidatus Liberibacter asiaticus’ associated with huanglongbing in the weeds Cleome rutidosperma, Pisonia aculeata and Trichostigma octandrum in Jamaica

    OpenAIRE

    Brown, S.E.; Oberheim, A. P.; Barrett, A.; McLaughlin, W. A.

    2014-01-01

    Citrus huanglongbing (HLB) also known as citrus greening is the most destructive disease of citrus worldwide.  Three species of the causal organism have been identified.  These are ‘Candidatus Liberibacter asiaticus’, ‘Ca. L. africanus’ and ‘Ca. L. americanus’ (Bové, 2006). In 2010 a survey of non-citrus plants was conducted on two major citrus producing farms in Clarendon and St Catherine in Jamaica.  This was to determine the possibility of the existence of non-citrus hosts of HLB.  A total...

  12. The Chemistry behind DNA Isolation from Orange Juice and Detection of 16S rDNA of Candidatus Liberibacter asiaticus by qPCR

    OpenAIRE

    J. Bai; Baldwin, E. A.; Liao, H.; Kostenyuk, I.; Burns, J.; Irey, M.

    2014-01-01

    The current standard to diagnose Huanglongbing (HLB) for citrus trees is to take samples from midribs of leaves, which are rich in phloem tissues, and apply quantitative real-time PCR (qPCR) test to detect 16S rDNA of Candidatus Liberibacter asiaticus (CLas), the putative causal pathogen. It is extremely difficult to detect CLas in orange juice because of the low CLas population, high pectin concentration, low pH and possible existence of an inhibitor to DNA amplification. The objective of th...

  13. Localization and Distribution of 'Candidatus Liberibacter asiaticus’ in Citrus and Periwinkle by Direct Tissue Blot Immuno Assay with an Anti-OmpA Polyclonal Antibody

    OpenAIRE

    Ding, Fang; Duan, Yongping; Paul, Cristina; Brlansky, Ronald H.; Hartung, John S.

    2015-01-01

    Candidatus Liberibacter asiaticus’ (CaLas), a non-cultured member of the α-proteobacteria, is the causal agent of citrus Huanglongbing (HLB). Due to the difficulties of in vitro culture, antibodies against CaLas have not been widely used in studies of this pathogen. We have used an anti-OmpA polyclonal antibody based direct tissue blot immunoassay to localize CaLas in different citrus tissues and in periwinkle leaves. In citrus petioles, CaLas was unevenly distributed in the phloem sieve tub...

  14. The ubiquity of small-world networks

    CERN Document Server

    Telesford, Qawi K; Hayasaka, Satoru; Burdette, Jonathan H; Laurienti, Paul J

    2011-01-01

    Small-world networks by Watts and Strogatz are a class of networks that are highly clustered, like regular lattices, yet have small characteristic path lengths, like random graphs. These characteristics result in networks with unique properties of regional specialization with efficient information transfer. Social networks are intuitive examples of this organization with cliques or clusters of friends being interconnected, but each person is really only 5-6 people away from anyone else. While this qualitative definition has prevailed in network science theory, in application, the standard quantitative application is to compare path length (a surrogate measure of distributed processing) and clustering (a surrogate measure of regional specialization) to an equivalent random network. It is demonstrated here that comparing network clustering to that of a random network can result in aberrant findings and networks once thought to exhibit small-world properties may not. We propose a new small-world metric, {\\omega}...

  15. Discovery of a SAR11 growth requirement for thiamin's pyrimidine precursor and its distribution in the Sargasso Sea.

    Science.gov (United States)

    Carini, Paul; Campbell, Emily O; Morré, Jeff; Sañudo-Wilhelmy, Sergio A; Thrash, J Cameron; Bennett, Samuel E; Temperton, Ben; Begley, Tadhg; Giovannoni, Stephen J

    2014-08-01

    Vitamin traffic, the production of organic growth factors by some microbial community members and their use by other taxa, is being scrutinized as a potential explanation for the variation and highly connected behavior observed in ocean plankton by community network analysis. Thiamin (vitamin B1), a cofactor in many essential biochemical reactions that modify carbon-carbon bonds of organic compounds, is distributed in complex patterns at subpicomolar concentrations in the marine surface layer (0-300 m). Sequenced genomes from organisms belonging to the abundant and ubiquitous SAR11 clade of marine chemoheterotrophic bacteria contain genes coding for a complete thiamin biosynthetic pathway, except for thiC, encoding the 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP) synthase, which is required for de novo synthesis of thiamin's pyrimidine moiety. Here we demonstrate that the SAR11 isolate 'Candidatus Pelagibacter ubique', strain HTCC1062, is auxotrophic for the thiamin precursor HMP, and cannot use exogenous thiamin for growth. In culture, strain HTCC1062 required 0.7 zeptomoles per cell (ca. 400 HMP molecules per cell). Measurements of dissolved HMP in the Sargasso Sea surface layer showed that HMP ranged from undetectable (detection limit: 2.4 pM) to 35.7 pM, with maximum concentrations coincident with the deep chlorophyll maximum. In culture, some marine cyanobacteria, microalgae and bacteria exuded HMP, and in the Western Sargasso Sea, HMP profiles changed between the morning and evening, suggesting a dynamic biological flux from producers to consumers. PMID:24781899

  16. Incidence of 'Candidatus Liberibacter asiaticus'-Infected Plants Among Citrandarins as Rootstock and Scion Under Field Conditions.

    Science.gov (United States)

    Boava, Leonardo Pires; Sagawa, Cíntia Helena Duarte; Cristofani-Yaly, Mariângela; Machado, Marcos Antonio

    2015-04-01

    Huanglongbing (HLB), caused by the bacterium 'Candidatus Liberibacter' spp., is currently one of the most serious diseases of citrus plants and has caused substantial economic losses. Thus far, there is no source of genetic resistance to HLB in the genus Citrus or its relatives. However, several studies have reported Poncirus trifoliata and some of its hybrids to be more tolerant to the disease. The main objective of this study was to report differences in the incidence of 'Ca. L. asiaticus' infection in citrandarin plants, hybrids from Sunki mandarin (Citrus sunki (Hayata) hort. ex Tanaka), and trifoliate orange Rubidoux (P. trifoliata (L.) Raf.)), after conducting an extensive survey under field conditions. These hybrid plants were established for approximately 7 years in an area with a high incidence of 'Ca. L. asiaticus'-infected plants. We selected two experimental areas (area A and area B), located approximately 10 m apart. Area A consists of Pera sweet orange (C. sinensis (L.) Osb.) grafted onto 56 different citrandarin rootstocks. Area B consists of citrandarin scions grafted onto Rangpur lime (C. limonia Osb.) rootstock. Bacteria in the leaves and roots were detected using real-time quantitative polymerase chain reaction. The incidence of 'Ca. L. asiaticus'-infected plants was 92% in area A and 14% in area B. Because infected plants occurred in both areas, we examined whether the P. trifoliata hybrid rootstock influenced HLB development and also determined the distribution of 'Ca. L. asiaticus' in Citrus tree tissues. Although this survey does not present evidence regarding the resistance of P. trifoliata and its hybrids in relation to bacteria or psyllids, future investigation, mainly using the most promising hybrids for response to 'Ca. L. asiaticus', will help us to understand the probable mechanism of defense or identifying compounds in P. trifoliata and its hybrids that are very important as strategy to combat HLB. Details of these results are

  17. Crystal structures and kinetic properties of enoyl-acyl carrier protein reductase I from Candidatus Liberibacter asiaticus.

    Science.gov (United States)

    Jiang, Ling; Gao, Zengqiang; Li, Yanhua; Wang, Shennan; Dong, Yuhui

    2014-04-01

    Huanglongbing (HLB) is a destructive citrus disease. The leading cause of HLB is Candidatus Liberibacter asiaticus. Fatty acid biosynthesis is essential for bacterial viability and has been validated as a target for the discovery of novel antibacterial agents. Enoyl-acyl carrier protein reductase (also called ENR or FabI and a product of the fabI gene) is an enzyme required in a critical step of bacterial fatty acid biosynthesis and has attracted attention as a target of novel antimicrobial agents. We determined the crystal structures of FabI from Ca. L. asiaticus in its apoform as well as in complex with b-nicotinamide adenine dinucleotide (NAD) at 1.7 and 2.7 Å resolution, respectively, to facilitate the design and screening of small molecule inhibitors of FabI. The monomeric ClFabI is highly similar to other known FabI structures as expected; however, unlike the typical tetramer, ClFabI exists as a hexamer in crystal, whereas as dimer in solution, on the other hand, the substrate binding loop which always disordered in apoform FabI structures is ordered in apo-ClFabI. Interestingly, the structure of ClFabI undergoes remarkable conformational change in the substrate-binding loop in the presence of NAD. We conclude that the signature sequence motif of FabI can be considered as Gly-(Xaa)5-Ser-(Xaa)n-Val-Tyr-(Xaa)6-Lys-(Xaa)n-Thr instead of Tyr-(Xaa)6-Lys. We have further identified isoniazid as a competitive inhibitor with NADH. PMID:24407918

  18. Structural model and spectroscopic characteristics of the FMO antenna protein from the aerobic chlorophototroph, Candidatus Chloracidobacterium thermophilum

    Energy Technology Data Exchange (ETDEWEB)

    Wen, Jianzhong; Tsukatani, Yusuke; Cui, Weidong; Zhang, Hao; Gross, Michael L; Bryant, Donald A; Blankenship, R. E.

    The Fenna–Matthews–Olson protein (FMO) binds seven or eight bacteriochlorophyll a (BChl a) molecules and is an important model antenna system for understanding pigment-protein interactions and mechanistic aspects of photosynthetic light harvesting. FMO proteins of green sulfur bacteria (Chlorobiales) have been extensively studied using a wide range of spectroscopic and theoretical approaches because of their stability, the spectral resolution of their pigments, their water-soluble nature, and the availability of high-resolution structural data. We obtained new structural and spectroscopic insights by studying the FMO protein from the recently discovered, aerobic phototrophic acidobacterium, Candidatus Chloracidobacterium thermophilum. Native C. thermophilum FMO is a trimer according to both analytical gel filtration and native-electrospray mass spectrometry. Furthermore, the mass of intact FMO trimer is consistent with the presence of 21–24 BChl a in each. Homology modeling of the C. thermophilum FMO was performed by using the structure of the FMO protein from Chlorobaculum tepidum as a template. C. thermophilum FMO differs from C. tepidum FMO in two distinct regions: the baseplate, CsmA-binding region and a region that is proposed to bind the reaction center subunit, PscA. C. thermophilum FMO has two fluorescence emission peaks at room temperature but only one at 77 K. Temperature-dependent fluorescence spectroscopy showed that the two room-temperature emission peaks result from two excited-state BChl a populations that have identical fluorescence lifetimes. Modeling of the data suggests that the two populations contain 1–2 BChl and 5–6 BChl a molecules and that thermal equilibrium effects modulate the relative population of the two emitting states.

  19. Assessing the Likelihood of Transmission of Candidatus Liberibacter solanacearum to Carrot by Potato Psyllid, Bactericera cockerelli (Hemiptera: Triozidae).

    Science.gov (United States)

    Munyaneza, Joseph E; Mustafa, Tariq; Fisher, Tonja W; Sengoda, Venkatesan G; Horton, David R

    2016-01-01

    'Candidatus Liberibacter solanacearum' (Lso) is a phloem-limited bacterium that severely affects important Solanaceae and Apiaceae crops, including potato, tomato, pepper, tobacco, carrot and celery. This bacterium is transmitted to solanaceous species by potato psyllid, Bactericera cockerelli, and to Apiaceae by carrot psyllids, including Trioza apicalis and Bactericera trigonica. Five haplotypes of Lso have so far been described, two are associated with solanaceous species and potato psyllids, whereas the other three are associated with carrot and celery crops and carrot psyllids. Little is known about cross-transmission of Lso to carrot by potato psyllids or to potato by carrot psyllids. Thus, the present study assessed whether potato psyllid can transmit Lso to carrot and whether Lso haplotypes infecting solanaceous species can also infect carrot and lead to disease symptom development. In addition, the stylet probing behavior of potato psyllid on carrot was assessed using electropenetrography (EPG) technology to further elucidate potential Lso transmission to Apiaceae by this potato insect pest. Results showed that, while potato psyllids survived on carrot for several weeks when confined on the plants under controlled laboratory and field conditions, the insects generally failed to infect carrot plants with Lso. Only three of the 200 carrot plants assayed became infected with Lso and developed characteristic disease symptoms. Lso infection in the symptomatic carrot plants was confirmed by polymerase chain reaction assay and Lso in the carrots was determined to be of the haplotype B, which is associated with solanaceous species. EPG results further revealed that potato psyllids readily feed on carrot xylem but rarely probe into the phloem tissue, explaining why little to no Lso infection occurred during the controlled laboratory and field cage transmission trials. Results of our laboratory and field transmission studies, combined with our EPG results, suggest

  20. The Black Queen Hypothesis: Evolution of Dependencies through Adaptive Gene Loss

    OpenAIRE

    Morris, J. Jeffrey; Lenski, Richard E.; Zinser, Erik R

    2012-01-01

    ABSTRACT Reductive genomic evolution, driven by genetic drift, is common in endosymbiotic bacteria. Genome reduction is less common in free-living organisms, but it has occurred in the numerically dominant open-ocean bacterioplankton Prochlorococcus and “Candidatus Pelagibacter,” and in these cases the reduction appears to be driven by natural selection rather than drift. Gene loss in free-living organisms may leave them dependent on cooccurring microbes for lost metabolic functions. We prese...

  1. Dicty_cDB: VHK823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kpelfgi*lkrn*ffhf*i*klkpmi* elsivikpmiklqsmqpmqlxd*klvlnvqqlhqtkhvsqsld*rxcgnhqmvpfvihwv ahylxsqlfvxmsh...vwspvginl*llvvmhlvtnteplis**relasws*pthqptavhh knskslts--- ---dttavsktfskrstkestklnstlpvfgms...hs*yigw hiixrancl*xcptfghlle*iysywssciw*piqsh*frskgswqvgvnlhtsrrqctt kipsl*l--- -...datus Pelagibacter ubique H... 234 4e-60 protein update 2009. 7.15 PSORT psg: 0.74 gvh: 0.35 alm: 0.44 top: 0.53 tms

  2. 'Candidatus Adiutrix intracellularis', an endosymbiont of termite gut flagellates, is the first representative of a deep-branching clade of Deltaproteobacteria and a putative homoacetogen.

    Science.gov (United States)

    Ikeda-Ohtsubo, Wakako; Strassert, Jürgen F H; Köhler, Tim; Mikaelyan, Aram; Gregor, Ivan; McHardy, Alice C; Tringe, Susannah Green; Hugenholtz, Phil; Radek, Renate; Brune, Andreas

    2016-09-01

    Termite gut flagellates are typically colonized by specific bacterial symbionts. Here we describe the phylogeny, ultrastructure and subcellular location of 'Candidatus Adiutrix intracellularis', an intracellular symbiont of Trichonympha collaris in the termite Zootermopsis nevadensis. It represents a novel, deep-branching clade of uncultured Deltaproteobacteria widely distributed in intestinal tracts of termites and cockroaches. Fluorescence in situ hybridization and transmission electron microscopy localized the endosymbiont near hydrogenosomes in the posterior part and near the ectosymbiont 'Candidatus Desulfovibrio trichonymphae' in the anterior part of the host cell. The draft genome of 'Ca. Adiutrix intracellularis' obtained from a metagenomic library revealed the presence of a complete gene set encoding the Wood-Ljungdahl pathway, including two homologs of fdhF encoding hydrogenase-linked formate dehydrogenases (FDHH ) and all other components of the recently described hydrogen-dependent carbon dioxide reductase (HDCR) complex, which substantiates previous claims that the symbiont is capable of reductive acetogenesis from CO2 and H2 . The close phylogenetic relationship between the HDCR components and their homologs in homoacetogenic Firmicutes and Spirochaetes suggests that the deltaproteobacterium acquired the capacity for homoacetogenesis via lateral gene transfer. The presence of genes for nitrogen fixation and the biosynthesis of amino acids and cofactors indicate the nutritional nature of the symbiosis. PMID:26914459

  3. Predominance of Single Prophage Carrying a CRISPR/cas System in “Candidatus Liberibacter asiaticus” Strains in Southern China

    Science.gov (United States)

    Zheng, Zheng; Bao, Minli; Wu, Fengnian; Chen, Jianchi; Deng, Xiaoling

    2016-01-01

    Candidatus Liberibacter asiaticus” (CLas) is an uncultureable α-proteobacterium associated with citrus Huanglongbing (HLB, yellow shoot disease), a highly destructive disease affecting citrus production worldwide. HLB was observed in Guangdong Province of China over a hundred years ago and remains endemic there. Little is known about CLas biology due to its uncultureable nature. This study began with the genome sequence analysis of CLas Strain A4 from Guangdong in the prophage region. Within the two currently known prophage types, Type 1 (SC1-like) and Type 2 (SC2-like), A4 genome contained only a Type 2 prophage, CGdP2, namely. An analysis on CLas strains collected in Guangdong showed that Type 2 prophage dominated the bacterial population (82.6%, 71/86). An extended survey covering five provinces in southern China also revealed the predominance of single prophage (Type 1 or Type 2) in the CLas population (90.4%, 169/187). CLas strains with two and no prophage types accounted for 7.2% and 2.8%, respectively. In silico analyses on CGdP2 identified a CRISPR (clustered regularly interspaced short palindromic repeats)/cas (CRISPR-associated protein genes) system, consisting of four 22 bp repeats, three 23 bp spacers and 9 predicted cas. Similar CRISPR/cas systems were detected in all 10 published CLas prophages as well as 13 CLas field strains in southern China. Both Type 1 and Type 2 prophages shared almost identical sequences in spacer 1 and 3 but not spacer 2. Considering that the function of a CRISPR/cas system was to destroy invading DNA, it was hypothesized that a pre-established CLas prophage could use its CRISPR/cas system guided by spacer 1 and/or 3 to defeat the invasion of the other phage/prophage. This hypothesis explained the predominance of single prophage type in the CLas population in southern China. This is the first report of CRISPR/cas system in the “Ca. Liberibacter” genera. PMID:26741827

  4. Comparative Transcriptome and iTRAQ Proteome Analyses of Citrus Root Responses to Candidatus Liberibacter asiaticus Infection.

    Directory of Open Access Journals (Sweden)

    Yun Zhong

    Full Text Available Root samples of 'Sanhu' red tangerine trees infected with and without Candidatus Liberibacter asiaticus (CLas were collected at 50 days post inoculation and subjected to RNA-sequencing and isobaric tags for relative and absolute quantification (iTRAQ to profile the differentially expressed genes (DEGs and proteins (DEPs, respectively. Quantitative real-time PCR was subsequently used to confirm the expression of 16 selected DEGs. Results showed that a total of 3956 genes and 78 proteins were differentially regulated by HLB-infection. Among the most highly up-regulated DEPs were sperm specific protein 411, copper ion binding protein, germin-like proteins, subtilisin-like proteins and serine carboxypeptidase-like 40 proteins whose transcript levels were concomitantly up-regulated as shown by RNA-seq data. Comparison between our results and those of the previously reported showed that known HLB-modulated biological pathways including cell-wall modification, protease-involved protein degradation, carbohydrate metabolism, hormone synthesis and signaling, transcription activities, and stress responses were similarly regulated by HLB infection but different or root-specific changes did exist. The root unique changes included the down-regulation in genes of ubiquitin-dependent protein degradation pathway, secondary metabolism, cytochrome P450s, UDP-glucosyl transferases and pentatricopeptide repeat containing proteins. Notably, nutrient absorption was impaired by HLB-infection as the expression of the genes involved in Fe, Zn, N and P adsorption and transportation were significantly changed. HLB-infection induced some cellular defense responses but simultaneously reduced the biosynthesis of the three major classes of secondary metabolites, many of which are known to have anti-pathogen activities. Genes involved in callose deposition were up-regulated whereas those involved in callose degradation were also up-regulated, indicating that the sieve tube

  5. Predominance of Single Prophage Carrying a CRISPR/cas System in "Candidatus Liberibacter asiaticus" Strains in Southern China.

    Directory of Open Access Journals (Sweden)

    Zheng Zheng

    Full Text Available "Candidatus Liberibacter asiaticus" (CLas is an uncultureable α-proteobacterium associated with citrus Huanglongbing (HLB, yellow shoot disease, a highly destructive disease affecting citrus production worldwide. HLB was observed in Guangdong Province of China over a hundred years ago and remains endemic there. Little is known about CLas biology due to its uncultureable nature. This study began with the genome sequence analysis of CLas Strain A4 from Guangdong in the prophage region. Within the two currently known prophage types, Type 1 (SC1-like and Type 2 (SC2-like, A4 genome contained only a Type 2 prophage, CGdP2, namely. An analysis on CLas strains collected in Guangdong showed that Type 2 prophage dominated the bacterial population (82.6%, 71/86. An extended survey covering five provinces in southern China also revealed the predominance of single prophage (Type 1 or Type 2 in the CLas population (90.4%, 169/187. CLas strains with two and no prophage types accounted for 7.2% and 2.8%, respectively. In silico analyses on CGdP2 identified a CRISPR (clustered regularly interspaced short palindromic repeats/cas (CRISPR-associated protein genes system, consisting of four 22 bp repeats, three 23 bp spacers and 9 predicted cas. Similar CRISPR/cas systems were detected in all 10 published CLas prophages as well as 13 CLas field strains in southern China. Both Type 1 and Type 2 prophages shared almost identical sequences in spacer 1 and 3 but not spacer 2. Considering that the function of a CRISPR/cas system was to destroy invading DNA, it was hypothesized that a pre-established CLas prophage could use its CRISPR/cas system guided by spacer 1 and/or 3 to defeat the invasion of the other phage/prophage. This hypothesis explained the predominance of single prophage type in the CLas population in southern China. This is the first report of CRISPR/cas system in the "Ca. Liberibacter" genera.

  6. Predominance of Single Prophage Carrying a CRISPR/cas System in "Candidatus Liberibacter asiaticus" Strains in Southern China.

    Science.gov (United States)

    Zheng, Zheng; Bao, Minli; Wu, Fengnian; Chen, Jianchi; Deng, Xiaoling

    2016-01-01

    "Candidatus Liberibacter asiaticus" (CLas) is an uncultureable α-proteobacterium associated with citrus Huanglongbing (HLB, yellow shoot disease), a highly destructive disease affecting citrus production worldwide. HLB was observed in Guangdong Province of China over a hundred years ago and remains endemic there. Little is known about CLas biology due to its uncultureable nature. This study began with the genome sequence analysis of CLas Strain A4 from Guangdong in the prophage region. Within the two currently known prophage types, Type 1 (SC1-like) and Type 2 (SC2-like), A4 genome contained only a Type 2 prophage, CGdP2, namely. An analysis on CLas strains collected in Guangdong showed that Type 2 prophage dominated the bacterial population (82.6%, 71/86). An extended survey covering five provinces in southern China also revealed the predominance of single prophage (Type 1 or Type 2) in the CLas population (90.4%, 169/187). CLas strains with two and no prophage types accounted for 7.2% and 2.8%, respectively. In silico analyses on CGdP2 identified a CRISPR (clustered regularly interspaced short palindromic repeats)/cas (CRISPR-associated protein genes) system, consisting of four 22 bp repeats, three 23 bp spacers and 9 predicted cas. Similar CRISPR/cas systems were detected in all 10 published CLas prophages as well as 13 CLas field strains in southern China. Both Type 1 and Type 2 prophages shared almost identical sequences in spacer 1 and 3 but not spacer 2. Considering that the function of a CRISPR/cas system was to destroy invading DNA, it was hypothesized that a pre-established CLas prophage could use its CRISPR/cas system guided by spacer 1 and/or 3 to defeat the invasion of the other phage/prophage. This hypothesis explained the predominance of single prophage type in the CLas population in southern China. This is the first report of CRISPR/cas system in the "Ca. Liberibacter" genera. PMID:26741827

  7. The ubiquity of consciousness: The ubiquity of consciousness, cognition and intelligence in life

    OpenAIRE

    Trewavas, Anthony J; Baluška, František

    2011-01-01

    Our definitions of consciousness and intelligence are largely anthropocentric, potentially skewing research. In fact, consciousness in its many forms could well be ubiquitous, even down to the simplest of organisms.

  8. Screening molecules for control of citrus huanglongbing using an optimized regeneration system for 'Candidatus Liberibacter asiaticus'-infected periwinkle (Catharanthus roseus) cuttings.

    Science.gov (United States)

    Zhang, Muqing; Duan, Yongping; Zhou, Lijuan; Turechek, William W; Stover, Ed; Powell, Charles A

    2010-03-01

    Citrus huanglongbing is one of the most destructive diseases of citrus worldwide. The disease is associated with three different species of 'Candidatus Liberibacter', of which 'Ca. L. asiaticus' is the most widely distributed. An optimized system using 'Ca. L. asiaticus'-infected periwinkle cuttings was developed to screen chemical compounds effective for controlling the bacterial population while simultaneously assessing their phytotoxicity. The optimal regeneration conditions were determined to be the use of vermiculite as a growth medium for the cuttings, and a fertilization routine using half-strength Murashige and Tucker medium supplemented with both naphthalene acetic acid (4 microg/ml) and indole-3-butyric acid (4 microg/ml). This system allowed a plant regeneration rate of 60.6% for 'Ca. L. asiaticus'-infected cuttings in contrast to the DBNPA), were found to be effective at eliminating or suppressing the 'Ca. L. asiaticus' bacterium in this periwinkle regeneration system. When treated with penicillin G sodium at 50 microg/ml, all plants regenerated from 'Ca. L. asiaticus'-infected cuttings were 'Ca. L. asiaticus' negative as determined by both nested polymerase chain reaction (PCR) and quantitative real-time PCR. In addition, DBNPA was also able to significantly reduce the percentage of 'Ca. L. asiaticus'-positive plants and the titer of the 'Ca. L. asiaticus' bacterium at 200 microl/liter. PMID:20128697

  9. Detection of citrus huanglongbing-associated 'Candidatus Liberibacter asiaticus' in citrus and Diaphorina citri in Pakistan, seasonal variability, and implications for disease management.

    Science.gov (United States)

    Razi, Muhammad F; Keremane, Manjunath L; Ramadugu, Chandrika; Roose, Mikeal; Khan, Iqrar A; Lee, Richard F

    2014-03-01

    We report the detection of the huanglongbing (HLB)-associated bacterium 'Candidatus Liberibacter asiaticus' from both plants and insects in Pakistan and the seasonal variability in the numbers of 'Ca. L. asiaticus'-positive psyllid vector, Diaphorina citri. Our studies showed that 'Ca. L. asiaticus' was detectable from trees in areas with maximum temperatures reaching nearly 50°C (average maximum of 42°C). However, the bacterium was present at very low levels in psyllids both in summer (June to August) and autumn (September to November) in contrast to reports from Florida, where the bacterium was detectable at very high levels during October to November. We hypothesize that hot summer temperatures in Pakistan may interfere with acquisition and replication of 'Ca. L. asiaticus' in psyllids and may lead to dead or non transmissible 'Ca. L. asiaticus' in plants. Psyllid counts were very low in both summer and winter, showed a population peak ('Ca. L. asiaticus'-positive vectors) in spring, and showed a larger peak ('Ca. L. asiaticus'-free psyllids) in autumn. Natural thermotherapy during hot summers and a low vector population during environmental extremes may have played a major role in long-term survival of the citrus industry in Pakistan. These results may be useful in developing management strategies for U.S. citrus industries in Texas and California. PMID:24134720

  10. A Rapid Protocol of Crude RNA/DNA Extraction for RT-qPCR Detection and Quantification of 'Candidatus Phytoplasma prunorum'.

    Directory of Open Access Journals (Sweden)

    Stefano Minguzzi

    Full Text Available Many efforts have been made to develop a rapid and sensitive method for phytoplasma and virus detection. Taking our cue from previous works, different rapid sample preparation methods have been tested and applied to Candidatus Phytoplasma prunorum ('Ca. P. prunorum' detection by RT-qPCR. A duplex RT-qPCR has been optimized using the crude sap as a template to simultaneously amplify a fragment of 16S rRNA of the pathogen and 18S rRNA of the host plant. The specific plant 18S rRNA internal control allows comparison and relative quantification of samples. A comparison between DNA and RNA contribution to qPCR detection is provided, showing higher contribution of the latter. The method presented here has been validated on more than a hundred samples of apricot, plum and peach trees. Since 2013, this method has been successfully applied to monitor 'Ca. P. prunorum' infections in field and nursery. A triplex RT-qPCR assay has also been optimized to simultaneously detect 'Ca. P. prunorum' and Plum pox virus (PPV in Prunus.

  11. A Rapid Protocol of Crude RNA/DNA Extraction for RT-qPCR Detection and Quantification of 'Candidatus Phytoplasma prunorum'.

    Science.gov (United States)

    Minguzzi, Stefano; Terlizzi, Federica; Lanzoni, Chiara; Poggi Pollini, Carlo; Ratti, Claudio

    2016-01-01

    Many efforts have been made to develop a rapid and sensitive method for phytoplasma and virus detection. Taking our cue from previous works, different rapid sample preparation methods have been tested and applied to Candidatus Phytoplasma prunorum ('Ca. P. prunorum') detection by RT-qPCR. A duplex RT-qPCR has been optimized using the crude sap as a template to simultaneously amplify a fragment of 16S rRNA of the pathogen and 18S rRNA of the host plant. The specific plant 18S rRNA internal control allows comparison and relative quantification of samples. A comparison between DNA and RNA contribution to qPCR detection is provided, showing higher contribution of the latter. The method presented here has been validated on more than a hundred samples of apricot, plum and peach trees. Since 2013, this method has been successfully applied to monitor 'Ca. P. prunorum' infections in field and nursery. A triplex RT-qPCR assay has also been optimized to simultaneously detect 'Ca. P. prunorum' and Plum pox virus (PPV) in Prunus. PMID:26742106

  12. Serological detection of 'Candidatus Liberibacter asiaticus' in citrus, and identification by GeLC-MS/MS of a chaperone protein responding to cellular pathogens.

