Energy Technology Data Exchange (ETDEWEB)
Andrews, A H; Kerr, L A; Cailliet, G M; Brown, T A; Lundstrom, C C; Stanley, R D
2007-11-04
Canary rockfish (Sebastes pinniger) have long been an important part of recreational and commercial rockfish fishing from southeast Alaska to southern California, but localized stock abundances have declined considerably. Based on age estimates from otoliths and other structures, lifespan estimates vary from about 20 years to over 80 years. For the purpose of monitoring stocks, age composition is routinely estimated by counting growth zones in otoliths; however, age estimation procedures and lifespan estimates remain largely unvalidated. Typical age validation techniques have limited application for canary rockfish because they are deep dwelling and may be long lived. In this study, the unaged otolith of the pair from fish aged at the Department of Fisheries and Oceans Canada was used in one of two age validation techniques: (1) lead-radium dating and (2) bomb radiocarbon ({sup 14}C) dating. Age estimate accuracy and the validity of age estimation procedures were validated based on the results from each technique. Lead-radium dating proved successful in determining a minimum estimate of lifespan was 53 years and provided support for age estimation procedures up to about 50-60 years. These findings were further supported by {Delta}{sup 14}C data, which indicated a minimum estimate of lifespan was 44 {+-} 3 years. Both techniques validate, to differing degrees, age estimation procedures and provide support for inferring that canary rockfish can live more than 80 years.
AFSC/ABL: Rockfish allozyme species identification (Sebastes aleutianus and borealis)
National Oceanic and Atmospheric Administration, Department of Commerce — Rougheye rockfish (Sebastes aleutianus) and shortraker rockfish (Sebastes borealis) were collected from the Washington coast, the Gulf of Alaska, the southern Bering...
Directory of Open Access Journals (Sweden)
Kristen M Green
Full Text Available Olive (Sebastes serranoides, black (Sebastes melanops, and blue rockfish (Sebastes mystinus are all common inhabitants of nearshore ecosystems on the West coast of North America and important components of the recreational fishery off California. Acoustic monitoring studies indicate that olive rockfish are highly residential and that black rockfish are capable of long migrations and have less site fidelity; yet little is known about the long-term movements of blue rockfish. External tag-recapture studies indicate that blue rockfish may have intermediate movements relative to these congener nearshore species. To better understand the site fidelity, and daily and seasonal movements of blue rockfish over long (>1-year time scales, we placed acoustic transmitters into 21 adult blue rockfish (30-41 cm total length in Carmel Bay, California. Blue rockfish displayed intermediate movement patterns and residency relative to other similar kelp forest rockfish species. Two-thirds of tagged blue rockfish (13 fish exhibited high residency to the study area (>12 mo. When in residence, mean home range of blue rockfish was 0.23 km2, however as many as 30% of tagged blue rockfish shifted their core home range area during the study. Most shifts in home range occurred during upwelling season, and tagged fish moved up to 3.1 km when in residence. Blue rockfish with short residence times were last detected in the study area in late winter and early spring. Blue rockfish were observed at shallower depths during day than night, likely indicative of diurnal feeding. However, over longer time scales, blue rockfish were detected at deeper depths during upwelling periods and with increased wave heights. Daily and seasonal vertical movements of blue rockfish may be influenced by upwelling conditions and local prey abundance.
Characteristics of pathogenic Vibrio sp. isolated from the rockfish, Sebastes schlegeli
International Nuclear Information System (INIS)
Kim, Jong Hwa
1995-02-01
At the summer time, an infectious bacterial disease occurs and damages the net cage farms of rockfish (Sebastes schlegeli) at the western coast of Korea. The symptoms of this disease include darkness of body color, ulceration of skin, anemia of gill-filaments, and congestion of operculum. In order to know the attributes of pathogenicity of this disease, the study is performed with isolated bacteria from the rockfish sampled at the fish farm, located at Taean-gun Chungcheongnam-do, from June to September in 1994. The pathogenic bacteria cna be isolated from dermal lesion, kidney, liver, and spleen of the sick fish, and classified as Vibrio sp. based on the morphological, biological, and biochemical examinations. These isolates are proliferated in BTB teepol, TCBS, TSA, XA, BHIA, media, not in SS and MacConkey media, and the optimal growth conditions for NaCl concentration, pH, and temperature are 3%, 7∼8, and 25∼30 .deg. C, respectively. They turn out to be sensitive to three chemicals such as SXT (sulfamethoxazol + trimethoprim), nalidixic acid, and tetracycline, but resistant to ampicillin and penicillin G. Finally, the virulence of infectious bacteria is appeared at both 20 .deg. C and 27 .deg. C when isolated pathogenic strains are injected into the muscle of healthy rockfish
International Nuclear Information System (INIS)
Gao, Yongwen; Svec, Russell A.; Wallace, Farron R.
2013-01-01
Highlights: ► Otoliths of 120 canary rockfish were analyzed for δ 18 O and δ