    Science.gov (United States)

    Ding, Fang; Duan, Yongping; Yuan, Qing; Shao, Jonathan; Hartung, John S

    2016-01-01

    We describe experiments with antibodies against 'Candidatus Liberibacter asiaticus used to detect the pathogen in infected plants. We used scFv selected to bind epitopes exposed on the surface of the bacterium in tissue prints, with secondary monoclonal antibodies directed at a FLAG epitope included at the carboxyl end of the scFv. Unexpectedly, the anti-FLAG secondary antibody produced positive results with CaLas diseased samples when the primary scFv were not used. The anti-FLAG monoclonal antibody (Mab) also identified plants infected with other vascular pathogens. We then identified a paralogous group of secreted chaperone proteins in the HSP-90 family that contained the amino acid sequence DDDDK identical to the carboxy-terminal sequence of the FLAG epitope. A rabbit polyclonal antibody against one of the same epitopes combined with a goat anti-rabbit secondary antibody produced very strong purple color in individual phloem cells, as expected for this pathogen. These results were entirely specific for CaLas-infected citrus. The simplicity, cost and ability to scale the tissue print assay makes this an attractive assay to complement PCR-based assays currently in use. The partial FLAG epitope may itself be useful as a molecular marker for the rapid screening of citrus plants for the presence of vascular pathogens. PMID:27381064

  13. High genetic variation and recombination events in the vicinity of non-autonomous transposable elements from ‘Candidatus Liberibacter asiaticus’

    Institute of Scientific and Technical Information of China (English)

    WANG Xue-feng; CHEN Jiao-yue; TAN Jin; DUAN Suo; DENG Xiao-ling; CHEN Jian-chi; ZHOU Chang-yong

    2015-01-01

    Two miniature inverted-repeat transposable elements (MITEs), MCLas-A and MCLas-B, were recently identiifed from ‘Candidatus Liberibacter asiaticus’ known to be associated with citrus Huanglongbing (HLB, yelow shoot disease). MCLas-A was suggested as an active MITE because of its mobility. The immediate upstream gene of the two MITEs was predicted to be a putative transposase. The goal of this study is to analyze the sequence variation in the upstream putative transposase of MITEs and explore the possible correlation between sequence variation of transposase gene and MITE activity. PCR and sequence analysis showed that 12 sequence types were found in six major amplicon types from 43 representative ‘Ca. L. asiaticus’ isolates from China, the United States and Brazil. Out of the 12 sequence types, three (T4, T5-2, T6) were reported for the ifrst time. Recombination events were found in the two unique sequence types (T5-2 and T6) which were detected in al Brazilian isolates. Notably, no sequence variation or recombination events were detected in the upstream putative transposase gene of MCLas-A, suggesting the conservation of the transposase gene might be closely related with the MITE activity. Phylogenetic analysis demonstrated two wel supported clades including ifve subclades were identiifed, clearly relfecting the geographical origins of isolates, especialy that of Ruili isolates, São Paulo isolates and a few Florida isolates.

  14. Localization and Distribution of 'Candidatus Liberibacter asiaticus' in Citrus and Periwinkle by Direct Tissue Blot Immuno Assay with an Anti-OmpA Polyclonal Antibody.

    Science.gov (United States)

    Ding, Fang; Duan, Yongping; Paul, Cristina; Brlansky, Ronald H; Hartung, John S

    2015-01-01

    'Candidatus Liberibacter asiaticus' (CaLas), a non-cultured member of the α-proteobacteria, is the causal agent of citrus Huanglongbing (HLB). Due to the difficulties of in vitro culture, antibodies against CaLas have not been widely used in studies of this pathogen. We have used an anti-OmpA polyclonal antibody based direct tissue blot immunoassay to localize CaLas in different citrus tissues and in periwinkle leaves. In citrus petioles, CaLas was unevenly distributed in the phloem sieve tubes, and tended to colonize in phloem sieve tubes on the underside of petioles in preference to the upper side of petioles. Both the leaf abscission zone and the junction of the petiole and leaf midrib had fewer CaLas bacteria compared to the main portions of the petiole and the midribs. Colonies of CaLas in phloem sieve tubes were more frequently found in stems with symptomatic leaves than in stems with asymptomatic leaves with an uneven distribution pattern. In serial sections taken from the receptacle to the peduncle, more CaLas were observed in the peduncle sections adjacent to the stem. In seed, CaLas was located in the seed coat. Many fewer CaLas were found in the roots, as compared to the seeds and petioles when samples were collected from trees with obvious foliar symptoms. The direct tissue blot immuno assay was adapted to whole periwinkle leaves infected by CaLas. The pathogen was distributed throughout the lateral veins and the results were correlated with results of qPCR. Our data provide direct spatial and anatomical information for CaLas in planta. This simple and scalable method may facilitate the future research on the interaction of CaLas and host plant. PMID:25946013

  15. Localization and Distribution of 'Candidatus Liberibacter asiaticus’ in Citrus and Periwinkle by Direct Tissue Blot Immuno Assay with an Anti-OmpA Polyclonal Antibody

    Science.gov (United States)

    Ding, Fang; Duan, Yongping; Paul, Cristina; Brlansky, Ronald H.; Hartung, John S.

    2015-01-01

    Candidatus Liberibacter asiaticus’ (CaLas), a non-cultured member of the α-proteobacteria, is the causal agent of citrus Huanglongbing (HLB). Due to the difficulties of in vitro culture, antibodies against CaLas have not been widely used in studies of this pathogen. We have used an anti-OmpA polyclonal antibody based direct tissue blot immunoassay to localize CaLas in different citrus tissues and in periwinkle leaves. In citrus petioles, CaLas was unevenly distributed in the phloem sieve tubes, and tended to colonize in phloem sieve tubes on the underside of petioles in preference to the upper side of petioles. Both the leaf abscission zone and the junction of the petiole and leaf midrib had fewer CaLas bacteria compared to the main portions of the petiole and the midribs. Colonies of CaLas in phloem sieve tubes were more frequently found in stems with symptomatic leaves than in stems with asymptomatic leaves with an uneven distribution pattern. In serial sections taken from the receptacle to the peduncle, more CaLas were observed in the peduncle sections adjacent to the stem. In seed, CaLas was located in the seed coat. Many fewer CaLas were found in the roots, as compared to the seeds and petioles when samples were collected from trees with obvious foliar symptoms. The direct tissue blot immuno assay was adapted to whole periwinkle leaves infected by CaLas. The pathogen was distributed throughout the lateral veins and the results were correlated with results of qPCR. Our data provide direct spatial and anatomical information for CaLas in planta. This simple and scalable method may facilitate the future research on the interaction of CaLas and host plant. PMID:25946013

  16. Transcriptome comparison and gene coexpression network analysis provide a systems view of citrus response to ‘Candidatus Liberibacter asiaticus’ infection

    Directory of Open Access Journals (Sweden)

    Zheng Zhi-Liang

    2013-01-01

    Full Text Available Abstract Background Huanglongbing (HLB is arguably the most destructive disease for the citrus industry. HLB is caused by infection of the bacterium, Candidatus Liberibacter spp. Several citrus GeneChip studies have revealed thousands of genes that are up- or down-regulated by infection with Ca. Liberibacter asiaticus. However, whether and how these host genes act to protect against HLB remains poorly understood. Results As a first step towards a mechanistic view of citrus in response to the HLB bacterial infection, we performed a comparative transcriptome analysis and found that a total of 21 Probesets are commonly up-regulated by the HLB bacterial infection. In addition, a number of genes are likely regulated specifically at early, late or very late stages of the infection. Furthermore, using Pearson correlation coefficient-based gene coexpression analysis, we constructed a citrus HLB response network consisting of 3,507 Probesets and 56,287 interactions. Genes involved in carbohydrate and nitrogen metabolic processes, transport, defense, signaling and hormone response were overrepresented in the HLB response network and the subnetworks for these processes were constructed. Analysis of the defense and hormone response subnetworks indicates that hormone response is interconnected with defense response. In addition, mapping the commonly up-regulated HLB responsive genes into the HLB response network resulted in a core subnetwork where transport plays a key role in the citrus response to the HLB bacterial infection. Moreover, analysis of a phloem protein subnetwork indicates a role for this protein and zinc transporters or zinc-binding proteins in the citrus HLB defense response. Conclusion Through integrating transcriptome comparison and gene coexpression network analysis, we have provided for the first time a systems view of citrus in response to the Ca. Liberibacter spp. infection causing HLB.

  17. Effect of Cyantraniliprole, a Novel Insecticide, on the Inoculation of Candidatus Liberibacter Asiaticus Associated with Citrus Huanglongbing by the Asian Citrus Psyllid (Hemiptera: Liviidae).

    Science.gov (United States)

    Ammar, El-Desouky; Hall, David G; Alvarez, Juan M

    2015-04-01

    The Asian citrus psyllid (Diaphorina citri Kuwayama) is the principal vector of 'Candidatus Liberibacter asiaticus' (CLas) associated with huanglongbing (HLB), the most serious citrus disease worldwide. New control measures including pesticides are urgently needed to combat HLB, especially to protect young or newly planted citrus trees from CLas-inoculation by vector psyllids. Here, we tested CLas-inoculation by D. citri adults (CLas-exposed, reared on infected plants) by feeding them for 7 d on excised healthy citrus leaves with dry residues of cyantraniliprole (Exirel), a novel insecticide, in comparison with fenpropathrin (Danitol 2.4EC), an insecticide commonly used against D. citri. Fewer adults settled (putatively feeding or probing) on leaves treated with cyantraniliprole than those treated with fenpropathrin or water controls. Also, psyllid adults died at a slower rate on leaves treated with cyantraniliprole than those treated with fenpropathrin, although the final cumulative mortality did not differ between the two treatments. In quantitative real-time polymerase chain reaction tests, 59.0-65.3% of the CLas-exposed psyllid adults were proven to be CLas-positive. Inoculation rates of CLas (using 10 adults per leaf) into untreated healthy citrus leaves (47.5-85%) were significantly higher than rates into leaves treated with cyantraniliprole or fenpropathrin (2.5-12.5%). Reduced inoculation rates to leaves treated with cyantraniliprole probably occurred as a result of reduced feeding or probing by D. citri. The excised leaf assay method, which took only a few weeks compared with up to a year or longer using whole plants, can be an effective tool for testing the effect of new pesticides or other treatments in reducing CLas inoculation or transmission by psyllid vectors. PMID:26470150

  18. An HPLC-MS characterization of the changes in sweet orange leaf metabolite profile following infection by the bacterial pathogen Candidatus Liberibacter asiaticus.

    Directory of Open Access Journals (Sweden)

    Faraj M Hijaz

    Full Text Available Huanglongbing (HLB presumably caused by Candidatus Liberibacter asiaticus (CLas threatens the commercial U.S. citrus crop of an annual value of $3 billion. The earliest shift in metabolite profiles of leaves from greenhouse-grown sweet orange trees infected with Clas, and of healthy leaves, was characterized by HPLC-MS concurrently with PCR testing for the presence of Clas bacteria and observation of disease symptoms. Twenty, 8-month-old 'Valencia' and 'Hamlin' trees were grafted with budwood from PCR-positive HLB source trees. Five graft-inoculated trees of each variety and three control trees were sampled biweekly and analyzed by HPLC-MS and PCR. Thirteen weeks after inoculation, Clas was detected in newly growing flushes in 33% and 55% of the inoculated 'Hamlin' and 'Valencia' trees, respectively. Inoculated trees remained asymptomatic in the first 20 weeks, but developed symptoms 30 weeks after grafting. No significant differences in the leaf metabolite profiles were detected in Clas-infected trees 23 weeks after inoculation. However, 27 weeks after inoculation, differences in metabolite profiles between control leaves and those of Clas-infected trees were evident. Affected compounds were identified with authentic standards or structurally classified by their UV and mass spectra. Included among these compounds are flavonoid glycosides, polymethoxylated flavones, and hydroxycinnamates. Four structurally related hydroxycinnamate compounds increased more than 10-fold in leaves from 'Hamlin' and 'Valencia' sweet orange trees in response to Clas infection. Possible roles of these hydroxycinnamates as plant defense compounds against the Clas infection are discussed.

  19. Localization and Distribution of 'Candidatus Liberibacter asiaticus' in Citrus and Periwinkle by Direct Tissue Blot Immuno Assay with an Anti-OmpA Polyclonal Antibody.

    Directory of Open Access Journals (Sweden)

    Fang Ding

    Full Text Available 'Candidatus Liberibacter asiaticus' (CaLas, a non-cultured member of the α-proteobacteria, is the causal agent of citrus Huanglongbing (HLB. Due to the difficulties of in vitro culture, antibodies against CaLas have not been widely used in studies of this pathogen. We have used an anti-OmpA polyclonal antibody based direct tissue blot immunoassay to localize CaLas in different citrus tissues and in periwinkle leaves. In citrus petioles, CaLas was unevenly distributed in the phloem sieve tubes, and tended to colonize in phloem sieve tubes on the underside of petioles in preference to the upper side of petioles. Both the leaf abscission zone and the junction of the petiole and leaf midrib had fewer CaLas bacteria compared to the main portions of the petiole and the midribs. Colonies of CaLas in phloem sieve tubes were more frequently found in stems with symptomatic leaves than in stems with asymptomatic leaves with an uneven distribution pattern. In serial sections taken from the receptacle to the peduncle, more CaLas were observed in the peduncle sections adjacent to the stem. In seed, CaLas was located in the seed coat. Many fewer CaLas were found in the roots, as compared to the seeds and petioles when samples were collected from trees with obvious foliar symptoms. The direct tissue blot immuno assay was adapted to whole periwinkle leaves infected by CaLas. The pathogen was distributed throughout the lateral veins and the results were correlated with results of qPCR. Our data provide direct spatial and anatomical information for CaLas in planta. This simple and scalable method may facilitate the future research on the interaction of CaLas and host plant.

  20. The phloem-sap feeding mealybug (Ferrisia virgata carries 'Candidatus Liberibacter asiaticus' populations that do not cause disease in host plants.

    Directory of Open Access Journals (Sweden)

    Marco Pitino

    Full Text Available 'Candidatus Liberibacter asiaticus' (Las is the primary causal agent of huanglongbing (HLB, the most devastating disease of citrus worldwide. There are three known insect vectors of the HLB-associated bacteria, and all are members of the Hemiptera: Diaphorina citri (Psyllidae, Trioza erytreae (Triozidae, and Cacopsylla (Psylla citrisuga (Psyllidae. In this study, we found that another hemipteran, the striped mealybug Ferrisia virgata (Cockerell (Hemiptera: Pseudococcidae, was able to acquire and retain Las bacteria. The bacterial titers were positively correlated with the feeding acquisition time on Las-infected leaf discs, with a two-weeks feeding period resulting in Ct values ranging from 23.1 to 36.1 (8.24 × 10(7 to 1.07 × 10(4 Las cells per mealybug. We further discovered that the prophage/phage populations of Las in the mealybugs were different from those of Las in psyllids based on Las prophage-specific molecular markers: infected psyllids harbored the Las populations with prophage/phage FP1 and FP2, while infected mealybugs carried the Las populations with the iFP3 being the dominant prophage/phage. As in the psyllids, Las bacteria were shown to move through the insect gut wall to the salivary glands after being ingested by the mealybug based on a time-course quantitative polymerase chain reaction (qPCR assay of the dissected digestive systems. However, Las populations transmitted by the mealybugs did not cause disease in host plants. This is the first evidence of genetic difference among Las populations harbored by different insect vectors and difference among Las populations with respect to whether or not they cause disease in host plants.

  1. The effect of ‘Candidatus Liberibacter asiaticus’ infection on the proteomic profiles and nutritional status of pre-symptomatic and symptomatic grapefruit (Citrus paradisi) plants

    Science.gov (United States)

    2013-01-01

    Background Huanglongbing (HLB) is a highly destructive citrus disease which threatens citrus production worldwide and ‘Candidatus Liberibacter asiaticus’ (Las), a non-culturable phloem-limited bacterium, is an associated causal agent of the disease. To better understand the physiological and molecular processes involved in host responses to Las, 2-DE and mass spectrometry analyses, as well as ICP spectroscopy analysis were employed to elucidate the global protein expression profiles and nutrient concentrations in leaves of Las-infected grapefruit plants at pre-symptomatic or symptomatic stages for HLB. Results This study identified 123 protein spots out of 191 spots that showed significant changes in the leaves of grapefruit plants in response to Las infection and all identified spots matched to 69 unique proteins/peptides. A down-regulation of 56 proteins including those associated with photosynthesis, protein synthesis, and metabolism was correlated with significant reductions in the concentrations of Ca, Mg, Fe, Zn, Mn, and Cu in leaves of grapefruit plants in response to Las infection, particularly in symptomatic plants. Oxygen-evolving enhancer (OEE) proteins, a PSI 9 kDa protein, and a Btf3-like protein were among a small group of proteins that were down-regulated in both pre-symptomatic and symptomatic plants in response to Las infection. Furthermore, a Las-mediated up-regulation of 13 grapefruit proteins was detected, which included Cu/Zn superoxide dismutase, chitinases, lectin-related proteins, miraculin-like proteins, peroxiredoxins and a CAP 160 protein. Interestingly, a Las-mediated up-regulation of granule-bound starch synthase was correlated with an increase in the K concentrations of pre-symptomatic and symptomatic plants. Conclusions This study constitutes the first attempt to characterize the interrelationships between protein expression and nutritional status of Las-infected pre-symptomatic or symptomatic grapefruit plants and sheds light on

  2. Use of Electrical Penetration Graph Technology to Examine Transmission of 'Candidatus Liberibacter solanacearum' to Potato by Three Haplotypes of Potato Psyllid (Bactericera cockerelli; Hemiptera: Triozidae.

    Directory of Open Access Journals (Sweden)

    Tariq Mustafa

    Full Text Available The potato psyllid, Bactericera cockerelli (Šulc (Hemiptera: Triozidae, is a vector of the phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso, the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern. All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato ("inoculation access period", or IAP to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in

  3. Molecular and physiological properties associated with zebra complex disease in potatoes and its relation with Candidatus Liberibacter contents in psyllid vectors.

    Directory of Open Access Journals (Sweden)

    Veria Y Alvarado

    Full Text Available Zebra complex (ZC disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs, an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc. The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to healthy plants, stems of ZC-plants accumulate starch and more than three-fold total protein, including gene expression regulatory factors (e.g. cyclophilin and tuber storage proteins (e.g., patatins, indicating that ZC-affected stems are reprogrammed to exhibit tuber-like physiological properties. Furthermore, the total phenolic content in ZC potato stems was elevated two-fold, and amounts of polyphenol oxidase enzyme were also high, both serving to explain the ZC-hallmark rapid brown discoloration of air-exposed damaged tissue. Newly developed quantitative and/or conventional PCR demonstrated that the percentage of psyllids in laboratory colonies containing detectable levels of CLs and its titer could fluctuate over time with effects on colony prolificacy, but presumed reproduction-associated primary endosymbiont levels remained stable. Potato plants exposed in the laboratory to psyllid populations with relatively low-CLs content survived while exposure of plants to high-CLs psyllids rapidly culminated in a lethal collapse. In conclusion, we identified plant physiological biomarkers associated with the presence of ZC and/or CLs in the vegetative potato plant tissue and determined that the titer of CLs in the psyllid population directly affects the rate of disease development in plants.

  4. Asian Citrus Psyllid Expression Profiles Suggest Candidatus Liberibacter Asiaticus-Mediated Alteration of Adult Nutrition and Metabolism, and of Nymphal Development and Immunity.

    Directory of Open Access Journals (Sweden)

    Meenal Vyas

    Full Text Available The Asian citrus psyllid (ACP Diaphorina citri Kuwayama (Hemiptera: Psyllidae is the insect vector of the fastidious bacterium Candidatus Liberibacter asiaticus (CLas, the causal agent of citrus greening disease, or Huanglongbing (HLB. The widespread invasiveness of the psyllid vector and HLB in citrus trees worldwide has underscored the need for non-traditional approaches to manage the disease. One tenable solution is through the deployment of RNA interference technology to silence protein-protein interactions essential for ACP-mediated CLas invasion and transmission. To identify psyllid interactor-bacterial effector combinations associated with psyllid-CLas interactions, cDNA libraries were constructed from CLas-infected and CLas-free ACP adults and nymphs, and analyzed for differential expression. Library assemblies comprised 24,039,255 reads and yielded 45,976 consensus contigs. They were annotated (UniProt, classified using Gene Ontology, and subjected to in silico expression analyses using the Transcriptome Computational Workbench (TCW (http://www.sohomoptera.org/ACPPoP/. Functional-biological pathway interpretations were carried out using the Kyoto Encyclopedia of Genes and Genomes databases. Differentially expressed contigs in adults and/or nymphs represented genes and/or metabolic/pathogenesis pathways involved in adhesion, biofilm formation, development-related, immunity, nutrition, stress, and virulence. Notably, contigs involved in gene silencing and transposon-related responses were documented in a psyllid for the first time. This is the first comparative transcriptomic analysis of ACP adults and nymphs infected and uninfected with CLas. The results provide key initial insights into host-parasite interactions involving CLas effectors that contribute to invasion-virulence, and to host nutritional exploitation and immune-related responses that appear to be essential for successful ACP-mediated circulative, propagative CLas

  5. In vivo transmission of 'candidatus Phytoplasma ulmi' by Amplicephalus curtulus (Hemiptera: Cicadellidae) and its effect on ryegrass (Lolium multiflorum cv. tama).

    Science.gov (United States)

    Arismendi, N L; Riegel, R; Carrillo, R

    2014-02-01

    In Chile, phytoplasmas have been reported in sugar beet, grapevine, peony, and Chilean shrubs. 'Candidatus Phytoplasma ulmi' have been detected in plants of Ugni molinae Turczanínow (Myrtaceae) and the leafhopper Amplicephalus curtulus Linnavuori & DeLong. We evaluated the possibility of phytoplasma transmission from native plants to grasses by A. curtulus and the possible effect on the plant hosts. Newly emerged adults were placed in cages with phytoplasma-infected U. molinae for 72 h (acquisition access period). These plants were then replaced by healthy ryegrasses for 20 d (latent period). They were again replaced for other healthy ryegrasses and were place in cages for 14, 7, and 1 d (inoculation access period [IAP]). After IAP, these plants were moved into different insect-free cages for 30 d, after which polymerase chain reaction (PCR) analyses were carried out. Phytoplasma-free insects on ryegrasses were considered as control treatments. Furthermore, plant height and leaf area were recorded for all treatments. After PCR, 46, 60, and 13% of the plants exposed to infected A. curtulus by 14, 7, and 1 d of IAP, respectively, were infected with 'Ca. Phytoplasma ulmi'. Similarly, plants exposed to an IAP of 14, 7, and 1 d with phytoplasma-infected leafhoppers showed a reduction in plant height of 19, 39, and 28% and leaf area of 302, 169, and 55%, respectively, in comparison to those exposed to phytoplasma-free leafhoppers. We showed that A. curtulus has the ability to transmit phytoplasma from U. molinae to ryegrasses, affecting ryegrass plant height and leaf area PMID:24665688

  6. Efecto de antioxidantes y señalizadores en plantas de papa (Solanum tuberosum L. infectadas con Candidatus Liberibacter solanacearum bajo condiciones de invernadero

    Directory of Open Access Journals (Sweden)

    Isidro Humberto Almeyda León

    2014-12-01

    Full Text Available In Mexico, the losses caused by the purple top syndrome in potato range from 30 to 95%. This syndrome has been greatly associated with the bacterium Candidatus Liberibacter solaneacearum, which produces reduction in yield and in crop quality, the tubers have internal browning, which is not desirable either for fresh consumption or for the industry. Present study was conducted to evaluate the efficiency of three products that act as antioxidants and / or signs to reduce damage on potato caused by Ca. L. solanacearum under greenhouse conditions. Plants uninfected and infected with the bacterium, produced in vitro were used. The products evaluated were: dehydroascorbic acid (600 ppm, ascorbic acid (600 ppm and hydrogen peroxide (1 mM, and were applied to infected and uninfected plants twice a week. Infected and uninfected plants without application of antioxidants were used as control treatments. To avoid experimental error in the application of the products evaluated the experimental design was a randomized complete block. A reduction of potato damage by Ca. L solaneacearum was registered, and there were significant differences among treatments in the tubers production. The largest tuber number in treatments that included uninfected plants was obtained in the hydrogen peroxide application, which exceeded a 33 %, 48 % and 59 % to plants treated with dehydroascorbic acid, with ascorbic acid and the controls respectively. Similarly, the largest tuber number in treatments included infected plants was obtained by hydrogen peroxide, and it exceeded a 33 %, 17 % and 67 % to treatments with dehydroascorbic acid, with ascorbic acid and the controls respectively. These results show a potential effect of the products evaluated to protect potato plants against Ca. L. solanacearum, although its function is not to diminish the growth or development of bacteria.

  7. Suppression of aggressive strains of 'Candidatus phytoplasma mali' by mild strains in Catharanthus roseus and Nicotiana occidentalis and indication of similar action in apple trees.

    Science.gov (United States)

    Schneider, Bernd; Sule, Sandor; Jelkmann, Wilhelm; Seemüller, Erich

    2014-05-01

    To study antagonistic interactions of 'Candidatus Phytoplasma mali' strains, graft inoculation of Catharanthus roseus and Nicotiana occidentalis was performed with mild strains 1/93Vin and 1/93Tab as suppressors and three aggressive strains as challengers. Inoculation of the suppressors was carried out in either the cross-protection modus prior to grafting of the challengers or by co-inoculating suppressors and challengers. Monitoring using multiplex real-time polymerase chain reaction assays revealed that, in long-term cross-protection trials with C. roseus, suppressor 1/93Vin was present in all root and randomly collected stem samples over the entire observation period. In contrast, the challengers were never detected in such stem samples and rarely in the roots. Following simultaneous inoculation, the suppressor successively colonized all stem and root regions whereas detection of challenger AT steadily decreased. However, this strain remained detectable in up to 13 and 27% of stem and root samples, respectively. The cross-protection trials with N. occidentalis yielded results similar to that of the cross-protection experiments with C. roseus. Comparison of the symptomatology of infected apple trees with the presence of putatively suppressive strains indicated that suppression of severe strains also occurs in apple. Phylogenetic analysis using a variable fragment of AAA+ ATPase gene AP460 of 'Ca. P. mali' revealed that suppressors 1/93Vin and 1/93Tab, together with several other mild strains maintained in apple, cluster distantly from obviously nonsuppressive strains that were predominantly highly virulent. PMID:24724815

  8. Genome sequence of Candidatus Nitrososphaera evergladensis from group I.1b enriched from Everglades soil reveals novel genomic features of the ammonia-oxidizing archaea.

    Directory of Open Access Journals (Sweden)

    Kateryna V Zhalnina

    Full Text Available The activity of ammonia-oxidizing archaea (AOA leads to the loss of nitrogen from soil, pollution of water sources and elevated emissions of greenhouse gas. To date, eight AOA genomes are available in the public databases, seven are from the group I.1a of the Thaumarchaeota and only one is from the group I.1b, isolated from hot springs. Many soils are dominated by AOA from the group I.1b, but the genomes of soil representatives of this group have not been sequenced and functionally characterized. The lack of knowledge of metabolic pathways of soil AOA presents a critical gap in understanding their role in biogeochemical cycles. Here, we describe the first complete genome of soil archaeon Candidatus Nitrososphaera evergladensis, which has been reconstructed from metagenomic sequencing of a highly enriched culture obtained from an agricultural soil. The AOA enrichment was sequenced with the high throughput next generation sequencing platforms from Pacific Biosciences and Ion Torrent. The de novo assembly of sequences resulted in one 2.95 Mb contig. Annotation of the reconstructed genome revealed many similarities of the basic metabolism with the rest of sequenced AOA. Ca. N. evergladensis belongs to the group I.1b and shares only 40% of whole-genome homology with the closest sequenced relative Ca. N. gargensis. Detailed analysis of the genome revealed coding sequences that were completely absent from the group I.1a. These unique sequences code for proteins involved in control of DNA integrity, transporters, two-component systems and versatile CRISPR defense system. Notably, genomes from the group I.1b have more gene duplications compared to the genomes from the group I.1a. We suggest that the presence of these unique genes and gene duplications may be associated with the environmental versatility of this group.

  9. Asian Citrus Psyllid Expression Profiles Suggest Candidatus Liberibacter Asiaticus-Mediated Alteration of Adult Nutrition and Metabolism, and of Nymphal Development and Immunity.

    Science.gov (United States)

    Vyas, Meenal; Fisher, Tonja W; He, Ruifeng; Nelson, William; Yin, Guohua; Cicero, Joseph M; Willer, Mark; Kim, Ryan; Kramer, Robin; May, Greg A; Crow, John A; Soderlund, Carol A; Gang, David R; Brown, Judith K

    2015-01-01

    The Asian citrus psyllid (ACP) Diaphorina citri Kuwayama (Hemiptera: Psyllidae) is the insect vector of the fastidious bacterium Candidatus Liberibacter asiaticus (CLas), the causal agent of citrus greening disease, or Huanglongbing (HLB). The widespread invasiveness of the psyllid vector and HLB in citrus trees worldwide has underscored the need for non-traditional approaches to manage the disease. One tenable solution is through the deployment of RNA interference technology to silence protein-protein interactions essential for ACP-mediated CLas invasion and transmission. To identify psyllid interactor-bacterial effector combinations associated with psyllid-CLas interactions, cDNA libraries were constructed from CLas-infected and CLas-free ACP adults and nymphs, and analyzed for differential expression. Library assemblies comprised 24,039,255 reads and yielded 45,976 consensus contigs. They were annotated (UniProt), classified using Gene Ontology, and subjected to in silico expression analyses using the Transcriptome Computational Workbench (TCW) (http://www.sohomoptera.org/ACPPoP/). Functional-biological pathway interpretations were carried out using the Kyoto Encyclopedia of Genes and Genomes databases. Differentially expressed contigs in adults and/or nymphs represented genes and/or metabolic/pathogenesis pathways involved in adhesion, biofilm formation, development-related, immunity, nutrition, stress, and virulence. Notably, contigs involved in gene silencing and transposon-related responses were documented in a psyllid for the first time. This is the first comparative transcriptomic analysis of ACP adults and nymphs infected and uninfected with CLas. The results provide key initial insights into host-parasite interactions involving CLas effectors that contribute to invasion-virulence, and to host nutritional exploitation and immune-related responses that appear to be essential for successful ACP-mediated circulative, propagative CLas transmission. PMID

  10. Acquisition, Replication and Inoculation of Candidatus Liberibacter asiaticus following Various Acquisition Periods on Huanglongbing-Infected Citrus by Nymphs and Adults of the Asian Citrus Psyllid.

    Directory of Open Access Journals (Sweden)

    El-Desouky Ammar

    Full Text Available The Asian citrus psyllid, Diaphorina citri (Hemiptera: Liviidae, is the primary vector of Candidatus Liberibacter asiaticus (Las implicated as causative agent of citrus huanglongbing (citrus greening, currently the most serious citrus disease worldwide. Las is transmitted by D. citri in a persistent-circulative manner, but the question of replication of this bacterium in its psyllid vector has not been resolved. Thus, we studied the effects of the acquisition access period (AAP by nymphs and adults of D. citri on Las acquisition, multiplication and inoculation/transmission. D. citri nymphs or adults (previously non-exposed to Las were caged on Las-infected citrus plants for an AAP of 1, 7 or 14 days. These 'Las-exposed' psyllids were then transferred weekly to healthy citrus or orange jasmine plants, and sampled via quantitative polymerase chain reaction (qPCR analysis 1-42 days post-first access to diseased plants (padp; all tested nymphs became adults 7-14 days padp. Our results indicate that following 1 or 7 day AAP as nymphs 49-59% of Las-exposed psyllids became Las-infected (qPCR-positive, whereas only 8-29% of the psyllids were infected following 1-14 day AAP as adults. Q-PCR analysis also indicated that Las titer in the Las-exposed psyllids (relative to that of the psyllid S20 ribosomal protein gene was: 1 significantly higher, and increasing at a faster rate, following Las acquisition as nymphs compared to that following Las acquisition as adults; 2 higher as post-acquisition time of psyllids on healthy plants increased reaching a peak at 14-28 days padp for nymphs and 21-35 days padp for adults, with Las titer decreasing or fluctuating after that; 3 higher with longer AAP on infected plants, especially with acquisition as adults. Our results strongly suggest that Las multiplies in both nymphs and adults of D. citri but attains much higher levels in a shorter period of time post-acquisition when acquired by nymphs than when acquired by

  11. Phylogeny and in situ identification of a morphologically conspicuous bacterium, Candidatus Magnospira bakii, present at very low frequency in activated sludge.

    Science.gov (United States)

    Snaidr, J; Fuchs, B; Wallner, G; Wagner, M; Schleifer, K H; Amann, R

    1999-04-01

    A morphologically conspicuous bacterium that constituted a very small fraction (sludge was enriched and analysed phylogenetically by a combination of cultivation-independent molecular and physical methods. The large, corkscrew-shaped, filamentous bacteria were first detected in municipal activated sludge by light microscopy owing to their unusual rotating gliding motility. Various attempts at microbiological enrichment and pure culture isolation with traditional techniques failed, as did attempts to retrieve the morphotype of interest by micromanipulation. In situ hybridization with the group-specific, rRNA-targeted oligonucleotide probe CF319a indicated a phylogenetic affiliation to the Cytophaga-Flexibacter group of the Cytophaga-Flavobacterium-Bacteroides phylum. Based on strong morphological resemblance to members of the genus Saprospira, additional 16S rRNA-targeted oligonucleotides with more narrow specificity were designed and evaluated for in situ hybridization to the morphotype of interest. Flow cytometric cell sorting based on the fluorescence conferred by probe SGR1425 and forward scatter enabled a physical enrichment of the helical coiled cells. Subsequent polymerase chain reaction (PCR) amplification of 16S rDNA fragments from whole fixed sorted cells with a primer pair based on probes CF319a and SGR1425 resulted in the retrieval of 12 almost identical partial 16S rDNA fragments with sequence similarities among each other of more than 99.2%. In situ hybridizations proved that the sequences that showed the highest similarity (88.4%) to the 16S rRNA of Saprospira grandis were indeed retrieved from the corkscrew-shaped filaments. The bacterium is likely to be a member of a genus of which no species has been cultured hitherto. It was consequently tentatively named 'Magnospira bakii' and has the taxonomic rank of Candidatus Magnospira bakii, as the ultimate taxonomic placement has to await its cultivation. In this study, it was demonstrated that even

  12. Genome sequence of Candidatus Riesia pediculischaeffi, endosymbiont of chimpanzee lice, and genomic comparison of recently acquired endosymbionts from human and chimpanzee lice.

    Science.gov (United States)

    Boyd, Bret M; Allen, Julie M; de Crécy-Lagard, Valérie; Reed, David L

    2014-11-01

    The obligate-heritable endosymbionts of insects possess some of the smallest known bacterial genomes. This is likely due to loss of genomic material during symbiosis. The mode and rate of this erosion may change over evolutionary time: faster in newly formed associations and slower in long-established ones. The endosymbionts of human and anthropoid primate lice present a unique opportunity to study genome erosion in newly established (or young) symbionts. This is because we have a detailed phylogenetic history of these endosymbionts with divergence dates for closely related species. This allows for genome evolution to be studied in detail and rates of change to be estimated in a phylogenetic framework. Here, we sequenced the genome of the chimpanzee louse endosymbiont (Candidatus Riesia pediculischaeffi) and compared it with the closely related genome of the human body louse endosymbiont. From this comparison, we found evidence for recent genome erosion leading to gene loss in these endosymbionts. Although gene loss was detected, it was not significantly greater than in older endosymbionts from aphids and ants. Additionally, we searched for genes associated with B-vitamin synthesis in the two louse endosymbiont genomes because these endosymbionts are believed to synthesize essential B vitamins absent in the louse's diet. All of the expected genes were present, except those involved in thiamin synthesis. We failed to find genes encoding for proteins involved in the biosynthesis of thiamin or any complete exogenous means of salvaging thiamin, suggesting there is an undescribed mechanism for the salvage of thiamin. Finally, genes encoding for the pantothenate de novo biosynthesis pathway were located on a plasmid in both taxa along with a heat shock protein. Movement of these genes onto a plasmid may be functionally and evolutionarily significant, potentially increasing production and guarding against the deleterious effects of mutation. These data add to a growing

  13. Dicty_cDB: Contig-U16072-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 8.1 22 ( DX407900 ) SOYF383TH LargeInsertSoybeanGenLibBuild4 Glycine ... 38 8.3 2 ( CP000084 ) Candidatus Pelagibact...ISEGTPFHVHDSSLQ*nilnnlskk*infkisfln*kkknk Translated Amino Acid sequence (All Frames) Frame A: fffpnlsnvpvnlevesdmfctsfsnnffkyts...etptetptetptetpt etptetptetptetptqtptqtptqspiprpitcsklddvlnfnstetiyckgrgptyci dgygsecetndvdgrikct... 12 BAC RP11-295G12 (Roswell Park Can... 36 3.1 8 ( AE014820 ) Plasmodium falciparum 3D7 chromosome 14 sect... subsp. aureus N315 DNA, com... 44 5.9 23 ( AE014832 ) Plasmodium falciparum 3D7 chromosome 10 section 4...

  14. Dicty_cDB: Contig-U16343-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available socitrate lyase; EC=4.1.3... 67 3e-09 CP000561_610( CP000561 |pid:none) Pyrobaculum calidifontis JCM...stonia metallidurans CH34, c... 65 6e-09 CP000926_1922( CP000926 |pid:none) Pseudomonas putida...9342 ) 1092344077476 Global-Ocean-Sampling_GS-27-01-01-1... 64 1e-09 2 ( CP000084 ) Candidatus Pelagibacter ...........done Score E Sequences producing significant alignments: (bits) Value AC117076_17( AC117076 |pid:none) Dictyostelium discoid...:none) Yersinia enterocolitica subsp. ... 494 e-138 CP001654_443( CP001654 |pid:none) Dickeya dadantii Ech70

  15. Ubiquity of Benford's law and emergence of the reciprocal distribution

    Science.gov (United States)

    Friar, J. L.; Goldman, T.; Pérez-Mercader, J.

    2016-05-01

    We apply the Law of Total Probability to the construction of scale-invariant probability distribution functions (pdf's), and require that probability measures be dimensionless and unitless under a continuous change of scales. If the scale-change distribution function is scale invariant then the constructed distribution will also be scale invariant. Repeated application of this construction on an arbitrary set of (normalizable) pdf's results again in scale-invariant distributions. The invariant function of this procedure is given uniquely by the reciprocal distribution, suggesting a kind of universality. We separately demonstrate that the reciprocal distribution results uniquely from requiring maximum entropy for size-class distributions with uniform bin sizes.

  16. Ubiquity of Benfords law and emergence of the reciprocal distribution

    CERN Document Server

    Friar, J L; Perez-Mercader, J

    2016-01-01

    We apply the Law of Total Probability to the construction of scale-invariant probability distribution functions (pdfs), and require that probability measures be dimensionless and unitless under a continuous change of scales. If the scale-change distribution function is scale invariant then the constructed distribution will also be scale invariant. Repeated application of this construction on an arbitrary set of (normalizable) pdfs results again in scale-invariant distributions. The invariant function of this procedure is given uniquely by the reciprocal distribution, suggesting a kind of universality. We separately demonstrate that the reciprocal distribution results uniquely from requiring maximum entropy for size-class distributions with uniform bin sizes.

  17. On the utility and ubiquity of atomic collision physics

    International Nuclear Information System (INIS)

    This paper is divided into three parts. In the introduction, we discuss the history and makeup of ICPEAC. In the second part, we discuss the extent of applicability of atomic collision physics. In the third part, we chose one subject (dielectronic excitation) to show the interrelationship of various sub-branches of atomic collision physics. 28 refs., 14 figs

  18. Ubiquity and Diversity of Human-Associated Demodex Mites

    Science.gov (United States)

    Thoemmes, Megan S.; Fergus, Daniel J.; Urban, Julie; Trautwein, Michelle; Dunn, Robert R.

    2014-01-01

    Demodex mites are a group of hair follicle and sebaceous gland-dwelling species. The species of these mites found on humans are arguably the animals with which we have the most intimate interactions. Yet, their prevalence and diversity have been poorly explored. Here we use a new molecular method to assess the occurrence of Demodex mites on humans. In addition, we use the 18S rRNA gene (18S rDNA) to assess the genetic diversity and evolutionary history of Demodex lineages. Within our samples, 100% of people over 18 years of age appear to host at least one Demodex species, suggesting that Demodex mites may be universal associates of adult humans. A phylogenetic analysis of 18S rDNA reveals intraspecific structure within one of the two named human-associated Demodex species, D. brevis. The D. brevis clade is geographically structured, suggesting that new lineages are likely to be discovered as humans from additional geographic regions are sampled. PMID:25162399

  19. The Hidden Cost of Ubiquity: Globalisation and Terrorism

    OpenAIRE

    Krug, Barbara; Reinmoeller, Patrick

    2003-01-01

    textabstractTerrorism is not a natural hazard outside the range of corporate decision-making. Simple micro-economic analysis shows how globalisation changed the supply of terrorist attacks and the costs for tolerating terrorist hazard. Approaches developed in organizational strategy help to single out three strategic decisions directly affecting the vulnerability of firms in a globalised world: exposure, geographical spread, and organisational form. The analysis suggests that the gains from u...

  20. The Ubiquity of Coeval Starbursts in Massive Galaxy Cluster Progenitors

    CERN Document Server

    Casey, Caitlin M

    2016-01-01

    The Universe's largest galaxy clusters likely built the majority of their massive $>10^{11} M_\\odot$ galaxies in simultaneous, short-lived bursts of activity well before virialization. This conclusion is reached from emerging datasets on $z>2$ proto-clusters and the characteristics of their member galaxies, in particular, rare starbursts and ultraluminous active galactic nuclei (AGN). The most challenging observational hurdle in identifying such structures is their very large volumes, $\\sim10^{4}$ comoving Mpc$^3$ at $z>2$, subtending areas $\\sim$half a degree on the sky. Thus the contrast afforded by an overabundance of very rare galaxies in comparison to the background can more easily distinguish overdense structures from the surrounding, normal density field. Five $210^{15} M_\\odot$ galaxy clusters in the nearby Universe, a factor of five larger than expected in some simulations. Some tension yet exists between measurements of their volume density of starburst-rich proto-clusters and the expectation that t...

  1. Saturn's Titan: A strict test for life's cosmic ubiquity

    OpenAIRE

    Lunine, J. I.

    2009-01-01

    Is life a common outcome of physical and chemical processes in the universe? Within our own solar system, a successful search for even primitive life, were it to have an origin independent from life on Earth, would dramatically advance a positive answer. The most stringent test for a second independent origin of life on Earth would come from examination of either the most physically remote from Earth, or the most exotic type, of planetary environments in which one might plausibly imagine a fo...

  2. Ubiquity and diversity of human-associated Demodex mites.

    Directory of Open Access Journals (Sweden)

    Megan S Thoemmes

    Full Text Available Demodex mites are a group of hair follicle and sebaceous gland-dwelling species. The species of these mites found on humans are arguably the animals with which we have the most intimate interactions. Yet, their prevalence and diversity have been poorly explored. Here we use a new molecular method to assess the occurrence of Demodex mites on humans. In addition, we use the 18S rRNA gene (18S rDNA to assess the genetic diversity and evolutionary history of Demodex lineages. Within our samples, 100% of people over 18 years of age appear to host at least one Demodex species, suggesting that Demodex mites may be universal associates of adult humans. A phylogenetic analysis of 18S rDNA reveals intraspecific structure within one of the two named human-associated Demodex species, D. brevis. The D. brevis clade is geographically structured, suggesting that new lineages are likely to be discovered as humans from additional geographic regions are sampled.

  3. Medicoscapes: on mobile ubiquity effects and ICT4D

    DEFF Research Database (Denmark)

    Michelsen, Anders Ib

    2012-01-01

    The Article presents theoretical comments on the theme of ‘media ubiquity’, as an introduction to the presentation of an information and communication technology ‘4’ development (ICT4D) project in the Republic of Somaliland: The Somaliland Telemedical System for Psychiatry. This project is based on...

  4. Ubiquity of Exciton Localization in Cryogenic Carbon Nanotubes

    OpenAIRE

    Hofmann, Matthias S.; Noé, Jonathan; Kneer, Alexander; Crochet, Jared J.; Högele, Alexander

    2016-01-01

    We present photoluminescence studies of individual semiconducting single-wall carbon nanotubes at room and cryogenic temperatures. From the analysis of spatial and spectral features of nanotube photoluminescence, we identify characteristic signatures of unintentional exciton localization. Moreover, we quantify the energy scale of exciton localization potentials as ranging from a few to a few tens of millielectronvolts and stemming from both environmental disorder and shallow covalent side-wal...

  5. Ubiquity of Exciton Localization in Cryogenic Carbon Nanotubes.

    Science.gov (United States)

    Hofmann, Matthias S; Noé, Jonathan; Kneer, Alexander; Crochet, Jared J; Högele, Alexander

    2016-05-11

    We present photoluminescence studies of individual semiconducting single-wall carbon nanotubes at room and cryogenic temperatures. From the analysis of spatial and spectral features of nanotube photoluminescence, we identify characteristic signatures of unintentional exciton localization. Moreover, we quantify the energy scale of exciton localization potentials as ranging from a few to a few tens of millielectronvolts and stemming from both environmental disorder and shallow covalent side-wall defects. Our results establish disorder-induced crossover from the diffusive to the localized regime of nanotube excitons at cryogenic temperatures as a ubiquitous phenomenon in micelle-encapsulated and as-grown carbon nanotubes. PMID:27105355

  6. Characterization of copy numbers of 16S rDNA and 16S rRNA of Candidatus Liberibacter asiaticus and the implication in detection in planta using quantitative PCR

    Directory of Open Access Journals (Sweden)

    Wang Nian

    2009-03-01

    Full Text Available Abstract Background Citrus Huanglongbing (HLB is one of the most devastating diseases on citrus and is associated with Candidatus Liberibacter spp.. The pathogens are phloem limited and have not been cultured in vitro. The current management strategy of HLB is to remove infected citrus trees and reduce psyllid populations with insecticides to prevent the spreading. This strategy requires sensitive and reliable diagnostic methods for early detection. Results We investigated the copy numbers of the 16S rDNA and 16S rRNA of the HLB pathogen and the implication of improving the diagnosis of HLB for early detection using Quantitative PCR. We compared the detection of HLB with different Quantitative PCR based methods with primers/probe targeting either 16S rDNA, beta-operon DNA, 16S rRNA, or beta-operon RNA. The 16S rDNA copy number of Ca. Liberibacter asiaticus was estimated to be three times of that of the beta-operon region, thus allowing detection of lower titer of Ca. L. asiaticus. Quantitative reverse transcriptional PCR (QRT-PCR indicated that the 16S rRNA averaged 7.83 times more than that of 16S rDNA for the same samples. Dilution analysis also indicates that QRT-PCR targeting 16S rRNA is 10 time more sensitive than QPCR targeting 16S rDNA. Thus QRT-PCR was able to increase the sensitivity of detection by targeting 16S rRNA. Conclusion Our result indicates that Candidatus Liberibacter asiaticus contains three copies of 16S rDNA. The copy number of 16S rRNA of Ca. L. asiaticus in planta averaged about 7.8 times of 16S rDNA for the same set of samples tested in this study. Detection sensitivity of HLB could be improved through the following approaches: using 16S rDNA based primers/probe in the QPCR assays; and using QRT-PCR assays targeting 16S rRNA.

  7. Denitrifying phosphorus removal from municipal wastewater and dynamics of "Candidatus Accumulibacter" and denitrifying bacteria based on genes of ppk1, narG, nirS and nirK.

    Science.gov (United States)

    Zeng, Wei; Zhang, Jie; Wang, Anqi; Peng, Yongzhen

    2016-05-01

    Relevance of clade-level population dynamics of "Candidatus Accumulibacter" to performance of denitrifying phosphorus (P) removal from municipal wastewater was investigated. Stable denitrifying P removal in anoxic zone of continuous-flow reactor was achieved, accounting for 90% of total P removal. Clades IIC and IIF affiliated with Accumulibacter lineage were the dominant clades during denitrifying P removal, reaching 90% of ppk1 clone library. NarG gene library indicated Gamma and Beta-proteobacteria played an important role in nitrate reduction. Diversity and abundance of nirS library was much more than nirK, and thus became the main functional gene to execute nitrite reduction. Based on abundance of nirS, nirK and ppk1, the ratio of Accumulibacter capable of denitrifying P removal to total Accumulibacter was 22%. No matter whether Accumulibacter had narG gene or not, high abundance of narG at a level of 10(9)cells/(g dried-sludge) promoted nitrate reduced to nitrite, ensuring performance of denitrifying P removal. PMID:26896717

  8. Infection Density Dynamics of the Citrus Greening Bacterium “Candidatus Liberibacter asiaticus” in Field Populations of the Psyllid Diaphorina citri and Its Relevance to the Efficiency of Pathogen Transmission to Citrus Plants

    Science.gov (United States)

    Ukuda-Hosokawa, Rie; Sadoyama, Yasutsune; Kishaba, Misaki; Kuriwada, Takashi; Anbutsu, Hisashi

    2015-01-01

    Huanglongbing, or citrus greening, is a devastating disease of citrus plants recently spreading worldwide, which is caused by an uncultivable bacterial pathogen, “Candidatus Liberibacter asiaticus,” and vectored by a phloem-sucking insect, Diaphorina citri. We investigated the infection density dynamics of “Ca. Liberibacter asiaticus” in field populations of D. citri with experiments using field-collected insects to address how “Ca. Liberibacter asiaticus” infection density in the vector insect is relevant to pathogen transmission to citrus plants. Of 500 insects continuously collected from “Ca. Liberibacter asiaticus”-infected citrus trees with pathological symptoms in the spring and autumn of 2009, 497 (99.4%) were “Ca. Liberibacter asiaticus” positive. The infections were systemic across head-thorax and abdomen, ranging from 103 to 107 bacteria per insect. In spring, the infection densities were low in March, at ∼103 bacteria per insect, increasing up to 106 to 107 bacteria per insect in April and May, and decreasing to 105 to 106 bacteria per insect in late May, whereas the infection densities were constantly ∼106 to 107 bacteria per insect in autumn. Statistical analysis suggested that several factors, such as insect sex, host trees, and collection dates, may be correlated with “Ca. Liberibacter asiaticus” infection densities in field D. citri populations. Inoculation experiments with citrus seedlings using field-collected “Ca. Liberibacter asiaticus”-infected insects suggested that (i) “Ca. Liberibacter asiaticus”-transmitting insects tend to exhibit higher infection densities than do nontransmitting insects, (ii) a threshold level (∼106 bacteria per insect) of “Ca. Liberibacter asiaticus” density in D. citri is required for successful transmission to citrus plants, and (iii) D. citri attaining the threshold infection level transmits “Ca. Liberibacter asiaticus” to citrus plants in a stochastic manner. These

  9. Infection Density Dynamics of the Citrus Greening Bacterium "Candidatus Liberibacter asiaticus" in Field Populations of the Psyllid Diaphorina citri and Its Relevance to the Efficiency of Pathogen Transmission to Citrus Plants.

    Science.gov (United States)

    Ukuda-Hosokawa, Rie; Sadoyama, Yasutsune; Kishaba, Misaki; Kuriwada, Takashi; Anbutsu, Hisashi; Fukatsu, Takema

    2015-06-01

    Huanglongbing, or citrus greening, is a devastating disease of citrus plants recently spreading worldwide, which is caused by an uncultivable bacterial pathogen, "Candidatus Liberibacter asiaticus," and vectored by a phloem-sucking insect, Diaphorina citri. We investigated the infection density dynamics of "Ca. Liberibacter asiaticus" in field populations of D. citri with experiments using field-collected insects to address how "Ca. Liberibacter asiaticus" infection density in the vector insect is relevant to pathogen transmission to citrus plants. Of 500 insects continuously collected from "Ca. Liberibacter asiaticus"-infected citrus trees with pathological symptoms in the spring and autumn of 2009, 497 (99.4%) were "Ca. Liberibacter asiaticus" positive. The infections were systemic across head-thorax and abdomen, ranging from 10(3) to 10(7) bacteria per insect. In spring, the infection densities were low in March, at ∼ 10(3) bacteria per insect, increasing up to 10(6) to 10(7) bacteria per insect in April and May, and decreasing to 10(5) to 10(6) bacteria per insect in late May, whereas the infection densities were constantly ∼ 10(6) to 10(7) bacteria per insect in autumn. Statistical analysis suggested that several factors, such as insect sex, host trees, and collection dates, may be correlated with "Ca. Liberibacter asiaticus" infection densities in field D. citri populations. Inoculation experiments with citrus seedlings using field-collected "Ca. Liberibacter asiaticus"-infected insects suggested that (i) "Ca. Liberibacter asiaticus"-transmitting insects tend to exhibit higher infection densities than do nontransmitting insects, (ii) a threshold level (∼ 10(6) bacteria per insect) of "Ca. Liberibacter asiaticus" density in D. citri is required for successful transmission to citrus plants, and (iii) D. citri attaining the threshold infection level transmits "Ca. Liberibacter asiaticus" to citrus plants in a stochastic manner. These findings provide

  10. Validation of 'variable number of tandem repeat'-based approach for examination of 'Candidatus Liberibacter asiaticus' diversity and its applications for the analysis of the pathogen populations in the areas of recent introduction.

    Directory of Open Access Journals (Sweden)

    Luis A Matos

    Full Text Available Citrus greening (Huanglongbing, HLB is one of the most destructive diseases of citrus worldwide. In South Asia HLB has been known for more than a century, while in Americas the disease was found relatively recently. HLB is associated with three species of 'Candidatus Liberibacter' among which 'Ca. Liberibacter asiaticus' (CLas has most wide distribution. Recently, a number of studies identified different regions in the CLas genome with variable number of tandem repeats (VNTRs that could be used for examination of CLas diversity. One of the objectives of the work presented here was to further validate the VNTR analysis-based approach by assessing the stability of these repeats upon multiplication of the pathogen in a host over an extended period of time and upon its passaging from a host to a host using CLas populations from Florida. Our results showed that the numbers of tandem repeats in the four loci tested display very distinguishable "signature profiles" for the two Florida-type CLas haplotype groups. Remarkably, the profiles do not change upon passage of the pathogen in citrus and psyllid hosts as well as after its presence within a host over a period of five years, suggesting that VNTR analysis-based approach represents a valid methodology for examination of the pathogen populations in various geographical regions. Interestingly, an extended analysis of CLas populations in different locations throughout Florida and in several countries in the Caribbean and Central America regions and in Mexico where the pathogen has been introduced recently demonstrated the dispersion of the same haplotypes of CLas. On the other hand, these CLas populations appeared to differ significantly from those obtained from locations where the disease has been present for a much longer time.

  11. Population Structure of‘Candidatus Liberibacter asiaticus’ in China Revealed by SSR Markers%基于SSR标记的中国亚洲韧皮杆菌种群结构研究

    Institute of Scientific and Technical Information of China (English)

    黄爱军; 苏华楠; 王雪峰; 唐科志; 李中安; 周常勇

    2014-01-01

    目的亚洲韧皮部杆菌是柑橘黄龙病病原。通过筛选SSR(Simple sequence repeat)位点,分析中国境内亚洲韧皮部杆菌(‘Candidatus Liberibacter asiaticus’)的群体结构。方法根据已报道亚洲韧皮部杆菌基因组上的25个SSR位点,使用中国不同地理来源的样品,对报道的SSR位点进行筛选,找出其中适宜进行中国样品群体结构分析的位点。应用PCR的方法,对收集的中国境内的285个亚洲韧皮部杆菌相应SSR位点进行扩增,聚丙烯酰胺凝胶电泳。所得电泳图导入软件Quantity One 4.5.0读取产物的碱基数。通过PopGen version 1.31软件评估选出的位点和不同地理来源的样品的多态性,分别使用软件Powermarker 3.25和structure 2.3.4进行聚类分析。结果共选出5个SSR位点可用于中国种群结构研究,Nei's多样性指数0.1542—0.9556。其中LasA位点多态性最高,有效等位基因数NE=22.5,Nei's多样性指数H=0.9556。通过这5个位点分析中国境内8个不同地理来源的样品,发现云南省样品存在较高多态性,NE=5.7,H=0.6580。8个地理种群间的遗传距离0.0236—0.5786,遗传相似度0.5607—0.9767,广西和四川遗传距离最大,遗传相似度最小。Powermarker软件以UPGMA方法进行聚类分析的结果显示,所有样品分为两个组群,四川和云南为一个组群;福建、浙江、贵州、广东、广西和江西为一个组群。Structure软件分析也得出了相似的结果,云南和四川样品的种群构成较为单一,90%以上个体为同一组群,而其他6个地理来源不同程度的为两个组群的混合。结论基于5个SSR位点分析中国境内的Ca. L. asiaticus表明其可能存在两种不同的群体结构,为进一步研究中国柑橘黄龙病的发生和流行规律提供了有价值的线索。%[Objective] ‘Candidatus Liberibacter asiaticus’ is the pathogeny of Citrus Huanglongbing. The purpose

  12. Genetic variation analysis of an outer membrane protein gene of Candidatus Liberibacter asiaticus%柑橘黄龙病菌亚洲种外膜蛋白基因的遗传变异分析

    Institute of Scientific and Technical Information of China (English)

    鹿连明; 杜丹超; 程保平; 胡秀荣; 张利平; 陈国庆

    2014-01-01

    为了解柑橘黄龙病菌亚洲种(Candidatus Liberibacter asiaticus)的遗传多样性,对来源于国内外7个不同地区和浙江台州地区11个不同寄主品种的 Ca.L.asiaticus 的外膜蛋白(outer membrane protein,OMP)基因进行聚合酶链反应限制性片段长度多态性分析(polymerase chain reaction-restriction fragment length polymorphism,PCR-RFLP).PCR 产物经克隆测序后,利用 NCBI Blast 和 DNAMAN 软件对 omp 基因序列进行多重比对,并用 MEGA 软件构建系统发育树.结果显示:在浙江台州地区不同寄主品种上 Ca.L.asiaticus 各分离物的 omp 基因的酶切片段长度不具有多态性,其基因序列也完全一致;而不同地理来源的 Ca.L.asiaticus 的omp 基因经限制性内切酶消化后可产生不同的 RFLP 指纹图谱,其核酸序列和氨基酸序列均存在变异,表明 Ca. L.asiaticus 存在种内遗传多样性.在系统发育树上,所有的 Ca.L.asiaticus 分离物聚为1个分支,而 Ca.L. africanus 和 Ca.L.solanacearum 分别处于不同的分支上.%Summary Huanglongbing (HLB) is a destructive disease that represents a major threat to the world citrus industry.It was first reported from Chaoshan area of Guangdong Province in the early 20th century,and is now known to occur in next to 40 different Asian,African,Oceanian,South and North American countries and areas. Its pathogen is a phloem-limited,non-cultured,Gram-negative bacterium which belongs to the genus Candidatus Liberibacter.Three species,i.e.,Ca. L.asiaticus,Ca. L.americanus,and Ca. L.africanus with Ca. L. africanus subsp.capensis are currently known.So far,the pathogen of HLB disease discovered in China is only Ca.L.asiaticus,which distributes widely in almost all major citrus growing areas such as Guangdong,Guangxi, Fujian,Yunnan,Zhejiang and so on.This pathogen can be transmitted by grafting and Diaphorina citri and infect almost all fruit trees of Citrus Fortunella and Poncirus

  13. AcEST: DK957088 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 221 3e-56 tr|A8TNP2|A8TNP2_9PROT Metallo-beta-lactamase family protein OS=... 220 6e-56 tr|A4EX99|A4EX99_9RHOB Hydroxyac...bid... 286 8e-76 tr|Q9FSZ6|Q9FSZ6_CICAR Putative mitochondrial glyoxalase II (Fra... 270 4e-71 tr|Q3EBH4|Q3EBH4_ARATH Uncharact...PTIPTS 606 + Y + V LR P+IPT+ Sbjct: 267 QSYATRVAHLRSQGLPSIPTT 287 >sp|Q60BX0|GLO2_METCA Hydroxyacylglutathione hydrolase OS=Met...ylglutathione hydrolase OS=Silicibacter pomeroyi GN=gloB PE=3 SV=1 Length = 255 Score = 224 bits (572), Expect...4FP49|GLO2_PELUB Hydroxyacylglutathione hydrolase OS=Pelagibacter ubique GN=gloB

  14. Correlation of Candidatus Liberibacter asiaticus and the Endophytic Community in Diaphorina citri%柑橘木虱黄龙病菌携带量与其内生菌群相关性

    Institute of Scientific and Technical Information of China (English)

    孙丽琴; 殷幼平; 王芳; 吴晓芳; 王中康

    2014-01-01

    【目的】分析柑橘木虱(Diaphorinacitri)体内可能与黄龙病菌(CandidatusLiberibacter asiaticus)互作的内生细菌,为黄龙病菌的人工培养及其病害防控奠定基础。【方法】首先通过传统分离培养方法比较不同地理来源带黄龙病菌(带菌)和不带菌黄龙病菌(不带菌)的木虱中可培养内生细菌的差异。其次将带菌状况不同的木虱分别分为头、胸、腹3部分,经PCR扩增其16S rDNA的V6-V8区,用变性梯度凝胶电泳(PCR-DGGE)方法,比较带菌状况不同的木虱内生细菌的差异和木虱不同部位内生细菌的差异。选择3种差异的内生细菌:Bacillus sp.、Salmonella sp.、Enterobacter sp.,在8份带菌状况不同的木虱样品中通过q-PCR分别对其进行实时荧光定量分析,再以总细菌量为校正计算包括黄龙病菌在内的4种细菌的相对含量,数据经LSD检验,以各种细菌相对含量的-lg值作图,先比较同一样品中3种细菌分别与黄龙病菌的相对含量关系,再比较同种细菌在不同样品中的特性,分析3种内生细菌和黄龙病菌的互作关系。【结果】不带菌木虱中可培养内生菌菌落丰富度和菌落形成单位均大于带菌木虱中。在不带菌木虱中共获得14株形态不同的菌株,分属于芽孢杆菌属(Bacillus,3株)、欧文氏菌属(Erwinia,1株)、克雷伯氏杆菌属(Klebsiella,1株)、葡萄球菌属(Staphylococcus,2株)、节杆菌属(Arthrobacter,1株)、泛菌属(Pantoea,2株)、果胶杆菌属(Pectobacterium,1株)、沙门氏菌属等(Salmonella,1株)、链霉菌属(Streptomyces,1株)、Massilia brevitalea(1株)等10个细菌属。在带菌木虱中分得的4株细菌在不带菌木虱中均分离到,分属于克雷伯氏菌属、芽孢杆菌属、果胶杆菌属。其中Dc-11(嗜气芽孢杆菌属)在带菌木虱和不带菌木虱中分

  15. Effect of Candidatus Liberibacter asiaticus Infection on Carbohydrate Metabolism in Citrus sinensis%柑橘黄龙病菌侵染对甜橙叶片糖代谢的影响

    Institute of Scientific and Technical Information of China (English)

    吴越; 苏华楠; 黄爱军; 周彦; 李中安; 刘金香; 周常勇

    2015-01-01

    【目的】研究甜橙(Citrus sinensis)在柑橘黄龙病菌(Candidatus Liberibacter asiaticus)侵染下不同时期糖代谢的变化,以探讨其与柑橘叶片中淀粉积累间的关系,为进一步阐明柑橘黄龙病的发病机理提供理论依据。【方法】以甜橙为供试材料,采用腹接接种病原的方法,试验组植株用感染黄龙病菌的芽条进行嫁接,对照组植株用健康芽条进行接种,每个植株均嫁接3个芽条。在检测到感病的植株中选取生长状况良好且接近的3株作为后续试验材料,每月采集1次成熟叶片,至10月份结束。采集的叶片立即抽提 DNA 和 RNA,并进行可溶性糖及淀粉含量的测定,其余叶片用液氮速冻后保存于-80℃用于测定糖代谢过程中关键酶活性的变化,同时利用实时荧光定量 PCR 技术比较二者关键酶基因表达量的差异。【结果】随着病原菌胁迫时间的延长,可溶性糖和淀粉含量总体呈升高趋势,均在6月达到峰值,分别为对照的1.59和3.73倍,在感病后期开始有所下降;通过对二者的比值分析发现,感病植株的比值随时间的延长不断下降。在黄龙病菌侵染的不同阶段,各种酶的作用程度有所不同。感病植株的蔗糖磷酸合成酶(SPS)活性在感病初期迅速上升至顶峰,高达58.44μg·g-1·min-1,至后期已略微低于对照;酸性转化酶(AI)总体显示出较高活性,各个时期均有显著性差异(P<0.05),感病中期活性最高为对照的2.91倍;中性转化酶(NI)活性在感病和对照中均维持较低水平,且变化趋势基本一致;可溶性淀粉合成酶(SSs)与束缚性淀粉合成酶(GBSS)协调作用,共同参与淀粉合成的调控;淀粉酶活性在感病不同时期均有所下降,在感病中期低至0.38 U·g-1。定量 PCR 分析表明,蔗糖磷酸合成酶基因 SPS1表达量显著升高,与其酶活

  16. Diversity and ubiquity of bacteria capable of utilizing humic substances as electron donors for anaerobic respiration.

    Science.gov (United States)

    Coates, John D; Cole, Kimberly A; Chakraborty, Romy; O'Connor, Susan M; Achenbach, Laurie A

    2002-05-01

    Previous studies have demonstrated that reduced humic substances (HS) can be reoxidized by anaerobic bacteria such as Geobacter, Geothrix, and Wolinella species with a suitable electron acceptor; however, little is known of the importance of this metabolism in the environment. Recently we investigated this metabolism in a diversity of environments including marine and aquatic sediments, forest soils, and drainage ditch soils. Most-probable-number enumeration studies were performed using 2,6-anthrahydroquinone disulfonate (AHDS), an analog for reduced HS, as the electron donor with nitrate as the electron acceptor. Anaerobic organisms capable of utilizing reduced HS as an electron donor were found in all environments tested and ranged from a low of 2.31 x 10(1) in aquifer sediments to a high of 9.33 x 10(6) in lake sediments. As part of this study we isolated six novel organisms capable of anaerobic AHDS oxidation. All of the isolates coupled the oxidation of AHDS to the reduction of nitrate with acetate (0.1 mM) as the carbon source. In the absence of cells, no AHDS oxidation was apparent, and in the absence of AHDS, no cell density increase was observed. Generally, nitrate was reduced to N(2). Analysis of the AHDS and its oxidized form, 2,6-anthraquinone disulfonate (AQDS), in the medium during growth revealed that the anthraquinone was not being biodegraded as a carbon source and was simply being oxidized as an energy source. Determination of the AHDS oxidized and nitrate reduced accounted for 109% of the theoretical electron transfer. In addition to AHDS, all of these isolates could also couple the oxidation of reduced humic substances to the reduction of nitrate. No HS oxidation occurred in the absence of cells and in the absence of a suitable electron acceptor, demonstrating that these organisms were capable of utilizing natural HS as an energy source and that AHDS serves as a suitable analog for studying this metabolism. Alternative electron donors included simple volatile fatty acids such as propionate, butyrate, and valerate as well as simple organic acids such as lactate and pyruvate. Analysis of the complete sequences of the 16S rRNA genes revealed that the isolates were not closely related to each other and were phylogenetically diverse, with members in the alpha, beta, gamma, and delta subdivisions of the PROTEOBACTERIA: Most of the isolates were closely related to known genera not previously recognized for their ability to couple growth to HS oxidation, while one of the isolates represented a new genus in the delta subclass of the PROTEOBACTERIA: The results presented here demonstrate that microbial oxidation of HS is a ubiquitous metabolism in the environment. This study represents the first description of HS-oxidizing isolates and demonstrates that microorganisms capable of HS oxidation are phylogenetically diverse. PMID:11976120

  17. Diversity and Ubiquity of Bacteria Capable of Utilizing Humic Substances as Electron Donors for Anaerobic Respiration

    OpenAIRE

    Coates, John D.; Cole, Kimberly A.; Chakraborty, Romy; O'Connor, Susan M.; Achenbach, Laurie A.

    2002-01-01

    Previous studies have demonstrated that reduced humic substances (HS) can be reoxidized by anaerobic bacteria such as Geobacter, Geothrix, and Wolinella species with a suitable electron acceptor; however, little is known of the importance of this metabolism in the environment. Recently we investigated this metabolism in a diversity of environments including marine and aquatic sediments, forest soils, and drainage ditch soils. Most-probable-number enumeration studies were performed using 2,6-a...

  18. Causal ubiquity in quantum physics a superluminal and local-causal physical ontology

    CERN Document Server

    Neelamkavil, Raphael

    2014-01-01

    A fixed highest criterial velocity (of light) in STR (special theory of relativity) is a convention for a layer of physical inquiry. QM (Quantum Mechanics) avoids action-at-a-distance using this concept, but accepts non-causality and action-at-a-distance in EPR (Einstein-Podolsky-Rosen-Paradox) entanglement experiments. Even in such allegedly non-causal processes, something exists processually in extension-motion, between the causal and the non-causal. If STR theoretically allows real-valued superluminal communication between EPR entangled particles, quantum processes become fully causal. That

  19. Homo ludicus. The ubiquity of play and its roles in present society

    OpenAIRE

    Peppino Ortoleva

    2012-01-01

    In the last decades new technologies, the rearrangement of living and labour time and other less visible cultural factors have brought some significant historical modifications to the traditionally separated area of the ludic. New types of games have emerged and the threshold between play and reality has been redefined to include aspects of social life that seemed to be unrelated to playing activities.

  20. Causal ubiquity in quantum physics. A superluminal and local-causal physical ontology

    Energy Technology Data Exchange (ETDEWEB)

    Neelamkavil, Raphael

    2014-07-01

    A fixed highest criterial velocity (of light) in STR (special theory of relativity) is a convention for a layer of physical inquiry. QM (Quantum Mechanics) avoids action-at-a-distance using this concept, but accepts non-causality and action-at-a-distance in EPR (Einstein-Podolsky-Rosen-Paradox) entanglement experiments. Even in such allegedly [non-causal] processes, something exists processually in extension-motion, between the causal and the [non-causal]. If STR theoretically allows real-valued superluminal communication between EPR entangled particles, quantum processes become fully causal. That is, the QM world is sub-luminally, luminally and superluminally local-causal throughout, and the Law of Causality is ubiquitous in the micro-world. Thus, ''probabilistic causality'' is a merely epistemic term.

  1. Causal ubiquity in quantum physics. A superluminal and local-causal physical ontology

    International Nuclear Information System (INIS)

    A fixed highest criterial velocity (of light) in STR (special theory of relativity) is a convention for a layer of physical inquiry. QM (Quantum Mechanics) avoids action-at-a-distance using this concept, but accepts non-causality and action-at-a-distance in EPR (Einstein-Podolsky-Rosen-Paradox) entanglement experiments. Even in such allegedly [non-causal] processes, something exists processually in extension-motion, between the causal and the [non-causal]. If STR theoretically allows real-valued superluminal communication between EPR entangled particles, quantum processes become fully causal. That is, the QM world is sub-luminally, luminally and superluminally local-causal throughout, and the Law of Causality is ubiquitous in the micro-world. Thus, ''probabilistic causality'' is a merely epistemic term.

  2. CardioML: integrating personal cardiac information for ubiquous diagnosis and analysis

    OpenAIRE

    Coelho, Luís; Queirós, Ricardo

    2010-01-01

    The latest medical diagnosis devices enable the performance of e-diagnosis making the access to these services easier, faster and available in remote areas. However this imposes new communications and data interchange challenges. In this paper a new XML based format for storing cardiac signals and related information is presented. The proposed structure encompasses data acquisition devices, patient information, data description, pathological diagnosis and waveform annotatio...

  3. ON THE UBIQUITY OF MOLECULAR ANIONS IN THE DENSE INTERSTELLAR MEDIUM

    International Nuclear Information System (INIS)

    Results are presented from a survey for molecular anions in seven nearby Galactic star-forming cores and molecular clouds. The hydrocarbon anion C6H– is detected in all seven target sources, including four sources where no anions have been previously detected: L1172, L1389, L1495B, and TMC-1C. The C6H–/C6H column density ratio is ∼> 1.0% in every source, with a mean value of 3.0% (and standard deviation 0.92%). Combined with previous detections, our results show that anions are ubiquitous in dense clouds wherever C6H is present. The C6H–/C6H ratio is found to show a positive correlation with molecular hydrogen number density, and with the apparent age of the cloud. We also report the first detection of C4H– in TMC-1 (at 4.8σ confidence), and derive an anion-to-neutral ratio C4H–/C4H =(1.2 ± 0.4) × 10–5(= 0.0012% ± 0.0004%). Such a low value compared with C6H– highlights the need for a revised radiative electron attachment rate for C4H. Chemical model calculations show that the observed C4H– could be produced as a result of reactions of oxygen atoms with C5H– and C6H–.

  4. ON THE UBIQUITY OF MOLECULAR ANIONS IN THE DENSE INTERSTELLAR MEDIUM

    Energy Technology Data Exchange (ETDEWEB)

    Cordiner, M. A.; Wirstroem, E. S.; Charnley, S. B. [Astrochemistry Laboratory and The Goddard Center for Astrobiology, NASA Goddard Space Flight Center, Code 691, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Buckle, J. V. [Cavendish Astrophysics Group and Kavli Institute for Cosmology, Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Olofsson, A. O. H., E-mail: martin.cordiner@nasa.gov [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden)

    2013-06-10

    Results are presented from a survey for molecular anions in seven nearby Galactic star-forming cores and molecular clouds. The hydrocarbon anion C{sub 6}H{sup -} is detected in all seven target sources, including four sources where no anions have been previously detected: L1172, L1389, L1495B, and TMC-1C. The C{sub 6}H{sup -}/C{sub 6}H column density ratio is {approx}> 1.0% in every source, with a mean value of 3.0% (and standard deviation 0.92%). Combined with previous detections, our results show that anions are ubiquitous in dense clouds wherever C{sub 6}H is present. The C{sub 6}H{sup -}/C{sub 6}H ratio is found to show a positive correlation with molecular hydrogen number density, and with the apparent age of the cloud. We also report the first detection of C{sub 4}H{sup -} in TMC-1 (at 4.8{sigma} confidence), and derive an anion-to-neutral ratio C{sub 4}H{sup -}/C{sub 4}H =(1.2 {+-} 0.4) Multiplication-Sign 10{sup -5}(= 0.0012% {+-} 0.0004%). Such a low value compared with C{sub 6}H{sup -} highlights the need for a revised radiative electron attachment rate for C{sub 4}H. Chemical model calculations show that the observed C{sub 4}H{sup -} could be produced as a result of reactions of oxygen atoms with C{sub 5}H{sup -} and C{sub 6}H{sup -}.

  5. Ubiquity of density slope oscillations in the central regions of galaxy and cluster-sized systems

    CERN Document Server

    Young, Anthony M; Hjorth, Jens

    2016-01-01

    One usually thinks of a radial density profile as having a monotonically changing logarithmic slope, such as in NFW or Einasto profiles. However, in two different classes of commonly used systems, this is often not the case. These classes exhibit non-monotonic changes in their density profile slopes which we call oscillations for short. We analyze these two unrelated classes separately. Class 1 consists of systems that have density oscillations and that are defined through their distribution function $f(E)$, or differential energy distribution $N(E)$, such as isothermal spheres, King profiles, or DARKexp, a theoretically derived model for relaxed collisionless systems. Systems defined through $f(E)$ or $N(E)$ generally have density slope oscillations. Class 1 system oscillations can be found at small, intermediate, or large radii but we focus on a limited set of Class 1 systems that have oscillations in the central regions, usually at $\\log(r/r_{-2})\\lesssim -2$, where $r_{-2}$ is the largest radius where $d\\...

  6. Ubiquity of density slope oscillations in the central regions of galaxy and cluster-sized systems

    Science.gov (United States)

    Young, Anthony M.; Williams, Liliya L. R.; Hjorth, Jens

    2016-05-01

    One usually thinks of a radial density profile as having a monotonically changing logarithmic slope, such as in NFW or Einasto profiles. However, in two different classes of commonly used systems, this is often not the case. These classes exhibit non-monotonic changes in their density profile slopes which we call oscillations for short. We analyze these two unrelated classes separately. Class 1 consists of systems that have density oscillations and that are defined through their distribution function f(E), or differential energy distribution N(E), such as isothermal spheres, King profiles, or DARKexp, a theoretically derived model for relaxed collisionless systems. Systems defined through f(E) or N(E) generally have density slope oscillations. Class 1 system oscillations can be found at small, intermediate, or large radii but we focus on a limited set of Class 1 systems that have oscillations in the central regions, usually at log(r/r‑2) lesssim ‑2, where r‑2 is the largest radius where dlog(ρ)/dlog(r) = ‑2. We show that the shape of their N(E) can roughly predict the amplitude of oscillations. Class 2 systems which are a product of dynamical evolution, consist of observed and simulated galaxies and clusters, and pure dark matter halos. Oscillations in the density profile slope seem pervasive in the central regions of Class 2 systems. We argue that in these systems, slope oscillations are an indication that a system is not fully relaxed. We show that these oscillations can be reproduced by small modifications to N(E) of DARKexp. These affect a small fraction of systems' mass and are confined to log(r/r‑2) lesssim 0. The size of these modifications serves as a potential diagnostic for quantifying how far a system is from being relaxed.

  7. Ubiquity and diversity of heterotrophic bacterial nasA genes in diverse marine environments.

    Directory of Open Access Journals (Sweden)

    Xuexia Jiang

    Full Text Available Nitrate uptake by heterotrophic bacteria plays an important role in marine N cycling. However, few studies have investigated the diversity of environmental nitrate assimilating bacteria (NAB. In this study, the diversity and biogeographical distribution of NAB in several global oceans and particularly in the western Pacific marginal seas were investigated using both cultivation and culture-independent molecular approaches. Phylogenetic analyses based on 16S rRNA and nasA (encoding the large subunit of the assimilatory nitrate reductase gene sequences indicated that the cultivable NAB in South China Sea belonged to the α-Proteobacteria, γ-Proteobacteria and CFB (Cytophaga-Flavobacteria-Bacteroides bacterial groups. In all the environmental samples of the present study, α-Proteobacteria, γ-Proteobacteria and Bacteroidetes were found to be the dominant nasA-harboring bacteria. Almost all of the α-Proteobacteria OTUs were classified into three Roseobacter-like groups (I to III. Clone library analysis revealed previously underestimated nasA diversity; e.g. the nasA gene sequences affiliated with β-Proteobacteria, ε-Proteobacteria and Lentisphaerae were observed in the field investigation for the first time, to the best of our knowledge. The geographical and vertical distributions of seawater nasA-harboring bacteria indicated that NAB were highly diverse and ubiquitously distributed in the studied marginal seas and world oceans. Niche adaptation and separation and/or limited dispersal might mediate the NAB composition and community structure in different water bodies. In the shallow-water Kueishantao hydrothermal vent environment, chemolithoautotrophic sulfur-oxidizing bacteria were the primary NAB, indicating a unique nitrate-assimilating community in this extreme environment. In the coastal water of the East China Sea, the relative abundance of Alteromonas and Roseobacter-like nasA gene sequences responded closely to algal blooms, indicating that NAB may be active participants contributing to the bloom dynamics. Our statistical results suggested that salinity, temperature and nitrate may be some of the key environmental factors controlling the composition and dynamics of the marine NAB communities.

  8. STED Nanoscopy Reveals the Ubiquity of Subcortical Cytoskeleton Periodicity in Living Neurons

    Directory of Open Access Journals (Sweden)

    Elisa D’Este

    2015-03-01

    Full Text Available In the axons of cultured hippocampal neurons, actin forms various structures, including bundles, patches (involved in the preservation of neuronal polarity, and a recently reported periodic ring-like structure. Nevertheless, the overlaying organization of actin in neurons and in the axon initial segment (AIS is still unclear, due mainly to a lack of adequate imaging methods. By harnessing live-cell stimulated emission depletion (STED nanoscopy and the fluorescent probe SiR-Actin, we show that the periodic subcortical actin structure is in fact present in both axons and dendrites. The periodic cytoskeleton organization is also found in the peripheral nervous system, specifically at the nodes of Ranvier. The actin patches in the AIS co-localize with pre-synaptic markers. Cytosolic actin organization strongly depends on the developmental stage and subcellular localization. Altogether, the results of this study reveal unique neuronal cytoskeletal features.

  9. Ubiquity and Diversity of Heterotrophic Bacterial nasA Genes in Diverse Marine Environments

    OpenAIRE

    Xuexia Jiang; Hongyue Dang; Nianzhi Jiao

    2015-01-01

    Nitrate uptake by heterotrophic bacteria plays an important role in marine N cycling. However, few studies have investigated the diversity of environmental nitrate assimilating bacteria (NAB). In this study, the diversity and biogeographical distribution of NAB in several global oceans and particularly in the western Pacific marginal seas were investigated using both cultivation and culture-independent molecular approaches. Phylogenetic analyses based on 16S rRNA and nasA (encoding the large ...

  10. Ubiquity and impact of thin mid-level clouds in the tropics.

    Science.gov (United States)

    Bourgeois, Quentin; Ekman, Annica M L; Igel, Matthew R; Krejci, Radovan

    2016-01-01

    Clouds are crucial for Earth's climate and radiation budget. Great attention has been paid to low, high and vertically thick tropospheric clouds such as stratus, cirrus and deep convective clouds. However, much less is known about tropospheric mid-level clouds as these clouds are challenging to observe in situ and difficult to detect by remote sensing techniques. Here we use Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) satellite observations to show that thin mid-level clouds (TMLCs) are ubiquitous in the tropics. Supported by high-resolution regional model simulations, we find that TMLCs are formed by detrainment from convective clouds near the zero-degree isotherm. Calculations using a radiative transfer model indicate that tropical TMLCs have a cooling effect on climate that could be as large in magnitude as the warming effect of cirrus. We conclude that more effort has to be made to understand TMLCs, as their influence on cloud feedbacks, heat and moisture transport, and climate sensitivity could be substantial. PMID:27530236

  11. MORPHOLOGY OF BLACK CARBON AEROSOLS AND UBIQUITY OF 50-NANOMETER BLACK CARBON AEROSOLS IN THE ATMOSPHERE

    Institute of Scientific and Technical Information of China (English)

    Fengfu Fu; Liangjun Xu; Wei Ye; Yiquan Chen; Mingyu Jiang; Xueqin Xu

    2006-01-01

    Different-sized aerosols were collected by an Andersen air sampler to observe the detailed morphology of the black carbon (BC) aerosols which were separated chemically from the other accompanying aerosols, using a Scanning Electron Microscope equipped with an Energy Dispersive X-ray Spectrometer (SEM-EDX). The results indicate that most BC aerosols are spherical particles of about 50 nm in diameter and with a homogeneous surface. Results also show that these particles aggregate with other aerosols or with themselves to form larger agglomerates in the micrometer range. The shape of these 50-nm BC spherical particles was found to be very similar to that of BC particles released from petroleum-powered vehicular internal combustion engines. These spherical BC particles were shown to be different from the previously reported fullerenes found using Matrix-Assisted Laser Desorption/Ionization Time-Of-Flight Mass Spectrometry (MALDI-TOF-MS).

  12. Confronting the Ubiquity of Electronic Communication and Social Media: Ethical and Legal Considerations for Psychoeducational Practice

    Science.gov (United States)

    Demers, Joseph A.; Sullivan, Amanda L.

    2016-01-01

    Most U.S. children and adults use computers and the Internet on a daily basis. The pervasiveness of electronic communication in a variety of contexts, including home and school, raises ethical and legal concerns for school psychologists and those in related fields of practice, because of the risks to privacy and confidentiality, boundaries,…

  13. Homo ludicus. The ubiquity of play and its roles in present society

    Directory of Open Access Journals (Sweden)

    Peppino Ortoleva

    2012-05-01

    Full Text Available In the last decades new technologies, the rearrangement of living and labour time and other less visible cultural factors have brought some significant historical modifications to the traditionally separated area of the ludic. New types of games have emerged and the threshold between play and reality has been redefined to include aspects of social life that seemed to be unrelated to playing activities.

  14. Ubiquity of parasporin-1 producers in Bacillus thuringiensis natural populations of Japan

    Science.gov (United States)

    Uemori, Akiko; Maeda, Minoru; Yasutake, Koichi; Ohgushi, Akira; Kagoshima, Kumiko; Mizuki, Eiichi; Ohba, Michio

    2007-01-01

    Parasporin, a Bacillus thuringiensis parasporal protein, is unique in having a strong cytocidal activity preferential for human cancer cells. In this study, we characterized parasporin activities associated with three novel geographical isolates of B. thuringiensis. Parasporal inclusion proteins of the three isolates were highly toxic to human uterus cervix cancer cells (HeLa), but not to non-cancer uterine smooth muscle cells (UtSMC). Inclusions of the isolates lacked insect toxicity and hemolytic activity against sheep erythrocytes. Ouchterlony immunodiffusion tests revealed that the proteins of the three isolates are immunologically closely related to parasporin-1 (Cry31A), but dissimilar to the three other existing parasporin groups. Our results provide evidence that the parasporin-1-producing organism is a common member in B. thuringiensis populations occurring in natural environments of Japan.

  15. 中国柑橘黄龙病病原菌两个原噬菌体超变异基因遗传多样性%Genetic Diversity of Two Hypervariable Genes from Prophage Regions of‘Candidatus Liberibacter asiaticus’ in China

    Institute of Scientific and Technical Information of China (English)

    谭锦; 王雪峰; 苏华楠; 李中安; 周常勇

    2013-01-01

    [目的]通过原噬菌体区域高度变异的基因位点研究柑橘黄龙病病原菌亚洲种(‘Candidatus Liberibacter asiaticus’)的种群分化,探讨病原菌种群遗传多样性水平和遗传结构。[方法]基于2种原噬菌体类型(SC1和SC2)对应的超变异基因区域设计2对引物(Lap-TJ-F/Lap-TJ-R1和Lap-TJ-F/Lap-TJ-R2),对中国不同柑橘产区的224个‘Ca. L. asiaticus’株系进行PCR检测和序列分析。[结果]PCR扩增的条带类型呈多态性,具有4种条带类型(SC1-1、SC1-2、SC2-1和SC2-2),西南地区以SC1-1型为主,广东、广西地区以SC2-1型为主,福建、江西、浙江地区没有明显优势的扩增型。分析SC1-1和SC1-2对应序列表明,其差异系由于132 bp的卫星序列和24 bp的小卫星序列2种串联重复序列数不同引起,而SC2-1和SC2-2的差异系由原噬菌体内部基因重排引起。[结论]中国不同地理来源病原菌株系在原噬菌体区域具有较丰富的多态性,对该基因区域研究将有助于揭示中国‘Ca. L. asiaticus’种群的遗传多样性。%[Objective] Hypervariable genomic loci of prophage region were used to study population differentiation and genetic diversity of‘Candidatus Liberibacter asiaticus’, the putative casual agent of citrus Huanglongbing (HLB). [Method] Two primer sets (Lap-TJ-F/Lap-TJ-R1 and Lap-TJ-F/Lap-TJ-R2), targeted hypervariable genomic regions of two prophage types (SC1 and SC2), respectively, were used for PCR detection and sequence analysis of 224 ‘Ca. L. asiaticus’ strains from different citrus producing areas in China.[Result]PCR amplicon polymorphisms and four amplion types (SC1-1, SC1-2, SC2-1 and SC2-2) were observed, SC1-1 and SC2-1 were the predominant types in Southwestern region and Guangdong-Guangxi region, respectively, and no dominant types were found in Fujian-Jiangxi-Zhejiang region. The sequence differences in SC1-1/SC1-2 were mainly caused by different

  16. Genomics of "Candidatus Synechococcus spongiarium", a Cyanobacterial Sponge Symbiont

    Energy Technology Data Exchange (ETDEWEB)

    Slaby, Beate M. [Univ. of Wuerzburg (Germany); Copeland, Alex [Lawrence Berkeley National Lab. (LBNL), Walnut Creek, CA (United States). Dept. of Energy Joint Genome Inst.; Woyke, Tanja [Lawrence Berkeley National Lab. (LBNL), Walnut Creek, CA (United States). Dept. of Energy Joint Genome Inst.; Hentschel, Ute [Univ. of Wuerzburg (Germany)

    2014-03-21

    Marine sponges (Porifera): ancient metazoans of ecological importance, that produce bioactive secondary metabolites and interact with various microorganisms including cyanobacteria1: Marine Synechococcus spp.: cyanobacteria, important contributors to the global carbon cycle and major primary producers in the oceans2 Ca. S. spongiarum: an ecotype of this genus, widespread and abundant symbiont of various marine sponges around the world3, e.g. Aplysina aerophoba

  17. The first detection of 'Candidatus Phytoplasma trifolii' in Rhododendron hybridum

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Petrzik, Karel; Špak, Josef

    2009-01-01

    Roč. 124, č. 1 (2009), s. 181-185. ISSN 0929-1873 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : Electron microscopy * 16SrVI Clover proliferation group * Phytoplasma Subject RIV: EE - Microbiology, Virology Impact factor: 1.931, year: 2009

  18. First Report of 'Candidatus Liberibacter solanacearum' in Carrots in Europe

    Science.gov (United States)

    Carrot (Daucus carota) plants exhibiting symptoms that resembled those of carrot psyllid (Trioza apicalis) damage were observed in commercial fields in southern Finland in August 2008. Carrot psyllid is a serious pest of carrots in northern and central Europe, where it can cause up to 100% yield los...

  19. First report of 'Candidatus Liberibacter solanacearum' on carrot in Africa

    Science.gov (United States)

    In March of 2014, carrot plants (Daucus carota L. var. Mascot) exhibiting symptoms of yellowing, purpling, and curling of leaves, proliferation of shoots, formation of hairy secondary roots, general stunting and plant decline were observed in commercial fields in the Gharb region of Morocco. The sym...

  20. Ubiquity of Putative Type III Secretion Genes among Clinical and Environmental Burkholderia pseudomallei Isolates in Northern Australia

    OpenAIRE

    Smith-Vaughan, H C; Gal, D; Lawrie, P. M.; Winstanley, C.; Sriprakash, K S; Currie, B. J.

    2003-01-01

    Horseradish peroxidase-like type III secretion (TTS1) genes were present in all 116 Northern Australian Burkholderia pseudomallei isolates tested but were not detected in other common environmental Burkholderia species. PCR of TTS1 genes may prove valuable as a diagnostic test.

  1. Momentum Images of Continuum Electrons from He+ and He2+ on He: Ubiquity of π Structure in the Continuum

    International Nuclear Information System (INIS)

    Cold target recoil ion momentum spectroscopy has been used to image the momentum distributions of continuum electrons liberated in the impact of slow He+ and He2+ ions on He. The distributions were measured for fully determined vector impact parameter. The spectra show that the electron momenta lie mainly in the collision plane and display a structure which strongly suggests that it is π states which are dominantly promoted into the continuum in such collisions, but that interfering σ and perhaps δ amplitudes are also important. copyright 1998 The American Physical Society

  2. Snapshot of Viral Infections in Wild Carnivores Reveals Ubiquity of Parvovirus and Susceptibility of Egyptian Mongoose to Feline Panleukopenia Virus

    OpenAIRE

    Duarte, Margarida D.; Ana Margarida Henriques; Sílvia Carla Barros; Teresa Fagulha; Paula Mendonça; Paulo Carvalho; Madalena Monteiro; Miguel Fevereiro; Basto, Mafalda P.; Luís Miguel Rosalino; Tânia Barros; Victor Bandeira; Carlos Fonseca; Cunha, Mónica V.

    2013-01-01

    The exposure of wild carnivores to viral pathogens, with emphasis on parvovirus (CPV/FPLV), was assessed based on the molecular screening of tissue samples from 128 hunted or accidentally road-killed animals collected in Portugal from 2008 to 2011, including Egyptian mongoose (Herpestes ichneumon, n = 99), red fox (Vulpes vulpes, n = 19), stone marten (Martes foina, n = 3), common genet (Genetta genetta, n = 3) and Eurasian badger (Meles meles, n = 4). A high prevalence of parvovirus DNA (63%...

  3. The Ubiquity of Good Taste: A Spatial Analysis of the Craft Brewing Industry in the United States

    OpenAIRE

    Reid, Neil; Mclaughlin, Ralph; Moore, Michael

    2013-01-01

    The performance and composition of the U.S. brewing industry has changed dramatically over the past three decades. The industry displays contradictory shifts in both aggregate production volume and number of firms. While aggregate beer production in the US has increased modestly, per capita production has decreased steadily since the early 1980s, dropping 26 percent between 1981 and 2011. However, the number of brewing establishments increased substantially during the same period, expanding f...

  4. High diversity of microplankton surrounds deep-water coral reef in the Norwegian Sea.

    Science.gov (United States)

    Jensen, Sigmund; Bourne, David G; Hovland, Martin; Murrell, J Colin

    2012-10-01

    Coral reefs that exist in the depths of the oceans are surrounded by Eukarya, Archaea and bacterial communities that may play an important role in the nutrition and health of the reef. The first interdomain community structure of planktonic organisms in seawater from a deep-water coral reef is described. Community profiling and analysis of ribosomal RNA gene sequences from a coral reef system at 350 m depth in the Norwegian Sea revealed a rich diversity of Eukarya and Bacteria and a moderate diversity of Archaea. Most sequences affiliated with marine microplankton from deep-sea to cold-surface regions, with many sequences being similar to those described in studies of mesopelagic and oxygen minimum zones. Dominant phylotypes belonged to the Alveolata (group I, II, dinoflagellates), Stramenopiles (silicoflagellates), Alphaproteobacteria (Pelagibacter ubique), Gammaproteobacteria (ARCTIC96BD-19), Bacteroidetes (Flavobacteria) and mesophilic Crenarchaeota (Nitrosopumilus maritimus). Several rare and novel members of the community fell into distinct phylogenetic groups. The inferred function of dominant community members suggested autotrophs that utilise light, ammonium or sulphide, and lifestyles based on host associations. The high diversity reflected a microplankton community structure, which is significantly different from that of microplankton collected at the same depth at a pelagic station away from reefs. PMID:22571287

  5. Amplification of 16S ribosomal RNA genes of autotrophic ammonia-oxidizing bacteria demonstrates the ubiquity of nitrosospiras in the environment.

    Science.gov (United States)

    Hiorns, W D; Hastings, R C; Head, I M; McCarthy, A J; Saunders, J R; Pickup, R W; Hall, G H

    1995-11-01

    Oligonucleotide sequences selected from the 16S rRNA genes of various species of ammonia-oxidizing bacteria were evaluated as specific PCR amplification primers and probes. The specificities of primer pairs for eubacterial, Nitrosospira and Nitrosomonas rRNA genes were established with sequence databases, and the primer pairs were used to amplify DNA from laboratory cultures and environmental samples. Eubacterial rRNA genes amplified from samples of soil and activated sludge hybridized with an oligonucleotide probe specific for Nitrosospira spp., but not with a Nitrosomonas-specific probe. Lakewater and sediment samples were analysed using a nested PCR technique in which eubacterial rRNA genes were subjected to a secondary amplification with Nitrosomonas or Nitrosospira specific primers. Again, the presence of Nitrosospira DNA, but not Nitrosomonas DNA, was detected and this was confirmed by hybridization of the amplified DNA with an internal oligonucleotide probe. Enrichments of lakewater and sediment samples, incubated for two weeks in the presence of ammonium, produced nitrite and were found to contain DNA from both Nitrosospira and Nitrosomonas as determined by nested PCR amplification and probing of 16S rRNA genes. This demonstrates that Nitrosospira spp. are widespread in the environment. The implications of the detection of Nitrosomonas DNA only after enrichment culture are discussed. PMID:8535507

  6. Origin and Ubiquity of Short-Period Earth-like Planets: Evidence for the Sequential-Accretion Theory of Planet Formation

    CERN Document Server

    Zhou, J L; Lin, D N C; Nagasawa, M

    2005-01-01

    The formation of gas giant planets is assumed to be preceded by the emergence of solid cores in the conventional sequential-accretion paradigm. This hypothesis implies that the presence of earth-like planets can be inferred from the detection of gas giants. A similar prediction cannot be made with the gravitational instability (hereafter GI) model which assumes that gas giants (hereafter giants) formed from the collapse of gas fragments analogous to their host stars. We propose an observational test for the determination of the dominant planet-formation channel. Based on the sequential-accretion (hereafter SA) model, we identify several potential avenues which may lead to the prolific formation of a population of close-in earth-mass ($M_\\oplus$) planets (hereafter close-in earths) around stars with 1) short-period or 2) solitary eccentric giants and 3) systems which contain intermediate-period resonant giants. In contrast, these close-in earths are not expected to form in systems where giants originated rapid...

  7. The Black Queen Hypothesis: evolution of dependencies through adaptive gene loss.

    Science.gov (United States)

    Morris, J Jeffrey; Lenski, Richard E; Zinser, Erik R

    2012-01-01

    Reductive genomic evolution, driven by genetic drift, is common in endosymbiotic bacteria. Genome reduction is less common in free-living organisms, but it has occurred in the numerically dominant open-ocean bacterioplankton Prochlorococcus and "Candidatus Pelagibacter," and in these cases the reduction appears to be driven by natural selection rather than drift. Gene loss in free-living organisms may leave them dependent on cooccurring microbes for lost metabolic functions. We present the Black Queen Hypothesis (BQH), a novel theory of reductive evolution that explains how selection leads to such dependencies; its name refers to the queen of spades in the game Hearts, where the usual strategy is to avoid taking this card. Gene loss can provide a selective advantage by conserving an organism's limiting resources, provided the gene's function is dispensable. Many vital genetic functions are leaky, thereby unavoidably producing public goods that are available to the entire community. Such leaky functions are thus dispensable for individuals, provided they are not lost entirely from the community. The BQH predicts that the loss of a costly, leaky function is selectively favored at the individual level and will proceed until the production of public goods is just sufficient to support the equilibrium community; at that point, the benefit of any further loss would be offset by the cost. Evolution in accordance with the BQH thus generates "beneficiaries" of reduced genomic content that are dependent on leaky "helpers," and it may explain the observed nonuniversality of prototrophy, stress resistance, and other cellular functions in the microbial world. PMID:22448042

  8. Natural sunlight shapes crude oil-degradingbacterial communities in northern Gulf of Mexico surface waters

    Directory of Open Access Journals (Sweden)

    Hernando P Bacosa

    2015-12-01

    Full Text Available Following the Deepwater Horizon (DWH spill in 2010, an enormous amount of oil was observed in the deep and surface waters of the northern Gulf of Mexico. Surface waters are characterized by intense sunlight and high temperature during summer. While the oil-degrading bacterial communities in the deep-sea plume have been widely investigated, the effect of natural sunlight on those in oil polluted surface waters remains unexplored to date. In this study, we incubated surface water from the DWH site with amendments of crude oil, Corexit dispersant, or both for 36 d under natural sunlight in the northern Gulf of Mexico. The bacterial community was analyzed over time for total abundance, density of alkane and polycyclic aromatic hydrocarbon degraders, and community composition via pyrosequencing. Our results showed that, for treatments with oil and/or Corexit, sunlight significantly reduced bacterial diversity and evenness and was a key driver of shifts in bacterial community structure. In samples containing oil or dispersant, sunlight greatly reduced abundance of the Cyanobacterium Synechococcus but increased the relative abundances of Alteromonas, Marinobacter, Labrenzia, Sandarakinotalea, Bartonella, and Halomonas. Dark samples with oil were represented by members of Thalassobius, Winogradskyella, Alcanivorax, Formosa, Pseudomonas, Eubacterium, Erythrobacter, Natronocella, and Coxiella. Both oil and Corexit inhibited the Candidatus Pelagibacter with or without sunlight exposure. For the first time, we demonstrated the effects of light in structuring microbial communities in water with oil and/or Corexit. Overall, our findings improve understanding of oil pollution in surface water, and provide unequivocal evidence that sunlight is a key factor in determining bacterial community composition and dynamics in oil polluted marine waters.

  9. The Microbial Community on Marine Plastic Debris: Life in the "Plastisphere"

    Science.gov (United States)

    Amaral-Zettler, L. A.; Zettler, E. R.; Mincer, T. J.

    2011-12-01

    Plastic debris is an abundant substrate of anthropogenic origin in the marine environment that is receiving increased attention. We documented the bacterial (V6-V4) and eukaryotic (V9) communities on open ocean plastic debris samples using 454 amplicon sequencing of small-subunit rRNA hypervariable regions and Scanning Electron Microscopy (SEM). Parametric alpha diversity measures of plastic samples showed considerable species richness comparable to the surrounding seawater with many Operational Taxonomic Units (OTUs) unique to the plastic substrates. We also found that while all samples contained an OTU assigned to SAR 11 (Candidatus Pelagibacter), considered to be one of most abundant heterotrophic bacteria in the ocean, this was not the most abundant OTU in our samples. Quite surprisingly, the most abundant OTU found in our polypropylene sample was an OTU assigned to the genus Vibrio. Although endemic to the marine environment, the genus Vibrio has several members that are human and animal pathogens. Our samples also included representatives from many protist groups and fungi. Sequences recovered were dominated by heterotrophs including an unidentified sequence related to colonial radiolaria and suctorian ciliates, but many photosynthetic groups including dinoflagellates, diatoms, and green, brown, and red algae were also present. SEM images revealed a complex landscape of microbes on the surface of the plastic; rich bacterial biofilms included diatoms and stalked suctorian ciliates covered with what appeared to be bacterial epibionts. The fact that these communities are distinct from the surrounding surface water suggests that plastic surfaces may serve as a unique new ecological habitat in the open ocean and warrant further investigation. We have proposed the term "Plastisphere" to describe the community of organisms closely associated with plastic debris in aquatic systems.

  10. Natural Sunlight Shapes Crude Oil-Degrading Bacterial Communities in Northern Gulf of Mexico Surface Waters.

    Science.gov (United States)

    Bacosa, Hernando P; Liu, Zhanfei; Erdner, Deana L

    2015-01-01

    Following the Deepwater Horizon (DWH) spill in 2010, an enormous amount of oil was observed in the deep and surface waters of the northern Gulf of Mexico. Surface waters are characterized by intense sunlight and high temperature during summer. While the oil-degrading bacterial communities in the deep-sea plume have been widely investigated, the effect of natural sunlight on those in oil polluted surface waters remains unexplored to date. In this study, we incubated surface water from the DWH site with amendments of crude oil, Corexit dispersant, or both for 36 days under natural sunlight in the northern Gulf of Mexico. The bacterial community was analyzed over time for total abundance, density of alkane and polycyclic aromatic hydrocarbon degraders, and community composition via pyrosequencing. Our results showed that, for treatments with oil and/or Corexit, sunlight significantly reduced bacterial diversity and evenness and was a key driver of shifts in bacterial community structure. In samples containing oil or dispersant, sunlight greatly reduced abundance of the Cyanobacterium Synechococcus but increased the relative abundances of Alteromonas, Marinobacter, Labrenzia, Sandarakinotalea, Bartonella, and Halomonas. Dark samples with oil were represented by members of Thalassobius, Winogradskyella, Alcanivorax, Formosa, Pseudomonas, Eubacterium, Erythrobacter, Natronocella, and Coxiella. Both oil and Corexit inhibited the Candidatus Pelagibacter with or without sunlight exposure. For the first time, we demonstrated the effects of light in structuring microbial communities in water with oil and/or Corexit. Overall, our findings improve understanding of oil pollution in surface water, and provide unequivocal evidence that sunlight is a key factor in determining bacterial community composition and dynamics in oil polluted marine waters. PMID:26648916

  11. Diversity and Temporal Dynamics of the Epiphytic Bacterial Communities Associated with the Canopy-Forming Seaweed Cystoseira compressa (Esper) Gerloff and Nizamuddin.

    Science.gov (United States)

    Mancuso, Francesco P; D'Hondt, Sofie; Willems, Anne; Airoldi, Laura; De Clerck, Olivier

    2016-01-01

    Canopy-forming seaweed species of the genus Cystoseira form diverse and productive habitats along temperate rocky coasts of the Mediterranean Sea. Despite numerous studies on the rich macrofauna and flora associated with Cystoseira spp., there is little knowledge about the epiphytic bacteria. We analyzed bacterial populations associated with canopies of Cystoseira compressa, over an annual vegetative cycle (May-October), and their relationships with the bacterial populations in the surrounding seawater, at intertidal rocky shores in Vasto (Chieti-Italy). The bacterial diversity was assessed using Illumina Miseq sequences of V1-V3 hypervariable regions of 16S rRNA gene. C. compressa bacterial community was dominated by sequences of Proteobacteria and Bacteroidetes, Verrucomicrobia, Actinobacteria, and Cyanobacteria especially of the Rhodobacteriaceae, Flavobacteriaceae, Sapropiraceae, Verrucomicrobiaceae, and Phyllobacteriaceae families. Seawater libraries were also dominated by Proteobacteria and Bacteroidetes sequences, especially of the Candidatus Pelagibacter (SAR11) and Rhodobacteriaceae families, but were shown to be clearly distinct from C. compressa libraries with only few species in common between the two habitats. We observed a clear successional pattern in the epiphytic bacteria of C. compressa over time. These variations were characterized by gradual addition of OTUs (Verrucomicrobia, Actinobacteria and SR1) to the community over a growing season, indicative of a temporal gradient, rather than a radical reorganization of the bacterial community. Moreover, we also found an increase in abundance over time of Rhodobacteraceae, comprising six potential pathogenic genera, Ruegeria, Nautella, Aquimarina, Loktanella, Saprospira, and Phaeobacter which seemed to be associated to aged thalli of C. compressa. These bacteria could have the potential to affect the health and ecology of the algae, suggesting the hypothesis of a possible, but still unexplored, role of

  12. Anaerobic ammonium oxidation by marine and freshwater planctomycete-like bacteria RID B-8834-2011 RID B-5428-2008 RID C-3269-2011 RID D-1875-2009

    DEFF Research Database (Denmark)

    Jetten, MSM; Sliekers, O.; Kuypers, M.; Dalsgaard, T.; Niftrik, L. van; Cirpus, I.; Pas-Schoonen, K. van de; Lavik, G.; Thamdrup, B.; Paslier, D. Le; Camp, HJM Op den; Hulth, S.; Nielsen, LP; Abma, W.; Third, K.; Engstrom, P.; Kuenen, JG; Jørgensen, BB; Canfield, DE; Damste, JSS; Revsbech, NP; Fuerst, J.; Weissenbach, J.; Wagner, M.; Schmidt, I.; Schmid, M.; Strous, M.

    2003-01-01

    Recently, two fresh water species, 'Candidatus Brocadia anammoxidans' and 'Candidatus Kuenenia stuttgartiensis', and one marine species, 'Candidatus Scalindua sorokinii', of planctomycete anammox bacteria have been identified. 'Candidatus Scalindua sorokinii' was discovered in the Black Sea, and...

  13. Home Detection Kit for Candidatus Liberibacter asiaticus (LAS) Associated with Citrus Huanglongbing from Psyllids

    OpenAIRE

    Keremane, Manjunath L.; Ramadugu, Chandrika; Kubota, Ryo; Duan, Yongping; Hall, David; Jenkins, Daniel; Richard F. Lee

    2014-01-01

    Management of citrus huanglongbing (HLB) requires rapid detection of infected psyllids and trees in an orchard. Detection of HLB associated bacteria (LAS) can be done using psyllids since detection in infected trees is usually delayed (Manjunath et al., 2008). We have developed an easy to use, rapid and affordable detection kit for grower use for testing psyllids for LAS at a reasonable price for initial investment and an operating cost of about $2 per sample.. Eight psyllid samples can be si...

  14. Is the striped mealybug, Ferrisia virgata, a vector of huanglongbing bacterium ‘Candidatus Liberibacter asiaticus’

    Science.gov (United States)

    This is the first report of ‘Ca. L. asiaticus’ (Las) present in striped mealybugs feeding on Las-infected periwinkle plants. In November 2010, specimens of a common greenhouse pest, the striped mealybug Ferrisia virgata (Cockerell) (Pseudococcidae; Hemiptera), were collected from Las-infected periw...

  15. Comparative genomics of two independently enriched ‘Candidatus Kuenenia stuttgartiensis’ anammox bacteria

    Directory of Open Access Journals (Sweden)

    DaanRSpeth

    2012-08-01

    Here we present a comparative genomic analysis of two ‘Ca. K. stuttgartiensis’ anammox bacteria that were independently enriched, with the aim to understand more about the evolution, cell plan and metabolism of these important microbes and to further improve and complete the reference genome. The two anammox bacteria used are ‘Ca. K. stuttgartiensis’ RU1, which was originally sequenced for the reference genome in 2002, and for the present study resequenced after seven (2002-2009 years in continuous culture. Furthermore ‘Ca. K. stuttgartiensis’ CH1, enriched from a Chinese wastewater treatment plant was used as an independent source of genomic information. The two different ‘Ca. Kuenenia’ bacteria showed a very high sequence identity (> 99 % at nucleotide level over the entire genome, but 31 genomic regions (average size 11 kb were absent from strain CH1 and 220 kb of sequence was specifically found in the CH1 assembly. The high sequence homology between these two bacteria indicates that mobile genetic elements are the main source of variation between these geographically widely separated strains.

  16. DNA barcoding for identification of 'Candidatus Phytoplasmas' using a fragment of the elongation factor Tu gene.

    Directory of Open Access Journals (Sweden)

    Olga Makarova

    Full Text Available BACKGROUND: Phytoplasmas are bacterial phytopathogens responsible for significant losses in agricultural production worldwide. Several molecular markers are available for identification of groups or strains of phytoplasmas. However, they often cannot be used for identification of phytoplasmas from different groups simultaneously or are too long for routine diagnostics. DNA barcoding recently emerged as a convenient tool for species identification. Here, the development of a universal DNA barcode based on the elongation factor Tu (tuf gene for phytoplasma identification is reported. METHODOLOGY/PRINCIPAL FINDINGS: We designed a new set of primers and amplified a 420-444 bp fragment of tuf from all 91 phytoplasmas strains tested (16S rRNA groups -I through -VII, -IX through -XII, -XV, and -XX. Comparison of NJ trees constructed from the tuf barcode and a 1.2 kbp fragment of the 16S ribosomal gene revealed that the tuf tree is highly congruent with the 16S rRNA tree and had higher inter- and intra- group sequence divergence. Mean K2P inter-/intra- group divergences of the tuf barcode did not overlap and had approximately one order of magnitude difference for most groups, suggesting the presence of a DNA barcoding gap. The use of the tuf barcode allowed separation of main ribosomal groups and most of their subgroups. Phytoplasma tuf barcodes were deposited in the NCBI GenBank and Q-bank databases. CONCLUSIONS/SIGNIFICANCE: This study demonstrates that DNA barcoding principles can be applied for identification of phytoplasmas. Our findings suggest that the tuf barcode performs as well or better than a 1.2 kbp fragment of the 16S rRNA gene and thus provides an easy procedure for phytoplasma identification. The obtained sequences were used to create a publicly available reference database that can be used by plant health services and researchers for online phytoplasma identification.

  17. Association of 'Candidatus Liberibacter solanacearum' with the Psyllid, Trioza apicalis (Hemiptera: Triozidae) in Europe

    Science.gov (United States)

    Carrot psyllid (Trioza apicalis Förster) is a serious pest of carrots (Daucus carota L.) in northern and central Europe. Carrots exhibiting symptoms of psyllid damage were observed in commercial fields in southern Finland in 2008. Symptoms in affected plants included leaf curling, yellow and purple ...

  18. Seasonal shifts in Candidatus Liberibacter asiaticus prevalence in the vector Diaphorina citri in Florida

    OpenAIRE

    Ebert, Timothy A.; Brlansky, Ronald H.; Rogers, Michael E.

    2014-01-01

    Psyllid populations at six locations in central Florida and one location in southern Florida were sampled monthly and the proportion of adult psyllids carrying Liberibacter asiaticus was measured using QPCR of pooled samples. The Florida Automated Weather Network was used to estimate environmental conditions at these locations. Prevalence was highest during the last three months of the year, but psyllids with Liberibacter asiaticus could be found at all times. Fluctuations in prevalence assoc...

  19. Evolutionary Relationships of “Candidatus Endobugula” Bacterial Symbionts and Their Bugula Bryozoan Hosts▿

    OpenAIRE

    Lim-Fong, Grace E.; Regali, Lindsay A.; Haygood, Margo G.

    2008-01-01

    Ribosomal gene sequences were obtained from bryozoans in the genus Bugula and their bacterial symbionts; analyses of host and symbiont phylogenetic trees did not support a history of strict cospeciation. Symbiont-derived compounds known to defend host larvae from predation were only detected in two out of four symbiotic Bugula species.

  20. Hydroxylamine-dependent Anaerobic Ammonium Oxidation (Anammox) by “ Candidatus Brocadia sinica”

    KAUST Repository

    Oshiki, Mamoru

    2016-04-26

    Although metabolic pathways and associated enzymes of anaerobic ammonium oxidation (anammox) of “Ca. Kuenenia stuttgartiensis” have been studied, those of other anammox bacteria are still poorly understood. NO2- reduction to NO is considered to be the first step in the anammox metabolism of “Ca. K. stuttgartiensis”, however, “Ca. Brocadia” lacks the genes that encode canonical NO-forming nitrite reductases (NirS or NirK) in its genome, which is different from “Ca. K. stuttgartiensis”. Here, we studied the anammox metabolism of “Ca. Brocadia sinica”. 15N-tracer experiments demonstrated that “Ca. B. sinica” cells could reduce NO2- to NH2OH, instead of NO, with as yet unidentified nitrite reductase(s). Furthermore, N2H4 synthesis, downstream reaction of NO2- reduction, was investigated using a purified “Ca. B. sinica” hydrazine synthase (Hzs) and intact cells. Both the “Ca. B. sinica” Hzs and cells utilized NH2OH and NH4+, but not NO and NH4+, for N2H4 synthesis and further oxidized N2H4 to N2 gas. Taken together, the metabolic pathway of “Ca. B. sinica” is NH2OH-dependent and different from the one of “Ca. K. stuttgartiensis”, indicating metabolic diversity of anammox bacteria. This article is protected by copyright. All rights reserved.

  1. Genetic diversity of Czech ‘Candidatus Phytoplasma mali’ strains based on multilocus gene analyses

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Ludvíková, H.; Paprštein, F.; Bertaccini, A.

    2013-01-01

    Roč. 136, č. 4 (2013), s. 675-688. ISSN 0929-1873 R&D Projects: GA MŠk OC09021; GA MŠk LD12074 Institutional support: RVO:60077344 Keywords : Apple proliferation * PCR/RFLP * sequencing Subject RIV: EE - Microbiology, Virology Impact factor: 1.707, year: 2013

  2. Identification of Candidatus Liberibacter asiaticus from Foshou (Citrus medica) in China

    Science.gov (United States)

    In China, Foshou (Buddha’s hand), C. medica var. sarcodactylus Swing, is commonly cultured and valued for its fragrance and used medicinally as a stomach, stimulant, expectorant and tonic. Since 1999, we noted that Foshou succumbs to Huanglongbing (HLB) or yellow shoot disease with incidence up to 4...

  3. Metabolic model for the filamentous ‘Candidatus Microthrix parvicella’ based on genomic and metagenomic analyses

    DEFF Research Database (Denmark)

    McIlroy, Simon Jon; Kristiansen, Rikke; Albertsen, Mads;

    2013-01-01

    acids as triacylglycerols. Utilisation of trehalose and/or polyphosphate stores or partial oxidation of long-chain fatty acids may supply the energy required for anaerobic lipid uptake and storage. Comparing the genome sequence of this isolate with metagenomes from two full-scale wastewater treatment...

  4. DNA Barcoding for Identification of "Candidatus Phytoplasmas" Using a Fragment of the Elongation Factor Tu Gene

    DEFF Research Database (Denmark)

    Makarova, Olga; Contaldo, Nicoletta; Paltrinieri, Samanta;

    2012-01-01

    different groups simultaneously or are too long for routine diagnostics. DNA barcoding recently emerged as a convenient tool for species identification. Here, the development of a universal DNA barcode based on the elongation factor Tu (tuf) gene for phytoplasma identification is reported. Methodology....../Principal Findings We designed a new set of primers and amplified a 420–444 bp fragment of tuf from all 91 phytoplasmas strains tested (16S rRNA groups -I through -VII, -IX through -XII, -XV, and -XX). Comparison of NJ trees constructed from the tuf barcode and a 1.2 kbp fragment of the 16S ribosomal gene revealed...... that the tuf tree is highly congruent with the 16S rRNA tree and had higher inter- and intra- group sequence divergence. Mean K2P inter−/intra- group divergences of the tuf barcode did not overlap and had approximately one order of magnitude difference for most groups, suggesting the presence of a DNA...

  5. Candidatus Phytoplasma malaysianum, a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus)

    Science.gov (United States)

    This study addressed the taxonomic position and group classification of a phytoplasma responsible for virescence and phyllody symptoms in naturally diseased Madagascar periwinkle plants in western Malaysia. Unique regions in the 16S rRNA gene from the Malaysian periwinkle virescence (MaPV) phytopla...

  6. Candidatus Sodalis melophagi sp. nov.: Phylogenetically Independent Comparative Model to the Tsetse Fly Symbiont Sodalis glossinidius

    Czech Academy of Sciences Publication Activity Database

    Chrudimský, T.; Husník, Filip; Nováková, Eva; Hypša, Václav

    2012-01-01

    Roč. 7, č. 7 (2012), e40354. E-ISSN 1932-6203 R&D Projects: GA MŠk LC06073 Grant ostatní: GA MŠk(CZ) LM2010005; GA ČR(CZ) GAP505/10/1401 Institutional support: RVO:60077344 Keywords : III SECRETION SYSTEMS * SECONDARY ENDOSYMBIONT * INSECT ENDOSYMBIONT * WIGGLESWORTHIA-GLOSSINIDIA * MAXIMUM-LIKELIHOOD * MULTIPLE TIMES * FLIES * EVOLUTION * HOST * BACTERIA Subject RIV: EE - Microbiology, Virology Impact factor: 3.730, year: 2012 http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0040354

  7. Characterization of an ATP translocase identified in the plant pathogen, Candidatus Liberibacter asiaticus

    Science.gov (United States)

    ATP/ADP translocases allow for the transport of ATP across a lipid bilayer, which is normally impermeable to this molecule due to its size and charge. These transport proteins appear to be unique to mitochondria, plant plastids, and obligate-intracellular bacteria. Of the bacterial ATP/ADP translo...

  8. Rest-frame Optical Emission Lines in z ˜ 3.5 Lyman-break-selected Galaxies: The Ubiquity of Unusually High [OIII]/Hβ Ratios at 2 Gyr

    Science.gov (United States)

    Holden, B. P.; Oesch, P. A.; González, V. G.; Illingworth, G. D.; Labbé, I.; Bouwens, R.; Franx, M.; van Dokkum, P.; Spitler, L.

    2016-03-01

    We present K-band spectra of rest-frame optical emission lines for 24 star-forming galaxies at z ˜ 3.2-3.7 using MOSFIRE on the Keck I telescope. Strong rest-frame optical [O iii] and Hβ emission lines were detected in 18 Lyman break galaxies (LBGs). The median flux ratio of [O iii]λ5007 to Hβ is {5.1}-0.5+0.5. This is a factor of 5-10 times higher than in local galaxies with similar stellar masses. None of our sources are detected in deep X-ray stacks, ruling out significant contamination by active galactic nuclei. Combining our sample with a variety of LBGs from the literature, including 49 galaxies selected in a very similar manner, we find a high median ratio of [O iii]/Hβ = {4.8}-1.7+0.8. This high ratio seems to be a ubiquitous feature of z ˜ 3-4 LBGs, very different from typical local star-forming galaxies at similar stellar masses. The only comparable systems at z ˜ 0 are those with similarly high specific star formation rates (SSFRs), though ˜5 times lower stellar masses. High SSFRs may result in a higher ionization parameter, higher electron density, or harder ionizing radiation, which, combined different elemental abundances, result in a much higher [O iii]/Hβ line ratio. This implies a strong relation between a global property of a galaxy, the SSFR, and the local conditions of ISM in star-forming regions. Partially based on data obtained with the Hubble Space Telescope operated by AURA, Inc. for NASA under contract NAS5-26555. Partially based on observations with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under NASA contract 1407.

  9. Relación entre Bactericera cockerelli y presencia de Candidatus Liberibacter psyllaurous en lotes comerciales de papa Relation between Bactericera cockerelli and presence of Candidatus Liberibacter psyllaurous in commercial fields of potato

    OpenAIRE

    Oswaldo Ángel Rubio-Covarrubias; Isidro Humberto Almeyda-León; Mateo Armando Cadena-Hinojosa; René Lobato-Sánchez

    2011-01-01

    La brotación anormal de los tubérculos (sin brotes o brotes ahilados) y el pardeamiento interno de los tubérculos, son síntomas de una enfermedad que está afectando la producción de papa en México, en el suroeste de Estados Unidos y América central. Esta enfermedad ha sido asociada con el psilido de la papa Bactericera cockerelli Sulc. Con el objetivo de dilucidar las causas de esta enfermedad, en 2007 se llevó a cabo un muestreo en 11 lotes comerciales de papa localizados en un transecto alt...

  10. Molecular detection of Candidatus liberibacter asiaticus associated with Citrus greening (Huanglongbing of mandarin by DNA template preparation

    Directory of Open Access Journals (Sweden)

    G.P. Jagtap

    2013-02-01

    Full Text Available The polymerase Chain Reaction (PCR diagnosis is more reliable and sensitive diagnostic tool for detecting greening bacterium than other conventional approaches like Electron microscopy, DNA-DNA hybridization and immunofluorescence (IF for detection of citrus greening. During experiments, it was observed that sodium sulphite method of DNA isolation provided higher yield and better quality DNA than other methods. Primer C (450 bp was more efficient in amplifying the DNA of greening bacterium even at a very low concentration of 0.1 pg. To confirm the reliability of PCR, the greening bacterium was also detected in graft-inoculated plants, which showed typical greening bacterium was also detected in graft-inoculated plants, which showed typical greening symptoms. Results showed amplification of 450 bp in PCR suggesting sampling in March is more suitable for PCR detection of greening bacterium.

  11. First report of a natural infection of Opuntia sp. by a 'Candidatus Phytoplasma asteris'-related phytoplasma in China

    Science.gov (United States)

    Cacti (Opuntia spp.) are perennial, evergreen, succulent plants native to arid areas of the Americas and West Indies. Because of their aesthetic appearance, many cacti have been cultivated and introduced into the international market as ornamental landscaping and house plants. Cacti are susceptibl...

  12. Distribution of the Primary Endosymbiont (Candidatus Uzinura Diaspidicola Within Host Insects from the Scale Insect Family Diaspididae

    Directory of Open Access Journals (Sweden)

    Katharina Dittmar

    2012-02-01

    Full Text Available It has long been known that armored scale insects harbor endosymbiotic bacteria inside specialized cells called bacteriocytes. Originally, these endosymbionts were thought to be fungal symbionts but they are now known to be bacterial and have been named Uzinura diaspidicola. Bacteriocyte and endosymbiont distribution patterns within host insects were visualized using in situ hybridization via 16S rRNA specific probes. Images of scale insect embryos, eggs and adult scale insects show patterns of localized bacteriocytes in embryos and randomly distributed bacteriocytes in adults. The symbiont pocket was not found in the armored scale insect eggs that were tested. The pattern of dispersed bacteriocytes in adult scale insects suggest that Uzinura and Blattabacteria may share some homologous traits that coincide with similar life style requirements, such as dispersal in fat bodies and uric acid recycling.

  13. Incidence of “Candidatus Liberibacter solanacearum” in potato psyllids collected in the south-central United States

    Science.gov (United States)

    In the last 10-15 years, the “zebra chip” (ZC) disease of chipping potatoes has been causing significant economic damage in the US, especially in Texas, Nebraska, Kansas, Colorado, and Wyoming. The disease also occurs in Mexico, Central America, and was recently reported in New Zealand. In about 2...

  14. Translating Anatomical Structures and Functional Genomics of Candidatus Liberibacter asiaticus and solanacearum Into Circulative, Propagative Vector-Mediated Transmission Processes

    OpenAIRE

    Fisher, T.; Cicero, J.; Vyas, M; R. He; Nelson, W; Willer, M.; Soderlund, C.; Gang, D.; Brown, J. K.

    2014-01-01

    Ca. Liberibacter asiaticus is the putative fastidious bacterial causal agent of citrus greening disease, also known as Huanglongbing (HLB), translated from Chinese as yellow dragon disease. The HLB bacterial pathogen is indigenous to Asia but has been introduced and dispersed to citrus throughout the Americas. A related bacterium that is indigenous to the Americas causes damage to potato (zebra chip) and tomato (vein-greening) and other solanaceous hosts. The causal agents are propagative and...

  15. Phylogeny and FISH probe analysis of the “Candidatus Competibacter”-lineage in wastewater treatment systems

    DEFF Research Database (Denmark)

    Nittami, Tadashi; McIlroy, Simon Jon; Kanai, Eri;

    Our understanding of the microbial ecology of enhanced biological phosphorus removal (EBPR) wastewater treatment systems has been greatly advanced through the application of molecular methods such as fluorescence in situ hybridization (FISH). Considerable attention has been directed at the...

  16. Tissue-associated "Candidatus Mycoplasma corallicola" and Filamentous bacteria on the cold-water coral Lophelia pertusa (Scleractinia)

    OpenAIRE

    Neulinger, Sven; Gärtner, Andrea; Järnegren, J.; Ludvigsen, M; Lochte, Karin; Dullo, Wolf-Christian

    2009-01-01

    The cold-water coral Lophelia pertusa (Scleractinia, Caryophylliidae) is a key species in the formation of cold-water reefs, which are among the most diverse deep-sea ecosystems. It occurs in two color varieties: white and red. Bacterial communities associated with Lophelia have been investigated in recent years, but the role of the associated bacteria remains largely obscure. This study uses catalyzed reporter deposition fluorescence in situ hybridization to detect the in situ location of sp...

  17. Survey of 'Candidatus Liberibacter solanacearum' in carrot crops affected by the psyllid Trioza apicalis (Hemiptera: Triozidae) in Norway

    Science.gov (United States)

    The carrot psyllid Trioza apicalis Förster (Hemiptera: Triozidae) is a serious insect pest of carrot (Daucus carota L.) in northern Europe, where it can cause up to 100% crop loss. Although it was long believed that T. apicalis causes damage to carrot by injection of toxins into the plant, it was re...

  18. Vector competence of the blacklegged tick, Ixodes scapularis, for the recently recognized Lyme borreliosis spirochete Candidatus Borrelia mayonii.

    Science.gov (United States)

    Dolan, Marc C; Hojgaard, Andrias; Hoxmeier, J Charles; Replogle, Adam J; Respicio-Kingry, Laurel B; Sexton, Christopher; Williams, Martin A; Pritt, Bobbi S; Schriefer, Martin E; Eisen, Lars

    2016-07-01

    A novel species within the Borrelia burgdorferi sensu lato complex, provisionally named Borrelia mayonii, was recently found to be associated with Lyme borreliosis in the Upper Midwest of the United States. Moreover, B. mayonii was detected from host-seeking Ixodes scapularis, the primary vector of B. burgdorferi sensu stricto in the eastern United States. We therefore conducted a study to confirm the experimental vector competence of I. scapularis for B. mayonii (strain MN14-1420), using colony ticks originating from adults collected in Connecticut and CD-1 white mice. Larvae fed on mice 10 weeks after needle-inoculation with B. mayonii acquired spirochetes and maintained infection through the nymphal stage at an average rate of 12.9%. In a transmission experiment, 40% of naïve mice exposed to a single infected nymph developed viable infections, as compared with 87% of mice fed upon by 2-3 infected nymphs. Transmission of B. mayonii by one or more feeding infected nymphs was uncommon up to 48h after attachment (one of six mice developed viable infection) but occurred frequently when nymphs were allowed to remain attached for 72-96h or feed to completion (11 of 16 mice developed viable infection). Mice infected via tick bite maintained viable infection with B. mayonii, as determined by ear biopsy culture, for at least 28 weeks. Our results demonstrate that I. scapularis is capable of serving as a vector of B. mayonii. This finding, together with data showing that field-collected I. scapularis are infected with B. mayonii, indicate that I. scapularis likely is a primary vector to humans of this recently recognized Lyme borreliosis spirochete. PMID:26922324

  19. Two high-copy plasmids found in plants associated with strains of ‘‘Candidatus Phytoplasma asteris’’

    Czech Academy of Sciences Publication Activity Database

    Petrzik, Karel; Krawczyk, K.; Zwolinska, A.

    2011-01-01

    Roč. 66, - (2011), s. 122-127. ISSN 0147-619X Institutional research plan: CEZ:AV0Z50510513 Keywords : Phytoplasma asteris * universal primers * complete sequence Subject RIV: EE - Microbiology, Virology Impact factor: 1.516, year: 2011

  20. Candidatus Phytoplasma hispanicum’, a novel taxon associated with Mexican periwinkle virescence disease of Catharanthus roseus

    Science.gov (United States)

    Mexican periwinkle virescence (MPV) phytoplasma was originally discovered in diseased plants of Madagascar periwinkle (Catharanthus roseus) in Yucatán, Mexico. On the basis of results from RFLP analysis of PCR-amplified 16S rRNA gene sequences, strain MPV was previously classified as the first know...

  1. .i.Candidatus./i. Planktophila limnetica, an actinobacterium representing one of the most numerically important taxa in freshwater bacterioplankton

    Czech Academy of Sciences Publication Activity Database

    Jezbera, Jan; Sharma, A. K.; Brandt, U.; Doolittle, W.F.; Hahn, M.W.

    2009-01-01

    Roč. 59, č. 11 (2009), s. 2864-2869. ISSN 1466-5026 Institutional research plan: CEZ:AV0Z60170517 Keywords : Actinobacteria * Planktophila * freshwater * bacterioplankton Subject RIV: EE - Microbiology, Virology Impact factor: 2.113, year: 2009

  2. ´Candidatus Midichloria mitochondrii´, an endosymbiont of the tick Ixodes ricinus with a unique intramitochondrial lifestyle

    Czech Academy of Sciences Publication Activity Database

    Sassera, D.; Beninati, T.; Bandi, C.; Bouman, Edwin Arien Poul; Sacchi, L.; Fabbi, M.; Lo, N.

    2006-01-01

    Roč. 56, č. 11 (2006), s. 2535-2540. ISSN 1466-5026 R&D Projects: GA ČR GA206/04/0751 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * endosymbiont * intramitochondrial Subject RIV: EH - Ecology, Behaviour Impact factor: 2.662, year: 2006

  3. Molecular detection of Candidatus Scalindua pacifica and environmental responses of sediment anammox bacterial community in the Bohai Sea, China.

    Directory of Open Access Journals (Sweden)

    Hongyue Dang

    Full Text Available The Bohai Sea is a large semi-enclosed shallow water basin, which receives extensive river discharges of various terrestrial and anthropogenic materials such as sediments, nutrients and contaminants. How these terrigenous inputs may influence the diversity, community structure, biogeographical distribution, abundance and ecophysiology of the sediment anaerobic ammonium oxidation (anammox bacteria was unknown. To answer this question, an investigation employing both 16S rRNA and hzo gene biomarkers was carried out. Ca. Scalindua bacteria were predominant in the surface sediments of the Bohai Sea, while non-Scalindua anammox bacteria were also detected in the Yellow River estuary and inner part of Liaodong Bay that received strong riverine and anthropogenic impacts. A novel 16S rRNA gene sequence clade was identified, putatively representing an anammox bacterial new candidate species tentatively named "Ca. Scalindua pacifica". Several groups of environmental factors, usually with distinct physicochemical or biogeochemical natures, including general marine and estuarine physicochemical properties, availability of anammox substrates (inorganic N compounds, alternative reductants and oxidants, environmental variations caused by river discharges and associated contaminants such as heavy metals, were identified to likely play important roles in influencing the ecology and biogeochemical functioning of the sediment anammox bacteria. In addition to inorganic N compounds that might play a key role in shaping the anammox microbiota, organic carbon, organic nitrogen, sulfate, sulfide and metals all showed the potentials to participate in the anammox process, releasing the strict dependence of the anammox bacteria upon the direct availability of inorganic N nutrients that might be limiting in certain areas of the Bohai Sea. The importance of inorganic N nutrients and certain other environmental factors to the sediment anammox microbiota suggests that these bacteria were active for the in situ N transforming process and maintained a versatile life style well adapted to the varying environmental conditions of the studied coastal ocean.

  4. Candidatus Propionivibrio aalborgensis”: A Novel Glycogen Accumulating Organism Abundant in Full-Scale Enhanced Biological Phosphorus Removal Plants

    DEFF Research Database (Denmark)

    Albertsen, Mads; McIlroy, Simon Jon; Stokholm-Bjerregaard, Mikkel;

    2016-01-01

    Enhanced biological phosphorus removal (EBPR) is widely used to remove phosphorus from wastewater. The process relies on polyphosphate accumulating organisms (PAOs) that are able to take up phosphorus in excess of what is needed for growth, whereby phosphorus can be removed from the wastewater...

  5. Genetic transformation of sweet orange to overexpress a CsPR-8 gene aiming for Candidatus Liberibacter asiaticus resistance

    OpenAIRE

    MOURÃO FILHO F.A.A.; Stipp, L. C.L.; Beltrame, A. B.; Boscariol-Camargo, R. L.; Harakava, R.; B.M.J. Mendes

    2014-01-01

    A strategy to produce HLB-resistant citrus using genetic engineering is the overexpression of genes identified in the citrus genome. Plants respond to pathogen attacks by producing several pathogenesis-related (PR) proteins. Therefore, individual PR overexpression in transgenic plants can lead to an increased resistance. In this study, we have chosen to use one PR-8 isoform cloned from Citrus sinensis (CsPR-8). The PR-8 is an endochitinase that also has lysozyme activity, to be potentially us...

  6. High-temperature EBPR process: the performance, analysis of PAOs and GAOs and the fine-scale population study of Candidatus "Accumulibacter phosphatis".

    Science.gov (United States)

    Ong, Ying Hui; Chua, Adeline Seak May; Fukushima, Toshikazu; Ngoh, Gek Cheng; Shoji, Tadashi; Michinaka, Atsuko

    2014-11-01

    The applicability of the enhanced biological phosphorus removal (EBPR) process for the removal of phosphorus in warm climates is uncertain due to frequent reports of EBPR deterioration at temperature higher than 25 °C. Nevertheless, a recent report on a stable and efficient EBPR process at 28 °C has inspired the present study to examine the performance of EBPR at 24 °C-32 °C, as well as the PAOs and GAOs involved, in greater detail. Two sequencing batch reactors (SBRs) were operated for EBPR in parallel at different temperatures, i.e., SBR-1 at 28 °C and SBR-2 first at 24 °C and subsequently at 32 °C. Both SBRs exhibited high phosphorus removal efficiencies at all three temperatures and produced effluents with phosphorus concentrations less than 1.0 mg/L during the steady state of reactor operation. Real-time quantitative polymerase chain reaction (qPCR) revealed Accumulibacter-PAOs comprised 64% of the total bacterial population at 24 °C, 43% at 28 °C and 19% at 32 °C. Based on fluorescent in situ hybridisation (FISH), the abundance of Competibacter-GAOs at both 24 °C and 28 °C was rather low (<10%), while it accounted for 40% of the total bacterial population at 32 °C. However, the smaller Accumulibacter population and larger population of Competibacter at 32 °C did not deteriorate the phosphorus removal performance. A polyphosphate kinase 1 (ppk1)-based qPCR analysis on all studied EBPR processes detected only Accumulibacter clade IIF. The Accumulibacter population shown by 16S rRNA and ppk1 was not significantly different. This finding confirmed the existence of single clade IIF in the processes and the specificity of the clade IIF primer sets designed in this study. Habitat filtering related to temperature could have contributed to the presence of a unique clade. The clade IIF was hypothesised to be able to perform the EBPR activity at high temperatures. The clade's robustness most likely helps it to fit the high-temperature EBPR sludge best and allows it not only to outcompete other Accumulibacter clades but coexist with GAOs without compromising EBPR activity. PMID:25046374

  7. Candidatus liberibacter sp.”, without koch's postulates completed, can the bacterium be considered as the causal agent of citrus Huanglongbing (yellow shoot disease)?

    Science.gov (United States)

    Huanglongbing (HLB) or yellow shoot disease is a destructive disease that threatens citrus production worldwide. The emergence of HLB in Sao Paulo, State of Brazil in 2004 and in Florida of the U.S. in 2005 has increased concern in the citrus production community in the USA. Intensive research is cu...

  8. Detection of Candidatus Liberibacter asiaticus in Diaphorina citri caught on yellow sticky traps during the winter and summer of Sao Paulo State Brazil

    OpenAIRE

    Sala, I; Martins, E. C.; Coletti, D. A.B.; Montesino, L. H.; Bassanezi, R. B.; N.A. WULFF; Texeira, D. C.

    2014-01-01

    The assessment of bacterialiferous Asian citrus psyllid (ACP) frequency is important in epidemiological and management studies because it can be related with the abundance of inoculum sources and with putative new HLB infections. For that, ACP can be collected directly or on yellow sticky traps (YST) commonly used by Brazilian growers to monitor psyllid population. The YST are usually left in the field for 2 weeks after which time YST are visually evaluated for the ACP presence, and if presen...

  9. Seed transmission of Candidatus Liberibacter asiaticus in periwinkle and dodder resulted in low bacterial titer and very mild disease in periwinkle

    Science.gov (United States)

    Canadidatus Liberibacter asiaticus (Las) is the most widely-distributed of three species of Liberibacter that are associated with citrus Huanglongbing (HLB), a lethal disease of citrus worldwide. In addition to citrus, periwinkle (Catharanthus roseus) and dodder (Cuscuta pentagona) are two experime...

  10. First report of ‘Candidatus Phytoplasma asteris’ subgroup 16SrI-A associated with a disease of potato (Solanum tuberosum) in Lithuania

    Science.gov (United States)

    Symptoms of little leaf, witches’-broom, and abnormally small and deformed potatoes, suggestive of possible phytoplasmal infection, were observed in diseased potato (Solanum tuberosum var. Hannibal arba Kestrel) in the Vilnius region of Lithuania. DNA extracted from symptomatic leaves and shoots we...

  11. First report of sweet cherry virescence disease in China and its association with infection by a ‘Candidatus Phytoplasma ziziphi’-related strain

    Science.gov (United States)

    Sweet cherry (Prunus avium L.) is a deciduous tree originating in the Black Sea/Caspian Sea region where Asia and Europe converge. Being highly valued for its timber and fruit, sweet cherry has been cultivated and naturalized on all continents. Over the past decade, the area of sweet cherry culti...

  12. Draft Genome Sequence of Candidatus Methanomethyllophilus sp. 1R26m -Enriched from Bovine Rumen, a Methanogenic Archaeon Belonging to the Methanomassiliicoccales Order

    DEFF Research Database (Denmark)

    Noel, Samantha Joan; Højberg, Ole; Urich, T.;

    2016-01-01

    Olsenella scatoligenes SK9K4(T) is a strictly anaerobic bacterium isolated from pig feces that produces the malodorous compounds 3-methylindole (skatole) and 4-methylphenol (p-cresol). Here, we report the 2.47 Mbp draft genome sequence of SK9K4(T), exploring pathways for the synthesis of skatole...... and p-cresol from the amino acids tryptophan and tyrosine, respectively....

  13. Candidatus Phytoplasma palmicola’, a novel taxon associated with a lethal yellowing-type disease (LYD) of coconut (Cocos nucifera L.) in Mozambique

    Science.gov (United States)

    In this study, the taxonomic position and group classification of the phytoplasma associated with a lethal yellowing-type disease (LYD) of coconut (Cocos nucifera L.) in Mozambique were addressed. Pairwise sequence similarity values based on alignment of near full-length 16SrRNA genes (1530 bp) reve...

  14. Genome Sequence of Candidatus Riesia pediculischaeffi, Endosymbiont of Chimpanzee Lice, and Genomic Comparison of Recently Acquired Endosymbionts from Human and Chimpanzee Lice

    OpenAIRE

    Boyd, Bret M.; Allen, Julie M; de Crécy-Lagard, Valérie; Reed, David L

    2014-01-01

    The obligate-heritable endosymbionts of insects possess some of the smallest known bacterial genomes. This is likely due to loss of genomic material during symbiosis. The mode and rate of this erosion may change over evolutionary time: faster in newly formed associations and slower in long-established ones. The endosymbionts of human and anthropoid primate lice present a unique opportunity to study genome erosion in newly established (or young) symbionts. This is because we have a detailed ph...

  15. Use of digital PCR to improve early detection of CLas infection

    Science.gov (United States)

    Huanglongbing is a devastating disease of citrus caused by the bacterium Candidatus Liberibacter asiaticus. Huanglongbing has devastated the Florida citrus industry and is threatening citrus in Texas and California. Detection of Candidatus Liberibacter asiaticus infections as early as possible is ...

  16. Suspended sludge and biofilm shaped different anammox communities in two pilot-scale one-stage anammox reactors.

    Science.gov (United States)

    Zheng, Bingyu; Zhang, Liang; Guo, Jianhua; Zhang, Shujun; Yang, Anming; Peng, Yongzhen

    2016-07-01

    The abundance and diversity of anammox bacteria was investigated in two pilot-scale integrated fixed-film activated sludge (IFAS) reactors treating high ammonium wastewater. Reactor A was inoculated with nitrifying sludge, while Reactor B was inoculated with suspended anammox sludge with the dominant anammox bacteria of Candidatus 'Kuenenia'. After 180days' operation, the predominate anammox bacteria was Candidatus 'Brocadia' (65%) in the biofilm, while Candidatus 'Kuenenia' (86%) outcompeted with other anammox bacteria in suspended sludge in Reactor A. Candidatus 'Kuenenia' were dominated in suspended sludge through the entire experiment in Reactor B. In contrast, the predominated species shifted from Candidatus 'Kuenenia' (89%) into Candidatus 'Brocadia' (66%) in the biofilm of Reactor B. This study indicated that Candidatus 'Brocadia' preferred to grow in the biofilm, while Candidatus 'Kuenenia' would dominant over other anammox bacteria in the suspended sludge. Further studies are required to identify the internal factors affecting the distribution of anammox bacteria. PMID:27023382

  17. Advances in HLB Detection Using Agdia’s Isothermal AmplifyRP™ Platform

    OpenAIRE

    McOwen, N.; Russell, P F; Bohannon, R.

    2014-01-01

    Huanglongbing (HLB) disease is found throughout Asia, in Brazil, Mexico, the USA, and parts of Africa and has seriously affected citrus production in many regions.  The three species of the Candidatus Liberibacter which have been identified are Candidatus Liberibacter asiaticus, Candidatus. L. americanus, and Candidatus L. africanus. We discuss here improvements in the AmplifyRP™ platform which allow for easy, accurate, and specific detection and identification of the three causativ...

  18. Hemoplasma prevalence and hematological abnormalities associated with infection in three different cat populations from Southern Brazil

    Directory of Open Access Journals (Sweden)

    Andrea Pires dos Santos

    2014-12-01

    Full Text Available Three hemoplasma species are recognized in domestic cats: Mycoplasma haemofelis, ‘Candidatus Mycoplasma haemominutum’ and ‘Candidatus Mycoplasma turicensis’. We report the prevalence and hematological abnormalities of hemoplasma infection in 369 domestic cats from three different populations (blood donors, hospitalized cats and shelter cats from Southern Brazil. Complete blood counts were performed at the time of blood collection, and DNA was extracted and tested by conventional PCR for each hemoplasma species. A total of 79 samples (21.40% were positive for at least one species. The most prevalent hemoplasma was ‘Candidatus Mycoplasma haemominutum’, with 50/369 (13.55% positive cats, followed by ‘Candidatus Mycoplasma turicensis’, 10/369 (2.71%, and Mycoplasma haemofelis, 8/369 (2.16%. Mycoplasma haemofelis and ‘Candidatus Mycoplasma haemominutum’ coinfection was observed in 4/369 (1.08%, whereas ‘Candidatus Mycoplasma haemominutum’ and ‘Candidatus Mycoplasma turicensis’ in 5/369 (1.35%. Three cats (0.81% were infected with all three hemoplasmas. There was no association between infection and the different populations. Anemia was associated with Mycoplasma haemofelis and ‘Candidatus Mycoplasma haemominutum’, but not with ‘Candidatus Mycoplasma turicensis’. Male cats and cats with outdoor access were more likely to be infected. Although ‘Candidatus Mycoplasma haemominutum’ is believed to cause minimal or no hematological alterations, the infected cats studied herein were more likely to be anemic.

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-0194 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available yltransferase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gb|ACQ67332.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine... N-acyltransferase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] YP_002923480.1 0.58 29% ... ...CBRC-VPAC-01-0194 ref|YP_002923480.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-ac

  20. NCBI nr-aa BLAST: CBRC-VPAC-01-0381 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available yltransferase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gb|ACQ67332.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine... N-acyltransferase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] YP_002923480.1 0.76 28% ... ...CBRC-VPAC-01-0381 ref|YP_002923480.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-ac

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-1371 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gb|ACQ68339.1| twin-arginine... translocase subunit, sec-independent protein export [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] YP_002924487.1 0.89 24% ... ...CBRC-TTRU-01-1371 ref|YP_002924487.1| twin-arginine translocase subunit, sec-indepe

  2. NCBI nr-aa BLAST: CBRC-MDOM-11-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available (LIV-II) (LIVCS family) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gb|ACQ67379.1| branched...-chain amino acid transport system II (LIV-II) (LIVCS family) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] YP_002923527.1 4.1 29% ...

  3. The link between independent acquisition of intracellular gamma-endosymbionts and concerted evolution in Tremblaya princeps

    OpenAIRE

    López-Madrigal, Sergio; Latorre, Amparo; Moya, Andrés; Gil, Rosario

    2015-01-01

    Many insect species establish mutualistic symbiosis with intracellular bacteria that complement their unbalanced diets. The betaproteobacterium “Candidatus Tremblaya” maintains an ancient symbiosis with mealybugs (Hemiptera: Pseudococcidae), which are classified in subfamilies Phenacoccinae and Pseudococcinae. Most Phenacoccinae mealybugs have “Candidatus Tremblaya phenacola” as their unique endosymbiont, while most Pseudococcinae mealybugs show a nested symbiosis (a bacterial symbiont placed...

  4. Metabolic Interplay between the Asian citrus psyllid and its Profftella symbiont: An Achilles’ heel of the citrus greening insect vector

    Science.gov (United States)

    Candidatus Liberibacter asiaticus’ (CLas), the bacterial pathogen associated with citrus greening disease, is transmitted by Diaphorina citri, the Asian citrus psyllid. Interactions among D. citri and its microbial endosymbionts, including ‘Candidatus Profftella armatura’, are likely to impact tra...

  5. Monitoring of psyllid species (Hemiptera, Psylloidea) in apple and pear orchards in East Bohemia Překlad názvu do angličtiny:

    Czech Academy of Sciences Publication Activity Database

    Ludvíková, H.; Lauterer, P.; Suchá, J.; Fránová, Jana

    2011-01-01

    Roč. 64, Suppl. (2011), s. 121-122. ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Psyllid species * Candidatus Phytoplasma mali * Candidatus Phytoplasma pyri Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

  6. Steve Jobs and the User Psyche

    OpenAIRE

    Denning, Peter J.

    2011-01-01

    The article of record as published may be found at http://dx.doi.org/10.1145/2043155.2043157 Peter J. Denning reflects on a meeting he had with Steve Jobs in 1988. Published in ACM Ubiquity.Ubiquity Commentary

  7. Metagenomic and metaproteomic analyses of Accumulibacter phosphatis enriched floccular and granular biofilm

    NARCIS (Netherlands)

    Barr, Jeremy J; Dutilh, Bas E; Skennerton, Connor T; Fukushima, Toshikazu; Hastie, Marcus L; Gorman, Jeffrey J; Tyson, Gene W; Bond, Philip L

    2015-01-01

    Biofilms are ubiquitous in nature, forming diverse adherent microbial communities that perform a plethora of functions. Here we operated two laboratory-scale sequencing batch reactors enriched with Candidatus Accumulibacter phosphatis (Accumulibacter) performing enhanced biological phosphorus remova

  8. Prevalence and molecular analyses of hemotrophic Mycoplasma spp. (hemoplasmas) detected in sika deer (Cervus nippon yesoensis) in Japan.

    Science.gov (United States)

    Tagawa, Michihito; Matsumoto, Kotaro; Yokoyama, Naoaki; Inokuma, Hisashi

    2014-03-01

    Hemotropic mycoplasmas (hemoplasmas) are cell-wall deficient, epierythrocytic bacteria that cause infectious anemia in several mammalian species. The prevalence of hemoplasma species was examined by screening and species-specific PCR using blood samples collected from 51 sika deer in Hokkaido, Japan. Molecular analyses were performed for the 16S rRNA, 23S rRNA and RNase P RNA (rnpB) gene sequences. A total of 23/51 (45%) deer DNA samples were positive for hemoplasmas in the screening PCR. Using species-specific PCR, 12 and 17 samples were positive for 'Candidatus Mycoplasma haemocervae' and 'Candidatus M. erythrocervae', respectively. Sequencing and phylogenetic trees of those three genes indicate that the 'Candidatus M. haemocervae' and 'Candidatus M. erythrocervae' detected in Japanese deer are potentially different species from the cervine hemoplasma found in deer from America and Brazil. PMID:24270803

  9. Comparison of Candiatus Liberibacter solanacearum genomic sequences isolated from carrot psyllids in Scandinavia and potato psyllids from Texas

    Science.gov (United States)

    The fastidious prokaryote Candidatus Liberibacter solanacearum (Lso), transmitted by the tomato potato psyllid (Bactericera cockerelli), is associated with the Zebra Chip disease of potato. Plants infected with Liberibacter may experience significant yield losses and these plants also serve as poten...

  10. Analyses of proteomic expression profiles and nutrient status of citrus plants in response to Huanglongbing

    OpenAIRE

    H. Lin; Nwugo, C. C.; Duan, Y.

    2014-01-01

    Huanglongbing (HLB) is a highly devastating citrus disease and represents a major threat to the citrus industries in US. The etiology of HLB worldwide is associated with three insect-transmissible phloem-limited members of the bacterial group ‘Candidatus Liberibacter spp.’, prevalently ‘Candidatus Liberibacter asiaticus’ (Las). All citrus cultivars are susceptible to HLB. To better understand the physiological and molecular processes involved in host responses to Las, proteomic analyses via 2...

  11. Variability of direction of tree-to-tree spread of HLB over time

    OpenAIRE

    Kriss, Alissa B.; Lopes, Silvio; Tim R. Gottwald

    2014-01-01

    Candidatus Liberibacter americanus and Candidatus Liberibacter asiaticus are two bacterial species that cause huanglongbing (HLB) disease in citrus-growing regions of Brazil. A concentrated sampling plan of a grove in Matao, Brazil was initiated to evaluate the spatial and temporal spread of these bacteria. The exact location of each of 8697 trees was recorded, and each symptomatic tree was assessed by PCR for the presence of Ca. L. americanus and Ca. L. asiaticus during 17 different months f...

  12. Metabolic Interplay between the Asian Citrus Psyllid and Its Profftella Symbiont: An Achilles’ Heel of the Citrus Greening Insect Vector

    OpenAIRE

    Ramsey, John S; Johnson, Richard S.; Hoki, Jason S.; Kruse, Angela; Mahoney, Jaclyn; Hilf, Mark E.; Hunter, Wayne B.; Hall, David G.; Schroeder, Frank C.; MacCoss, Michael J.; Cilia, Michelle

    2015-01-01

    Candidatus Liberibacter asiaticus’ (CLas), the bacterial pathogen associated with citrus greening disease, is transmitted by Diaphorina citri, the Asian citrus psyllid. Interactions among D. citri and its microbial endosymbionts, including ‘Candidatus Profftella armatura’, are likely to impact transmission of CLas. We used quantitative mass spectrometry to compare the proteomes of CLas(+) and CLas(-) populations of D. citri, and found that proteins involved in polyketide biosynthesis by the ...

  13. Prävalenz von hämotrophen Mycoplasma spp., Bartonella spp., Anaplasma phagocytophilum und Borrelia burgdorferi bei Katzen im Raum Berlin/Brandenburg

    OpenAIRE

    Morgenthal, Dinah

    2014-01-01

    Arthropod-borne infectious agents in the cat include Bartonella (B.) henselae, Bartonella (B.) clarridgeiae, Bartonella (B.) quintana, Anaplasma (A.) phagocytophilum and Borrelia (B.) burgdorferi. Moreover infections with Mycoplasma (M.) haemofelis, Candidatus Mycoplasma (C. M.) turicensis and Candidatus Mycoplasma (C. M.) haemominutum occur in the cat. The cat flea (Ctenocephalides felis) is supposed to be the main vector for Mycoplasma spp.; moreover, transmission via blood transfusion and ...

  14. Real-Time PCR Investigation of Potential Vectors, Reservoirs, and Shedding Patterns of Feline Hemotropic Mycoplasmas▿

    OpenAIRE

    Willi, Barbara; Boretti, Felicitas S; Meli, Marina L; Bernasconi, Marco V.; Casati, Simona; Hegglin, Daniel; Puorger, Maria; Neimark, Harold; Cattori, Valentino; Wengi, Nicole; Reusch, Claudia E.; Lutz, Hans; Hofmann-Lehmann, Regina

    2007-01-01

    Three hemotropic mycoplasmas have been identified in pet cats: Mycoplasma haemofelis, "Candidatus Mycoplasma haemominutum," and "Candidatus Mycoplasma turicensis." The way in which these agents are transmitted is largely unknown. Thus, this study aimed to investigate fleas, ticks, and rodents as well as saliva and feces from infected cats for the presence of hemotropic mycoplasmas, to gain insight into potential transmission routes for these agents. DNA was extracted from arthropods and from ...

  15. Scientific Opinion on the pest categorisation of Elm phloem necrosis mycoplasm

    OpenAIRE

    EFSA Panel on Plant Health (PLH)

    2014-01-01

    The Panel on Plant Health performed a pest categorisation of Elm phloem necrosis mycoplasma, now renamed Candidatus Phytoplasma ulmi (CPu), for the European Union (EU) territory. CPu is a well-defined phytoplasma species of the genus Candidatus Phytoplasma, for which molecular detection assays are available. CPu is transmitted by grafting and vegetative propagation material as well as by insect vectors. CPu is reported from North America and is present in at least four EU Member States: the C...

  16. Hemoplasma prevalence and hematological abnormalities associated with infection in three different cat populations from Southern Brazil

    OpenAIRE

    Andrea Pires dos Santos; Francisco de Oliveira Conrado; Joanne Belle Messick; Alexander Welker Biondo; Simone Tostes de Oliveira; Ana Marcia Sá Guimaraes; Naíla Cannes do Nascimento; Viviane Pedralli; Camila Serina Lasta; Félix Hilário Diaz González

    2014-01-01

    Three hemoplasma species are recognized in domestic cats: Mycoplasma haemofelis, ‘Candidatus Mycoplasma haemominutum’ and ‘Candidatus Mycoplasma turicensis’. We report the prevalence and hematological abnormalities of hemoplasma infection in 369 domestic cats from three different populations (blood donors, hospitalized cats and shelter cats) from Southern Brazil. Complete blood counts were performed at the time of blood collection, and DNA was extracted and tested by conventional PCR for each...

  17. Distribution of Legionella pneumophila Antibody Among Primate Species

    OpenAIRE

    Helmke, R J; Kalter, S. S.; Heberling, R L

    1981-01-01

    Sera representing 16 different primate species were surveyed by indirect immunofluorescence for evidence of antibody to Legionella pneumophila. The presence of antibody in Old and New World monkeys and in apes supports previous observations of the ubiquity of Legionella pneumophila.

  18. Yeast Interacting Proteins Database: YNL311C, YKL001C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available -purification experiments; putative F-box protein; analysis of integrated high-throughput datasets predicts ...ments; putative F-box protein; analysis of integrated high-throughput datasets predicts involvement in ubiqu

  19. Muusika valib Tristan Priimägi / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2004-01-01

    Heliplaatidest: Roy Ayers "Virgin Ubiquity - Unreleased Recordings 1976-1981", "Ibadan People", "A Journey to the Dawn", The Matthew Herbert Big Band "Goodbye Swingtime", Amp Fiddler "Waltz of a Ghetto Fly"

  20. HIV Infection Seems to Affect Nervous System

    Science.gov (United States)

    ... is a clinical fellow in the department of neurology at the University of California, San Francisco (UCSF). " ... early [HIV] infection." Valcour is a professor of neurology at UCSF. "Additionally, the ubiquity of symptoms in ...

  1. NOVEL APPLICATIONS FOR EMERGING MARKETS USING TELEVISION AS A UBIQUITOUS DEVICE

    OpenAIRE

    Pal, Arpan

    2013-01-01

    According to Mark Weiser, who is known as the father of ubiquitous computing, the most profound technologies are those that disappear and disappearance of technology is the fundamental requirement for ubiquity. Ubiquitous computing is more about computing for the purpose of communication and for the purpose of information access anytime everywhere. As we enter the ubiquitous computing era, the main aspect of ubiquity will be how these computing devices disseminate information to end-users. As...

  2. Diagnóstico molecular da infecção por hemoplasmas em gatos domésticos naturalmente infectados da cidade de Belém, Pará

    Directory of Open Access Journals (Sweden)

    Sinerey K.S. Aragão-de-Sousa

    2013-09-01

    Full Text Available Mycoplasma haemofelis, 'Candidatus Mycoplasma haemominutum' e 'Candidatus Mycoplasma turicensis' são os agentes causadores da micoplasmose felina, que podem causar anemia aguda ou crônica. O objetivo deste trabalho foi determinar a ocorrência de hemoplasmas em gatos domésticos de Belém, Pará. Para isso, 201 gatos foram divididos em três grupos: Grupo A foi composto por 101 gatos de rua capturados pelo Centro de Controle de Zoonoses, o grupo B foi composto por 62 gatos domiciliados e saudáveis e o grupo C foi composto por 38 gatos domiciliados que apresentavam alguma afecção clínica. Foram coletadas amostras de sangue para a realização de Reação em Cadeia pela Polimerase (PCR para detectar o DNA destes agentes, os quais foram sequenciados e alinhados. A análise estatística foi realizada para detectar a associação entre a infecção, o sexo dos animais e os grupos experimentais. O DNA de pelo menos uma das espécies de hemoplasmas pesquisados foi detectado em 19,9% (40/201 das amostras, sendo o DNA de 'Candidatus M. haemominutum' encontrado em 7,96% (16/201 das amostras, M. haemofelis em 1,49% (3/201 das amostras, enquanto que o DNA de 'Candidatus M. turicensis' foi detectado em 12,93% (26/201 das amostras. O DNA destes três agentes foi detectado em gatos dos grupos A e C, enquanto que no grupo B foi detectado apenas 'Candidatus M. turicensis' e 'Candidatus M. haemominutum' Foi detectada a influência do sexo sobre a infecção hemoplasmas apenas entre 'Candidatus M. haemominutum' e machos. Estes resultados mostraram que os hemoplasmas circulam entre os gatos domésticos em Belém e 'Candidatus M. turicensis' e 'Candidatus M. haemominutum' foram mais comuns do que M. haemofelis, especialmente em gatos vadios.

  3. Epitheliocystis Distribution and Characterization in Brown Trout (Salmo trutta) from the Headwaters of Two Major European Rivers, the Rhine and Rhone

    Science.gov (United States)

    Guevara Soto, Maricruz; Vaughan, Lloyd; Segner, Helmut; Wahli, Thomas; Vidondo, Beatriz; Schmidt-Posthaus, Heike

    2016-01-01

    We present a first description of the distribution and characterization of epitheliocystis infections in brown trout (Salmo trutta) from the upper catchments of two major European rivers, the Rhine and the Rhone. Overall, epitheliocystis was widely distributed, with 70% of the Rhine and 67% of the Rhone sites harboring epitheliocystis positive brown trout. The epitheliocystis agents Candidatus Piscichlamydia salmonis and Candidatus Clavichlamydia salmonicola could be identified in both catchments, although their relative proportions differed from site to site. Additionally, in two rivers in the Rhine catchment, a new species of Candidatus Similichlamydia was identified. Based on the histology, infection intensity, and severity of pathological changes were significantly more pronounced in mixed chlamydial infections, whereas single infections showed only low numbers of cysts and mild pathology. Infections could be found over a wide range of temperatures, which showed no correlation to infection prevalence or intensity. PMID:27148070

  4. Epitheliocystis Distribution and Characterization in Brown Trout (Salmo trutta) from the Headwaters of Two Major European Rivers, the Rhine and Rhone.

    Science.gov (United States)

    Guevara Soto, Maricruz; Vaughan, Lloyd; Segner, Helmut; Wahli, Thomas; Vidondo, Beatriz; Schmidt-Posthaus, Heike

    2016-01-01

    We present a first description of the distribution and characterization of epitheliocystis infections in brown trout (Salmo trutta) from the upper catchments of two major European rivers, the Rhine and the Rhone. Overall, epitheliocystis was widely distributed, with 70% of the Rhine and 67% of the Rhone sites harboring epitheliocystis positive brown trout. The epitheliocystis agents Candidatus Piscichlamydia salmonis and Candidatus Clavichlamydia salmonicola could be identified in both catchments, although their relative proportions differed from site to site. Additionally, in two rivers in the Rhine catchment, a new species of Candidatus Similichlamydia was identified. Based on the histology, infection intensity, and severity of pathological changes were significantly more pronounced in mixed chlamydial infections, whereas single infections showed only low numbers of cysts and mild pathology. Infections could be found over a wide range of temperatures, which showed no correlation to infection prevalence or intensity. PMID:27148070

  5. Dicty_cDB: Contig-U14897-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Penicillium chrysogenum Wisconsi... 42 0.026 CP001338_1471( CP001338 |pid:none) Candidatus Methanos...CU469464_340( CU469464 |pid:none) Candidatus Phytoplasma mali stra... 52 1e-05 (B7IHU5) RecName: Full=30S riboso...( O21246 ) RecName: Full=Ribosomal protein S10, mitochondrial; &A... 49 2e-04 CP000770_184( CP000770 |pid:none) Candi...0656_95( AP010656 |pid:none) Candidatus Azobacteroides pseudot... 45 0.002 ( O59152 ) RecName: Full=30S riboso...hmania braziliensis chromoso... 37 0.49 AF526250_1( AF526250 |pid:none) Chlamys farreri clone iols

  6. Molecular evidence for ammonia oxidation bacteria in the sediments of shallow lake: A case study in Yangcheng Lake%浅水湖泊(阳澄湖)沉积物氨氧化菌的分子证据

    Institute of Scientific and Technical Information of China (English)

    张亚平; 阮晓红

    2012-01-01

    选择长江三角洲中型浅水湖泊--阳澄湖,应用分子生物学方法鉴定淡水系统底质中的厌氧氨氧化细菌和好氧氨氧化细菌.试验设计三组厌氧氨氧化特异性巢式引物,对沉积物细菌的16S rRNA进行特异性扩增.其中,引物对AMX368f-AMX820r从底质中扩增出了anammox特异性序列,系统发育分析表明样品序列分别与Candidatus brocadia fulgida、Candidatus brocadia anammoxidans和Candidatus scalindua属近似.应用amoA基因特异性探针在底质中扩增出的好氧氨氧化菌序列,均属于Betaproteobacteria.本研究提供了阳澄湖中好氧氨氧化菌与厌氧氨氧化菌共存的分子证据.%Sediment samples were collected from Yangcheng Lake, a middle size shallow lake in Yangtze River Delta. Molecular biology methods were adopted to detect the anaerobic ammonia oxidation (anammox) and aerobic ammonia oxidation bacteria in the samples. Three pairs of nest PCR primers were designed to amplify the 16S rRNA from the sediment samples. The specified sequences of anammox were amplified by the primer pairs AMX368f- AMX820r, and analyses of phylogenetics showed that these sequences were similar to Candidatus brocadia fulgida, Candidatus brocadia anammoxidans and Candidatus scalindua. The sequences amplified by the amoA gene specified primer from the sediment samples belonged to the Betaproteobacteria class. This study provided the molecular evidence for coexistence of anammox and aerobic-ammonia-oxidation in Yangcheng Lake.

  7. Dicty_cDB: Contig-U06647-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00 m_ : 1.00 36.0 %: extracellular, including cell wall 16.0 %: cytoplasmic 16.0 %: mitochondri...tic Parameters within the ... 42 1e-04 11 ( L06178 ) Apis mellifera ligustica complete mitochondri...05 6 ( CP000770 ) Candidatus Sulcia muelleri GWSS, complete genome. 38 0.006 14 ( CP000016 ) Candidatus Bloc...608 |pid:none) Homo sapiens extracellular signal-... 46 0.002 DQ399291_1( DQ399291 |pid:none) Homo sapiens extracellu...1( DQ399292 |pid:none) Homo sapiens extracellular signal-... 43 0.011 AM502239_5( AM502239 |pid:none) Leishm

  8. The link between independent acquisition of intracellular gamma-endosymbionts and concerted evolution in Tremblaya princeps.

    Science.gov (United States)

    López-Madrigal, Sergio; Latorre, Amparo; Moya, Andrés; Gil, Rosario

    2015-01-01

    Many insect species establish mutualistic symbiosis with intracellular bacteria that complement their unbalanced diets. The betaproteobacterium "Candidatus Tremblaya" maintains an ancient symbiosis with mealybugs (Hemiptera: Pseudococcidae), which are classified in subfamilies Phenacoccinae and Pseudococcinae. Most Phenacoccinae mealybugs have "Candidatus Tremblaya phenacola" as their unique endosymbiont, while most Pseudococcinae mealybugs show a nested symbiosis (a bacterial symbiont placed inside another one) where every "Candidatus Tremblaya princeps" cell harbors several cells of a gammaproteobacterium. Genomic characterization of the endosymbiotic consortium from Planococcus citri, composed by "Ca. Tremblaya princeps" and "Candidatus Moranella endobia," unveiled several atypical features of the former's genome, including the concerted evolution of paralogous loci. Its comparison with the genome of "Ca. Tremblaya phenacola" PAVE, single endosymbiont of Phenacoccus avenae, suggests that the atypical reductive evolution of "Ca. Tremblaya princeps" could be linked to the acquisition of "Ca. Moranella endobia," which possess an almost complete set of genes encoding proteins involved in homologous recombination. In order to test this hypothesis, we performed comparative genomics between "Ca. Tremblaya phenacola" and "Ca. Tremblaya princeps" and searched for the co-occurrence of concerted evolution and homologous recombination genes in endosymbiotic consortia from four unexplored mealybug species, Dysmicoccus boninsis, Planococcus ficus, Pseudococcus longispinus, and Pseudococcus viburni. Our results support a link between concerted evolution and nested endosymbiosis. PMID:26161080

  9. Small RNA profiling reveals phosphorus deficiency as a contributing factor in symptom expression for Citrus Huanglongbing Disease

    Science.gov (United States)

    Huanglongbing (HLB) is a devastating citrus disease that is associated with bacteria of the genus Candidatus Liberibacter(Ca. L.). Powerful diagnostic tools and management strategies are desired to control HLB. Host small Ribonucleic acid (sRNA) play a vital role in regulating host responses to pa...

  10. Biology, history and world status of Diaphorina citri

    Science.gov (United States)

    The Asian citrus psyllid, Diaphorina citri Kuwayama, is an important pest of citrus because it transmits phloem-limited bacteria (Candidatus Liberibacter spp.) responsible for citrus greening disease (huanglongbing), considered by some to be the world’s most serious disease of citrus. The psyllid ha...

  11. First Report of Dodder Transmission of Huanglongbing from Naturally Infected Murraya paniculata to Citrus

    Science.gov (United States)

    Huanglongbing (HLB) or “greening” disease of citrus is caused by phloem-limited, uncultured bacteria in the genus “Candidatus Liberibacter”. HLB is one of the most destructive diseases of citrus worldwide and is considered so dangerous to a U.S. citrus production that the USDA has listed “Ca. Liberi...

  12. Dicty_cDB: Contig-U15400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 34 2.3 2 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34... 2.5 16 ( AZ524051 ) 226PbF06 Pb MBN #21 Plasmodium berghei genomic 3'... 36 2.5 2 ( AC129992 ) Rattus norve

  13. PROCENTAJE DE PSILIDOS PORTADORES DE Canidatus Liberibacter asiaticus Y SU RELACION CON LA INCIDENCIA DE HLB EN CINCO HUERTAS COMERCIALES DE LIMON MEXICANO {Citrus aurantifolia (Christm) Swingle} EN EL ESTADO DE COLIMA MEXICO

    Science.gov (United States)

    Asian citrus psyllids (Diaphorina citri) were individually analyzed by qPCR to detect Candidatus Liberibacter asiaticus (CLas). The psyllids were collected in Mexican lime (Citrus aurantifolia) trees in five commercial orchards in Tecomán and Manzanillo, Colima with severe symptoms of classical mott...

  14. Within-orchard edge effects of the azimuth of the sun on Diaphorina citri adults in mature orchards

    Science.gov (United States)

    Huanglongbing (HLB) has been considered the most devastating disease of citrus. The bacterium and vector associated with HLB in Florida are ‘Candidatus Liberibacter asiaticus’ and Diaphorina citri (Asian citrus psyllid), respectively. D. citri is positively phototropic, and higher populations have b...

  15. Huanglongbing and psyllid cell cultures

    Science.gov (United States)

    We successfully established cell cultures of the Asian citrus psyllid, Diaphorina citri (Psyllidae: Hemiptera), DcHH-1. The cell culture also supported growth of Candidatus Liberibacter asiaticus. This bacterial pathogen is associated with Huanglongbing, known as citrus greening disease. Research on...

  16. The link between independent acquisition of intracellular gamma-endosymbionts and concerted evolution in Tremblaya princeps

    Directory of Open Access Journals (Sweden)

    Sergio eLópez-Madrigal

    2015-06-01

    Full Text Available Many insect species establish mutualistic symbiosis with intracellular bacteria that complement their unbalanced diets. The betaproteobacterium Candidatus Tremblaya maintains an ancient symbiosis with mealybugs (Hemiptera: Pseudococcidae, which are classified in subfamilies Phenacoccinae and Pseudococcinae. Most Phenacoccinae mealybugs have Candidatus Tremblaya phenacola as their unique endosymbiont, while most Pseudococcinae mealybugs show a nested symbiosis (a bacterial symbiont placed inside another one where every Candidatus Tremblaya princeps cell harbors several cells of a gammaproteobacterium. Genomic characterization of the endosymbiotic consortium from Planococcus citri, composed by Ca. Tremblaya princeps and Candidatus Moranella endobia, unveiled several atypical features of the former’s genome, including the concerted evolution of paralogous loci. Its comparison with the genome of Ca. Tremblaya phenacola PAVE, single endosymbiont of Phenacoccus avenae, suggests that the atypical reductive evolution of Ca. Tremblaya princeps could be linked to the acquisition of Ca. Moranella endobia, which possess an almost complete set of genes encoding proteins involved in homologous recombination. In order to test this hypothesis, we performed comparative genomics between Ca. Tremblaya phenacola and Ca. Tremblaya princeps and searched for the co-occurrence of concerted evolution and homologous recombination genes in endosymbiotic consortia from four unexplored mealybug species, Dysmicoccus boninsis, Planococcus ficus, Pseudococcus longispinus and Pseudococcus viburni. Our results support a link between concerted evolution and nested endosymbiosis.

  17. Potato psyllid vector density and zebra chip disease

    Science.gov (United States)

    Zebra chip disease (ZC), which is caused by ‘Candidatus Liberibacter solanacearum’ (Lso) and vectored by potato psyllids Bactericera cockerelli, is a continuing threat to the North American potato industry. Current management entails frequent insecticide sprays for the vectors as thresholds for spra...

  18. Characterization of a recombinant Cathepsin B-Like cysteine peptidase from Diaphorina citri Kuwayama (Hemiptera: Liviidae): A putative target control of citrus huanglongbing

    Science.gov (United States)

    Huanglongbing (HLB) is one of the most destructive disease affecting citrus plants. The causal agent is associated with the phloem-limited bacterium Candidatus Liberibacter asiaticus (CLas) spread by the Asian citrus psyllid, Diaphorina citri (Hemiptera: Liviidae). Among the control strategies for H...

  19. Entomopathogenic fungi (Hypocreales) for control of potato psyllid, Bactericerta cockerelli (Sulc)(Hemiptera: Triozidae) in an area endemic for zebra chip disease of potato

    Science.gov (United States)

    Potato psyllid, Bactericera cockerelli (Šulc), is a serious pest of potato, tomato and other solanaceous vegetables in the United States, Mexico, Central America, and New Zealand and is responsible for transmission of Candidatus Liberibacter solanacearum causing a disease known as “zebra chip” (ZC)....

  20. Investigations of the feasibility for managing the Asian citrus pysllid using Isaria fumosorosea

    Science.gov (United States)

    The Asian citrus psyllid (AsCP), Diaphorina citri, transmits one of the most devastating diseases of citrus, the plant pathogenic bacterium Candidatus Liberibacter asiaticus, which is strongly associated with the occurrence of huanglongbing (HLB), also known as citrus greening disease. In Florida, g...

  1. Incidence of the Asian citrus psyllid, Diaphorina citri (Hemiptera: Psyllidae) and its parasitoid Tamarixia radiata (Hymenoptera: Eulophidae) in Florida citrus

    Science.gov (United States)

    Diaphorina citri Kuwayama, vectors the bacterium Candidatus Liberibacter asiaticus, one of the causal organisms of the devastating citrus disease “huanglongbing” or citrus greening. In the United States, D. citri was first discovered in Florida, in 1998. Tamarixia radiata Waterston, was imported fro...

  2. Seasonal Occurrence and Abundance of the Potato Psyllid, Bactericera cockerelli, in south central Washington

    Science.gov (United States)

    The potato psyllid, Bactericera cockerelli Sulc, has recently been identified as a vector of Candidatus Liberibacter, the putative causal agent of zebra chip (ZC) potato disease. ZC is causing millions of dollars in losses to the potato industry in the United States, Mexico, Central America, and New...

  3. Assessing potato psyllid haplotypes in potato crops in the Pacific Northwestern United States

    Science.gov (United States)

    The potato psyllid, Bactericera cockerelli (Šulc), is a vector of the bacterium ‘Candidatus Liberibacter solanacearum’ (Lso) that has been linked to the economically devastating zebra chip disease of potato. To date, four haplotypes of the potato psyllid have been identified and include Central, We...

  4. Use of the entomopathogenic fungi Metarhizium anisopliae, Cordyceps bassiana and Isaria fumosorosea to control Diaphorina citri (Hemiptera: Psylidae) in Persian lime under field conditions

    Science.gov (United States)

    The Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae), is a destructive insect pest in the citriculture, because it is an efficient vector of the proteobacteria, ‘Candidatus Liberibacter asiaticus’ (Las), ‘Ca. L. Africanus’ (Laf), and ‘Ca. L. Americanus’ (Lam). These bacteria c...

  5. Potato psyllid genome and metagenome project

    Science.gov (United States)

    The potato psyllid (Bactericera cockerelli) is a Hemipteran pest of solanaceous plants and limits potato and tomato production by the transmission of Candidatus Liberibacter solanacearum. Genomic information on the potato psyllid is limited but is vital in developing appropriate management strategi...

  6. The potato psyllid genome project

    Science.gov (United States)

    The potato psyllid (Bactericera cockerelli) is a Hemipteran pest of solanaceous plants and limits potato and tomato production by the transmission of Candidatus Liberibacter solanacearum. Genomic information on the potato psyllid is limited but is vital in developing appropriate management strategi...

  7. Potato tuber chemistry of promising germplasm exhibiting tolerance to zebra chip disease

    Science.gov (United States)

    Long-term sustainable management of zebra chip (ZC) disease of potato requires development of tolerant or resistant germplasm. To this end, 283 potato varieties and breeding clones were infected with the ZC putative causal agent ‘Candidatus Liberibacter solanacearum’ (Lso) by potato psyllid vector i...

  8. Quantification of Las gene by qPCR from orange juice extracted from Huanglongbing infected fruit

    Science.gov (United States)

    The objective of this research is to establish a methodology to quantify the Candidatus Liberibacter asiaticus (CLas) in orange juice as an indicator of orange juice quality. Current standard method for citrus Huanglongbing (HLB) diagnosis is using real-time Polymerase Chain Reaction (qPCR) to quan...

  9. Neglected tick-borne pathogens in the Czech Republic, 2011–2014

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Mendel, Jan; Betášová, Lenka; Blažejová, Hana; Jedličková, Petra; Straková, Petra; Hubálek, Zdeněk; Rudolf, Ivo

    2016-01-01

    Roč. 7, č. 1 (2016), s. 107-112. ISSN 1877-959X EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Rickettsia spp. * Candidatus N. mikurensis * Anaplasma phagocytophilum * Babesia spp. Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 2.718, year: 2014

  10. Dicty_cDB: Contig-U02594-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DL172026 ) Methods for Identifying the Target of a Compound ... 42 0.049 2 ( DJ377761 ) Identification of E...e cDNA clone:VS... 670 0.0 2 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34 0.015 11 (

  11. Dicty_cDB: Contig-U12038-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 34 0.005 19 ( DW248180 ) pOP-EON00464_EST_C_1_pSK_SK EON (Oil... Palm Embryoi... 54 0.013 1 ( EY410093 ) pOP-EO07491_EST_C_1_pSK_SK EO (Oil

  12. A graft-based chemotherapy method for screening effective molecules and rescuing Huanglongbing (HLB)-affected citrus plants

    Science.gov (United States)

    Huanglongbing (HLB), the most devastating disease of citrus worldwide, is associated with three species of fastidious and phloem-limited a-Proteobacteria in the genus of ‘Candidatus Liberibacter’. We previously reported a regeneration-based chemical screening system using periwinkle cuttings. In ...

  13. Dicty_cDB: Contig-U06960-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 0.72 16 ( CU469464 ) Candidatus Phytoplasma mali strain AT complete ch... 30 0.74 15 ( CP000727 ) Clostr...idium botulinum A str. Hall, complete genome. 34 0.79 15 ( CU074304 ) Pig DNA seq

  14. Variations in Zebra Chip disease expression and tuber biochemistry in response to vector density

    Science.gov (United States)

    This study examined effects of the number of ‘Candidatus Liberibacter solanacearum’ (Lso)-positive psyllids feeding on potatoes to Lso titers, zebra chip disease (ZC) symptom severity, and levels of amino acids, carbohydrates, and phenolics in tubers harvested weeks later. Red La Soda and Russet Nor...

  15. Variation in susceptibility to potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae),among Solanum verrucosum germplasm accessions

    Science.gov (United States)

    Potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae) is a key pest of potato and the vector of "Candidatus Liberibacter solanacearum," the pathogen associated with zebra chip disease. Development of potato cultivars with genetic resistance to potato psyllid would enable cost-effecti...

  16. Phytoplasma associated with witches´-broom disease of Ulmus minor in the Czech Republic. Electron microscopy and molecular characterization

    Czech Academy of Sciences Publication Activity Database

    Navrátil, M.; Šafářová, D.; Válová, P.; Fránová, Jana; Šimková, Marie

    2009-01-01

    Roč. 54, č. 1 (2009), s. 37-42. ISSN 0015-5632 R&D Projects: GA AV ČR(CZ) 1QS500510558 Institutional research plan: CEZ:AV0Z50510513 Keywords : Ulmus minor * Candidatus Phytoplasma ulmi * PCR * sequencing Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

  17. Phytoplasmas in apricot, peach and sour cherry orchards in East Bohemia, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Ludvíková, H.; Fránová, Jana; Suchá, J.

    2011-01-01

    Roč. 64, Suppl. (2011), s. 67-68. ISSN 1721-8861 R&D Projects: GA MŠk OC09021 Institutional research plan: CEZ:AV0Z50510513 Keywords : Candidatus Phytoplasma prunorum * PCR/RFLP * apricot, peach and sour cherry orchards Subject RIV: EE - Microbiology, Virology Impact factor: 0.592, year: 2011

  18. Rickettsiae in Gulf Coast Ticks, Arkansas, USA

    OpenAIRE

    Trout, Rebecca; Steelman, C Dayton; Szalanski, Allen L.; Williamson, Phillip C

    2010-01-01

    To determine the cause of spotted fever cases in the southern United States, we screened Gulf Coast ticks (Amblyomma maculatum) collected in Arkansas for rickettsiae. Of the screened ticks, 30% had PCR amplicons consistent with Rickettsia parkeri or Candidatus Rickettsia amblyommii.

  19. Anaplasmataceae-Specific PCR for Diagnosis and Therapeutic Guidance for Symptomatic Neoehrlichiosis in Immunocompetent Host.

    Science.gov (United States)

    Schwameis, Michael; Auer, Julia; Mitteregger, Dieter; Simonitsch-Klupp, Ingrid; Ramharter, Michael; Burgmann, Heinz; Lagler, Heimo

    2016-02-01

    Candidatus Neoehrlichia is increasingly being recognized worldwide as a tickborne pathogen. We report a case of symptomatic neoehrlichiosis in an immunocompetent Austria resident who had recently returned from travel in Tanzania. The use of Anaplasmataceae-specific PCR to determine the duration of antimicrobial therapy seems reasonable to avert recrudescence. PMID:26811875

  20. Hemoplasmas in wild canids and felids in Brazil.

    Science.gov (United States)

    André, Marcos Rogerio; Adania, Cristina Harumi; Allegretti, Silmara Marques; Machado, Rosangela Zacarias

    2011-06-01

    Hemotropic mycoplasmas, epicellular erythrocytic bacterial parasites lacking a cell wall, are the causative agents of infectious anemia in numerous mammalian species. The presence of hemotropic mycoplasmas in blood samples of neotropical and exotic wild canids and felids from Brazilian zoos were recorded using molecular techniques. Blood samples were collected from 146 Brazilian wild felids, 19 exotic felids, 3 European wolves (Canis lupus), and from 97 Brazilian wild canids from zoos in the Brazilian states of São Paulo and Mato Grosso and the Federal District. Using conventional polymerase chain reaction (PCR), this work found 22 (13%) wild felids positive to Candidatus Mycoplasma haemominutum [4 jaguars (Panthera onca); 3 pumas (Puma concolor); 10 ocelots (Leopardus pardalis); 2 jaguarondis (Puma yagouaroundi); and 3 little spotted cats (Leopardus tigrinus)]. Only one little spotted cat (Leopardus tigrinus) was positive to Mycoplasma haemofelis, and none was positive to Candidatus Mycoplasma turicensis. Two bush dogs (Speothos venaticus) were positive for a Mycoplasma sp. closely related to Candidatus Mycoplasma haematoparvum, and two European wolves were positive for a Mycoplasma sp. closely related to Candidatus Mycoplasma haemominutum. This is the first study regarding the molecular detection of hemotropic mycoplasmas in wild canids. PMID:22946419

  1. Gender differences and effect of photophase on Asian citrus psyllid (Diaphorina citri Kuwayama) feeding behavior

    Science.gov (United States)

    Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Psyllidae), thought to be primarily a phloem-feeding insect, transmits the presumptive pathogen for Huanglongbing, ‘Candidatus Liberibacter asiaticus’. Because this bacterium is restricted to the phloem and bacterial transmission is the res...

  2. Multigene Sequence Analysis of Aster Yellows Phytoplasma Associated with Primrose Yellows

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Přibylová, Jaroslava; Koloniuk, Igor; Podrábská, Kateřina; Špak, Josef

    2016-01-01

    Roč. 164, č. 3 (2016), s. 166-176. ISSN 0931-1785 Institutional support: RVO:60077344 Keywords : Candidatus Phytoplasma asteris * pyrH-frr genes * Primula acaulis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.820, year: 2014

  3. Dicty_cDB: Contig-U06086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne) Candidatus Phytoplasma mali stra... 37 1.5 AY180958_1( AY180958 |pid:none) Avian infectious...one) Mycoplasma mobile 163K complete ... 34 9.5 AY189157_1( AY189157 |pid:none) Avian infectious

  4. Stolbur Phytoplasma Transmission to Maize by Reptalus panzeri and the Disease Cycle of Maize Redness in Serbia

    Science.gov (United States)

    Maize redness (MR), induced by stolbur phytoplasma (Candidatus Phytoplasma solani, subgroup 16SrXII-A), is characterized by midrib, leaf and stalk reddening and abnormal ear development. MR has been reported from Serbia, Romania and Bulgaria for 50 years, and recent epiphytotics reduced yields by 4...

  5. Prevalence, risk factor analysis, and hematological findings of hemoplasma infection in domestic cats from Valdivia, Southern Chile.

    Science.gov (United States)

    Walker Vergara, Romina; Morera Galleguillos, Francisco; Gómez Jaramillo, Marcelo; Pereira Almosny, Nadia Regina; Arauna Martínez, Pía; Grob Behne, Paulina; Acosta-Jamett, Gerardo; Müller, Ananda

    2016-06-01

    Four distinct cat hemoplasma species are recognized worldwide. However, this is the first study to investigate the prevalence, risk factors, and hematological findings of hemoplasmas in cats from Chile. Complete blood count and 16S rRNA real-time PCR for cat hemoplasma species were performed in 384 blood samples from domestic cats in Valdivia, Chile. Among the 384 samples the species-specific prevalence was as follows: 'Candidatus Mycoplasma haemominutum' (7.8%), Mycoplasma haemofelis (4.4%), 'Candidatus Mycoplasma turicensis' (1%), 'Ca. M. haemominutum'+M. haemofelis (0.78%), 'Ca. M. haemominutum'+'Ca. M. turicensis' (0.52%), 'Ca. M. haemominutum'+'Candidatus Mycoplasma haematoparvum' (0.26%) and 'Ca. M. haemominutum'+M. haemofelis+'Ca. M. haematoparvum' (0.26%). Male sex, older age, outdoor access, and FIV status were risk factors for hemoplasmosis. Mycoplasma haemofelis-positive cats had higher mean corpuscular volume and monocyte count. Four hemoplasma species circulate in the cat population of Valdivia. 'Candidatus M. turicensis' and 'Ca. M. haematoparvum' have been reported for the first time in Chilean cats. PMID:27260806

  6. Intestinal Endocellular Symbiotic Bacterium of the Macaque Louse Pedicinus obtusus: Distinct Endosymbiont Origins in Anthropoid Primate Lice and the Old World Monkey Louse▿ †

    OpenAIRE

    Fukatsu, Takema; Hosokawa, Takahiro; Koga, Ryuichi; Nikoh, Naruo; KATO,Takuya; HAYAMA, Shin-ichi; Takefushi, Haruo; Tanaka, Ichirou

    2009-01-01

    A symbiotic bacterium of the macaque louse, Pedicinus obtusus, was characterized. The symbiont constituted a gammaproteobacterial lineage distinct from the symbionts of anthropoid primate lice, localized in the midgut epithelium and the ovaries and exhibiting AT-biased genes and accelerated molecular evolution. The designation “Candidatus Puchtella pedicinophila” was proposed for it.

  7. Hard ticks and their bacterial endosymbionts (or would be pathogens)

    Czech Academy of Sciences Publication Activity Database

    Ahantarig, A.; Trinachartvanit, W.; Baimai, V.; Grubhoffer, Libor

    2013-01-01

    Roč. 58, č. 5 (2013), s. 419-428. ISSN 0015-5632 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * Candidatus Midichloria mitochondrii * Francisella-like endosymbionts * vector Ambylomma americanum * fever group Rickettsiae * Dermacentor andersoni * spotted fever * borne pathogens Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.145, year: 2013

  8. Examining the role of tuber biochemistry in the development of zebra chip in stored potato tubers

    Science.gov (United States)

    Zebra chip disease (ZC), associated with infection by the bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), is an emerging problem for potato growers in the United States, Mexico, and New Zealand. Although potato tubers exhibiting ZC symptoms will be rejected by processors, it remains possible...

  9. Diversity of zoonotic enterohepatic Helicobacter species and detection of a putative novel gastric Helicobacter species in wild and wild-born captive chimpanzees and western lowland gorillas

    Czech Academy of Sciences Publication Activity Database

    Flahou, B.; Modrý, David; Pomajbíková, Kateřina; Petrželková, Klára Judita; Smet, A.; Ducatelle, R.; Pasmans, F.; Sá, R. M.; Todd, A.; Hashimoto, C.; Mulama, M.; Kiang, J.; Rossi, M.; Haesebrouck, F.

    2014-01-01

    Roč. 174, 1-2 (2014), s. 186-194. ISSN 0378-1135 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Enterohepatic Helicobacter species * Gastric Helicobacter species * Helicobacter cinaedi * 'Candidatus Helicobacter homininae' * Chimpanzee * Gorilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.511, year: 2014

  10. Diversity of zoonotic enterohepatic Helicobacter species and detection of a putative novel gastric Helicobacter species in wild and wild-born captive chimpanzees and western lowland gorillas

    Czech Academy of Sciences Publication Activity Database

    Flahou, B.; Modrý, D.; Pomajbíková, K.; Petrželková, Klára Judita; Smet, A.; Ducatelle, R.; Pasmans, F.; Sá, R. M.; Todd, A.; Hashimoto, C.; Mulama, M.; Kiang, J.; Rossi, M.; Haesebrouck, F.

    2014-01-01

    Roč. 174, 1-2 (2014), s. 186-194. ISSN 0378-1135 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Enterohepatic Helicobacter species * Gastric Helicobacter species * Helicobacter cinaedi * Candidatus Helicobacter homininae * Chimpanzee * Gorilla Subject RIV: EG - Zoology Impact factor: 2.511, year: 2014

  11. Zebra chip progression: from inoculation of potato plants with liberibacter to development of disease symptoms in tubers

    Science.gov (United States)

    Zebra chip (ZC), a new and serious disease of potatoes, has caused millions of dollars in losses to the potato industry in the United States, Mexico, Central America, and New Zealand. The disease has been associated with the bacterium “Candidatus Liberibacter solanacearum” transmitted to potato by t...

  12. Evidence that Cell Death is Associated with Zebra Chip Disease in Potato Tubers

    Science.gov (United States)

    Zebra chip (ZC) is an established and highly destructive disease of potato (Solanum tuberosum L.) that occurs in several southwestern states of the United States, Mexico, Central America, and New Zealand. The causal agent for this disease has not been identified. However, the bacterium ‘Candidatus ...

  13. Scanning electron microscopy and in vitro cultivation of endophytic bacteria from potato tubers related to Zebra Chip disease

    Science.gov (United States)

    Zebra chip disease (ZCD) drastically reduces the quality and market value of potatoes in North America. The disease is associated with a phloem-limited alpha-proteobacterium, “Candidatus Liberibacter solanacearum”. No effective measure is currently available to control ZCD. It is known that endoph...

  14. Draft Genome Sequence of Actinomyces odontolyticus subsp. actinosynbacter Strain XH001, the Basibiont of an Oral TM7 Epibiont

    OpenAIRE

    Jeffrey S. McLean; Liu, Quanhui; Bor, Batbileg; Bedree, Joseph K.; Cen, Lujia; Watling, Michael; To, Thao T.; Bumgarner, Roger E; He, Xuesong; Shi, Wenyuan

    2016-01-01

    Here, we present the draft genome sequence of Actinomyces odontolyticus subsp. actinosynbacter strain XH001, isolated from the human oral cavity. Uniquely, it was discovered as a host bacterium to the ultrasmall epibiont TM7x, which is the first cultivated member of “Candidatus Saccharibacteria” (formerly candidate phylum TM7).

  15. Draft Genome Sequence of Actinomyces odontolyticus subsp. actinosynbacter Strain XH001, the Basibiont of an Oral TM7 Epibiont.

    Science.gov (United States)

    McLean, Jeffrey S; Liu, Quanhui; Bor, Batbileg; Bedree, Joseph K; Cen, Lujia; Watling, Michael; To, Thao T; Bumgarner, Roger E; He, Xuesong; Shi, Wenyuan

    2016-01-01

    Here, we present the draft genome sequence of Actinomyces odontolyticus subsp. actinosynbacter strain XH001, isolated from the human oral cavity. Uniquely, it was discovered as a host bacterium to the ultrasmall epibiont TM7x, which is the first cultivated member of "Candidatus Saccharibacteria" (formerly candidate phylum TM7). PMID:26847892

  16. Assessment of bacterial endosymbiont diversity in Otiorhynchus spp. (Coleoptera: Curculionidae larvae using a multitag 454 pyrosequencing approach

    Directory of Open Access Journals (Sweden)

    Hirsch Jacqueline

    2012-01-01

    Full Text Available Abstract Background Weevils of the genus Otiorhynchus are regarded as devastating pests in a wide variety of horticultural crops worldwide. So far, little is known on the presence of endosymbionts in Otiorhynchus spp.. Investigation of endosymbiosis in this genus may help to understand the evolution of different reproductive strategies in these weevils (parthenogenesis or sexual reproduction, host-symbiont interactions, and may provide a future basis for novel pest management strategy development. Here, we used a multitag 454 pyrosequencing approach to assess the bacterial endosymbiont diversity in larvae of four economically important Otiorhynchus species. Results High-throughput tag-encoded FLX amplicon pyrosequencing of a bacterial 16S rDNA fragment was used to characterise bacterial communities associated with different Otiorhynchus spp. larvae. By sequencing a total of ~48,000 PCR amplicons, we identified 49 different operational taxonomic units (OTUs as bacterial endosymbionts in the four studied Otiorhynchus species. More than 90% of all sequence reads belonged either to the genus Rickettsia or showed homology to the phylogenetic group of “Candidatus Blochmannia” and to endosymbionts of the lice Pedicinus obtusus and P. badii. By using specific primers for the genera Rickettsia and “Candidatus Blochmannia”, we identified a new phylogenetic clade of Rickettsia as well as “Candidatus Nardonella” endosymbionts in Otiorhynchus spp. which are closely related to “Candidatus Blochmannia” bacteria. Conclusions Here, we used multitag 454 pyrosequencing for assessment of insect endosymbiotic communities in weevils. As 454 pyrosequencing generates only quite short sequences, results of such studies can be regarded as a first step towards identifying respective endosymbiotic species in insects. In the second step of our study, we analysed sequences of specific gene regions for a more detailed phylogeny of selected endosymbiont genera

  17. Co-occurrence of nitrite-dependent anaerobic ammonium and methane oxidation processes in subtropical acidic forest soils.

    Science.gov (United States)

    Meng, Han; Wang, Yong-Feng; Chan, Ho-Wang; Wu, Ruo-Nan; Gu, Ji-Dong

    2016-09-01

    Anaerobic ammonium oxidation (anammox) and nitrite-dependent anaerobic methane oxidation (n-damo) are two new processes of recent discoveries linking the microbial nitrogen and carbon cycles. In this study, 16S ribosomal RNA (rRNA) gene of anammox bacteria and pmoA gene of n-damo bacteria were used to investigate their distribution and diversity in natural acidic and re-vegetated forest soils. The 16S rRNA gene sequences retrieved featured at least three species in two genera known anammox bacteria, namely Candidatus Brocadia anammoxidans, Candidatus Brocadia fulgida, and Candidatus Kuenenia stuttgartiensis while the pmoA gene amplified was affiliated with two species of known n-damo bacteria Candidatus Methylomirabilis oxyfera and a newly established Candidatus Methylomirabilis sp. According to the results, the diversity of anammox bacteria in natural forests was lower than in re-vegetated forests, but no significant difference was observed in n-damo community between them. Quantitative real-time PCR showed that both anammox and n-damo bacteria were more abundant in the lower layer (10-20 cm) than the surface layer (0-5 cm). The abundance of anammox bacteria varied from 2.21 × 10(5) to 3.90 × 10(6) gene copies per gram dry soil, and n-damo bacteria quantities were between 1.69 × 10(5) and 5.07 × 10(6) gene copies per gram dry soil in the two different layers. Both anammox and n-damo bacteria are reported for the first time to co-occur in acidic forest soil in this study, providing a more comprehensive information on more defined microbial processes contributing to C and N cycles in the ecosystems. PMID:27178181

  18. Distribution and activity of anaerobic ammonium-oxidising bacteria in natural freshwater wetland soils.

    Science.gov (United States)

    Shen, Li-dong; Wu, Hong-sheng; Gao, Zhi-qiu; Cheng, Hai-xiang; Li, Ji; Liu, Xu; Ren, Qian-qi

    2016-04-01

    Anaerobic ammonium oxidation (anammox) process plays a significant role in the marine nitrogen cycle. However, the quantitative importance of this process in nitrogen removal in wetland systems, particularly in natural freshwater wetlands, is still not determined. In the present study, we provided the evidence of the distribution and activity of anammox bacteria in a natural freshwater wetland, located in southeastern China, by using (15)N stable isotope measurements, quantitative PCR assays and 16S rRNA gene clone library analysis. The potential anammox rates measured in this wetland system ranged between 2.5 and 25.5 nmol N2 g(-1) soil day(-1), and up to 20% soil dinitrogen gas production could be attributed to the anammox process. Phylogenetic analysis of 16S rRNA genes showed that anammox bacteria related to Candidatus Brocadia, Candidatus Kuenenia, Candidatus Anammoxoglobus and two novel anammox clusters coexisted in the collected soil cores, with Candidatus Brocadia and Candidatus Kuenenia being the dominant anammox genera. Quantitative PCR of hydrazine synthase genes showed that the abundance of anammox bacteria varied from 2.3 × 10(5) to 2.2 × 10(6) copies g(-1) soil in the examined soil cores. Correlation analyses suggested that the soil ammonium concentration had significant influence on the activity of anammox bacteria. On the basis of (15)N tracing technology, it is estimated that a total loss of 31.1 g N m(-2) per year could be linked the anammox process in the examined wetland. PMID:26621804

  19. Genomics-Guided Discovery of Traits Contributing to Interactions of Pseudomonas fluorescens with Other Organisms

    Science.gov (United States)

    Pseudomonas fluorescens is a diverse bacterial species known for its ubiquity in natural habitats and the production of structurally diverse, bioactive secondary metabolites. The high degree of ecological and metabolic diversity represented in P. fluorescens is reflected in the genomic diversity di...

  20. Reconceptualisation of Approaches to Teaching Evaluation in Higher Education

    Science.gov (United States)

    Tran, Nga D.

    2015-01-01

    The ubiquity of using Student Evaluation of Teaching (SET) in higher education is inherently controversial. Issues mostly resolve around whether the instrument is reliable and valid for the purpose for which it was intended. Controversies exist, in part, due to the lack of a theoretical framework upon which SETs can be based and tested for their…

  1. Removing roadblocks for mobile phone sensing

    NARCIS (Netherlands)

    Brouwers, N.

    2014-01-01

    The increasing ubiquity of the modern smartphone, coupled with its technical capabilities in terms of processing power, internet connectivity, and sensor richness, make it an ideal platformfor sensing all kinds of information about ourselves and the world around us. The emerging field of Mobile Phon

  2. Molecular and physiological analysis of the role of osmolyte transporters BetL, Gbu, and OpuC in growth of Listeria monocytogenes at low temperatures

    NARCIS (Netherlands)

    Wemekamp-Kamphuis, H.H.; Sleator, R.D.; Wouters, J.A.; Hill, C.; Abee, T.

    2004-01-01

    Listeria monocytogenes is a ubiquitous food-borne pathogen found widely distributed in nature as well as an undesirable contaminant in a variety of fresh and processed foods. This ubiquity can be at least partly explained by the ability of the organism to grow at high osmolarity and reduced temperat

  3. The Nature of Music from a Biological Perspective

    Science.gov (United States)

    Peretz, Isabelle

    2006-01-01

    Music, as language, is a universal human trait. Throughout human history and across all cultures, people have produced and enjoyed music. Despite its ubiquity, the musical capacity is rarely studied as a biological function. Music is typically viewed as a cultural invention. In this paper, the evidence bearing on the biological perspective of the…

  4. The carbohydrates of Phaeocystis and their degradation in the microbial food web

    NARCIS (Netherlands)

    Alderkamp, Anne-Carlijn; Buma, Anita G. J.; van Rijssel, Marion

    2007-01-01

    The ubiquity and high productivity associated with blooms of colonial Phaeocystis makes it an important contributor to the global carbon cycle. During blooms organic matter that is rich in carbohydrates is produced. We distinguish five different pools of carbohydrates produced by Phaeocystis. Like a

  5. Cell Phones in the Classroom: Teachers' Perspectives of Inclusion, Benefits, and Barriers

    Science.gov (United States)

    Thomas, Kevin M.; O'Bannon, Blanche W.; Bolton, Natalie

    2013-01-01

    Historically viewed as a disruption by teachers, cell phones have been banned from 69% of classrooms (Common Sense Media, 2009). The increased ubiquity and instructional features of cell phones have prompted some teachers to re-evaluate the ban and consider the benefits associated with allowing cell phones in the classroom. This study surveyed 79…

  6. EST data: 5430 [RED

    Lifescience Database Archive (English)

    Full Text Available EH1662 AU101561 AU101562 E61662 4 D DPlate 056 F07 5' TAA TGT TTG CTT AGC CAA CC 3' 5' CGC TGC C ... AT TCT TAC ATC AC 3' >BTCI B8_1(X63219|pid:g246) B.taurus CI -B8 mRNA for ubiqu ...

  7. The neural basis of the speed-accuracy tradeoff

    NARCIS (Netherlands)

    R. Bogacz; E.J. Wagenmakers; B.U. Forstmann; S. Nieuwenhuis

    2010-01-01

    In many situations, decision makers need to negotiate between the competing demands of response speed and response accuracy, a dilemma generally known as the speed-accuracy tradeoff (SAT). Despite the ubiquity of SAT, the question of how neural decision circuits implement SAT has received little att

  8. Inside poverty and development in Africa : critical reflections on pro-poor policies

    NARCIS (Netherlands)

    Rutten, M.M.E.M.; Leliveld, A.H.M.; Foeken, D.W.J.

    2008-01-01

    When discussing development issues in Africa, it is not sufficient to simply stress the ubiquity of failure, malnutrition, disease, predatory states and war, one also has to recognize that important aspects in the lives of millions of ordinary people have been transformed over the last five decades.

  9. Organizing Blogs in an ESL/EFL Class Using the Rule of Thirds

    Science.gov (United States)

    Warhol, Tamara; Fields, Katherine Rhodes

    2012-01-01

    Given the ubiquity of digital media in daily life, students must not only read and write traditional texts, but also those associated with information and multimedia technologies, such as blogs, photo and video sharing sites, social networks, and wikis. In response to the need to teach students to read and write these non-traditional texts, guides…

  10. Sense of Community, Perceived Learning, and Achievement Relationships in an Online Graduate Course

    Science.gov (United States)

    Trespalacios, Jesus; Perkins, Ross

    2016-01-01

    The ubiquity of online programs in higher education requires continued focus on designing instructional environments that improve students' learning. We examine students' perceptions of sense of community and learning, as well as academic achievement, using grades obtained from a final project and participation in asynchronous discussion forums.…

  11. Using Information and Communication Technology (ICT) to the Maximum: Learning and Teaching Biology with Limited Digital Technologies

    Science.gov (United States)

    Van Rooy, Wilhelmina S.

    2012-01-01

    Background: The ubiquity, availability and exponential growth of digital information and communication technology (ICT) creates unique opportunities for learning and teaching in the senior secondary school biology curriculum. Digital technologies make it possible for emerging disciplinary knowledge and understanding of biological processes…

  12. Genetic transformation of Alstroemeria using particle bombardment

    NARCIS (Netherlands)

    Lin, H.S.; Toorn, van der C.; Raemakers, C.J.J.M.; Visser, R.G.F.; Jeu, de M.J.; Jacobsen, E.

    2000-01-01

    Transgenic plants were obtained after particle bombardment of embryogenic callus derived from stem segments of two tetraploid Alstroemeria genotypes with plasmids containing different selection/reporter genes. Firstly, a plasmid containing a firefly luciferase reporter gene driven by the maize ubiqu

  13. Facebook Addiction Levels of Students in the Physical Education and Sport Department

    Science.gov (United States)

    Yaman, Çetin

    2016-01-01

    Time spent using various technological equipment increases every day with rapid technology development. Unfortunately, technology addiction is becoming an important issue. Especially with the development and ubiquity of mobile technologies, social media addiction is expanding. The aim of this study is to measure the Facebook addiction levels of…

  14. Selection of mosquito life-histories: a hidden weapon against malaria?

    NARCIS (Netherlands)

    Ferguson, H.M.; Maire, N.; Takken, W.; Lyimo, I.N.; Briet, O.; Lindsay, S.W.; Smith, T.A.

    2012-01-01

    Background There has recently been a substantial decline in malaria incidence in much of Africa. While the decline can clearly be linked to increasing coverage of mosquito vector control interventions and effective drug treatment in most settings, the ubiquity of reduction raises the possibility tha

  15. Post-Translational Modification Biology of Glutamate Receptors and Drug Addiction

    OpenAIRE

    Mao, Li-Min; Guo, Ming-Lei; JIN, Dao-Zhong; Fibuch, Eugene E.; Choe, Eun Sang; Wang, John Q.

    2011-01-01

    Post-translational covalent modifications of glutamate receptors remain a hot topic. Early studies have established that this family of receptors, including almost all ionotropic and metabotropic glutamate receptor subtypes, undergoes active phosphorylation at serine, threonine, or tyrosine residues in their intracellular domains. Recent evidence identifies several glutamate receptor subtypes to be direct substrates for palmitoylation at cysteine residues. Other modifications such as ubiquiti...

  16. Introduction to solitons

    Indian Academy of Sciences (India)

    Miki Wadati

    2001-11-01

    As an introduction to the special issue on nonlinear waves, solitons and their significance in physics are reviewed. The soliton is the first universal concept in nonlinear science. Universality and ubiquity of the soliton concept are emphasized.

  17. The Iterative Design of a Mobile Learning Application to Support Scientific Inquiry

    Science.gov (United States)

    Marty, Paul F.; Mendenhall, Anne; Douglas, Ian; Southerland, Sherry A.; Sampson, Victor; Kazmer, Michelle M.; Alemanne, Nicole; Clark, Amanda; Schellinger, Jennifer

    2013-01-01

    The ubiquity of mobile devices makes them well suited for field-based learning experiences that require students to gather data as part of the process of developing scientific inquiry practices. The usefulness of these devices, however, is strongly influenced by the nature of the applications students use to collect data in the field. To…

  18. Scaffolding Java Programming on a Mobile Phone for Novice Learners

    Science.gov (United States)

    Mbogo, Chao; Blake, Edwin; Suleman, Hussein

    2015-01-01

    The ubiquity of mobile phones provides an opportunity to use them as a resource for construction of programs beyond the classroom. However, limitations of mobile phones impede their use as typical programming environments. This research proposes that programming environments on mobile phones should include scaffolding techniques specifically…

  19. Gustatory Habituation in "Drosophila" Relies on "Rutabaga" (Adenylate Cyclase)-Dependent Plasticity of GABAergic Inhibitory Neurons

    Science.gov (United States)

    Paranjpe, Pushkar; Rodrigues, Veronica; VijayRaghavan, K.; Ramaswami, Mani

    2012-01-01

    In some situations, animals seem to ignore stimuli which in other contexts elicit a robust response. This attenuation in behavior, which enables animals to ignore a familiar, unreinforced stimulus, is called habituation. Despite the ubiquity of this phenomenon, it is generally poorly understood in terms of the underlying neural circuitry. Hungry…

  20. Design and Implementation of BusinessApp, a MALL Application to Make Successful Business Presentations

    Science.gov (United States)

    Calle-Martínez, Cristina; Yanes, Lourdes Pomposo; Pareja-Lora, Antonio

    2016-01-01

    Little by little, (or, simply, MALL) is taking force in the field of education, as it supports language blended learning and language learning ubiquity. The study presented here belongs in the Social Ontology-based Cognitively Augmented Language Learning Mobile Environment (SO-CALL-ME) research project, whose final aim is to design and create…

  1. Queer Tracings of Genre

    DEFF Research Database (Denmark)

    Balle, Søren Hattesen

    2008-01-01

    A prominent feature of John Ashbery's debut collection Some Trees is the near ubiquity of classical and post-classical genre designations attached as titles to its poems. Among them appear titles such as "Eclogue", "Sonnet", "Meditations of a Parrot", and "A Pastoral". Neither does Ashbery hesitate...

  2. Users' Perceptions of Library Service Quality: A LibQUAL+ Qualitative Study.

    Science.gov (United States)

    Cook, Colleen; Heath, Fred M.

    2001-01-01

    Describes a study of ARL (Association of Research Libraries) members called LibQUAL+ that identified users' perceptions of library service quality and measured gaps between expected service and perceived service. Discusses results of user interviews regarding information seeking behavior; self reliance; ubiquity and ease of access; and hours of…

  3. Design Characteristics of Virtual Learning Environments: State of Research

    Science.gov (United States)

    Mueller, Daniel; Strohmeier, Stefan

    2011-01-01

    Virtual learning environments constitute current information systems' category for electronically supported training and development in (higher) education(al) and vocational training settings. Frequently expected advantages of using virtual learning environments refer, for instance, to the efficiency, individuality, ubiquity, timeliness and…

  4. Guests and Hosts--The Global Market in International Higher Education: Reflections on the Japan-UK Axis in Study Abroad

    Science.gov (United States)

    Walker, Patricia

    2010-01-01

    Taking as a starting point the present ubiquity of international student mobility, contrasting paradigms of international study are offered through a critical examination of two nations. The UK is presented as a leading host nation and provider of international higher education, significant revenue from which is central to the prosperity of the…

  5. Are Television Commercials Still Achievement Scripts for Women?

    Science.gov (United States)

    Yoder, Janice D.; Christopher, Jessica; Holmes, Jeffrey D.

    2008-01-01

    Content analyses of television advertising document the ubiquity of traditional images of women, yet few studies have explored their impact. One noteworthy exception is the experiment by Geis, Brown, Jennings, and Porter (1984). These researchers found that the achievement aspirations of controls and women exposed to traditional images were lower…

  6. Origins of Eukaryotic Sexual Reproduction

    OpenAIRE

    Goodenough, Ursula; Heitman, Joseph

    2014-01-01

    Sexual reproduction is a nearly universal feature of eukaryotic organisms. Given its ubiquity and shared core features, sex is thought to have arisen once in the last common ancestor to all eukaryotes. Using the perspectives of molecular genetics and cell biology, we consider documented and hypothetical scenarios for the instantiation and evolution of meiosis, fertilization, sex determination, uniparental inheritance of organelle genomes, and speciation.

  7. Learning Potentials of the Ubiquitous Internet: Using Mobile Devices to Support the Individual, Social and Physical Context of the Learner

    Science.gov (United States)

    Dalsgaard, Christian; Pedersen, Nicholai Friis; Aaen, Janus Holst

    2013-01-01

    The aim of this paper is to identify the key learning potentials of the ubiquitous internet. Rather than focusing on mobile technology or the mobility of the learner, the paper emphasises the ubiquity of internet access as a paramount catalyst for new learning in the digital age. From a sociocultural perspective the paper discusses different ways…

  8. Genomic Analysis of Secondary Metabolite Production by Pseudomonas fluorescens

    Science.gov (United States)

    Pseudomonas fluorescens is a diverse bacterial species known for its ubiquity in natural habitats and its production of secondary metabolites. The high degree of ecological and metabolic diversity represented in P. fluorescens is reflected in the genomic diversity displayed among strains. Certain st...

  9. Opportunistic beacon networks

    NARCIS (Netherlands)

    Türkes, Okan

    2016-01-01

    Modern society is surrounded by an ample spectrum of personal mobile devices with short-range wireless communication support. This ubiquity creates an immense potential of new concepts for people-centric ad hoc networks that can be applied to every personal and social dimension of life. The last dec

  10. Collaborative development of embedded systems

    NARCIS (Netherlands)

    Verhoef, Marcel; Pierce, Kenneth; Gamble, Carl; Broenink, Jan; Fitzgerald, John; Larsen, Peter Gorm; Verhoef, Marcel

    2014-01-01

    This chapter presents motivation for taking a collaborative multi-disciplinary approach to the model-based development of embedded systems. Starting from a consideration of the ubiquity of embedded systems in daily life it identifies challenges faced by industry in developing products in a timely ma

  11. Siim Nestor kuulas, nautis ja õppis funk'i / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2003-01-01

    Heliplaatidest: Roy Ayers Ubiquity "A Tear To A Smile", The Undisputed Truth "Face to Face With the Truth", Love Unlimited "In Heat", Gloria Scotti "What Am I Gonna Do", Bohannon "Summertime Groove", "Nice and Soulful", "One Way featuring Al Hudson", Cameo "Ugly Ego", The Gap Band "The Gap Band"

  12. Malaysian University Students' Use of Mobile Phones for Study

    Science.gov (United States)

    Pullen, Darren; J-F; Swabey, Karen; Abadooz, M.; Sing, Termit Kaur Ranjit

    2015-01-01

    Mobile technology coupled with Internet accessibility has increased not only how we communicate but also how we might engage in learning. The ubiquity of mobile technology, such as smart phones and tablet devices, makes it a valuable tool for accessing learning resources on the Internet. The unified theory of acceptance and use of technology…

  13. It’s the Geography, Stupid!

    DEFF Research Database (Denmark)

    Andersen, Rasmus Fonnesbæk

    2016-01-01

    Much research in political science examines either countries or individuals. However, technological advances in geographic information systems (GIS) software and the ubiquity of geo-coded data in recent years have opened up the possibility of political science research that is attentive to (1) sp...

  14. GETDB: 113898 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Request - strong and uniform in muscle and vm from stg 11. useful as driver? epi...form in muscle and vm from stg 11. useful as driver? Larval GFP epi, tr Larval X-gal sg, epi Adult GFP ubiqu

  15. Automated Detection of Financial Events in News Text

    NARCIS (Netherlands)

    F.P. Hogenboom (Frederik)

    2014-01-01

    markdownabstractToday’s financial markets are inextricably linked with financial events like acquisitions, profit announcements, or product launches. Information extracted from news messages that report on such events could hence be beneficial for financial decision making. The ubiquity of news, how

  16. Playing with History: A Look at Video Games, World History and Libraries

    Science.gov (United States)

    Snow, Cason E.

    2010-01-01

    The ubiquity of video games in today's society presents unique challenges and opportunities for librarians and faculty. A significant subset of video games use historical periods as a setting, some with greater adherence to history than others. Many students are playing these games and bringing preconceived ideas of the historical period to the…

  17. CLOSTRIDIUM PERFRINGENS

    Science.gov (United States)

    The incidence of C. perfringens food-poisoning is quite common and costly. Although somewhat fastidious in growth characteristics using synthetic laboratory media, the microorganism is very prolific when found in food products. Despite the pathogen’s ubiquity in the natural environment, foodborne i...

  18. The Colors of the Alphabet: Naturally-Biased Associations between Shape and Color

    Science.gov (United States)

    Spector, Ferrinne; Maurer, Daphne

    2011-01-01

    Many letters of the alphabet are consistently mapped to specific colors in English-speaking adults, both in the general population and in individuals with grapheme-color synaesthesia who perceive letters in color. Here, across six experiments, we tested the ubiquity of the color/letter associations with typically developing toddlers, literate…

  19. From "Banished" to "Brother Outsider", "Miss Navajo" to "An Inconvenient Truth": Documentary Films as Perspective-Laden Narratives

    Science.gov (United States)

    Hess, Diana

    2007-01-01

    The ubiquity of documentary films in social studies courses, along with their potential to influence what students learn, clearly show that documentary films matter in social studies education. While the high rate of documentary film usage by social studies teachers indicates that they are amenable to bringing new films into their classrooms, they…

  20. "I'm Ambivalent about It": The Dilemmas of PowerPoint

    Science.gov (United States)

    Hill, Andrea; Arford, Tammi; Lubitow, Amy; Smollin, Leandra M.

    2012-01-01

    The increasing ubiquity of PowerPoint in the university classroom raises complex questions about pedagogy and the creation of dynamic and effective learning environments. Though much of the sociological teaching literature has focused on engagement and active learning, very little of this work has addressed the presence of PowerPoint in sociology…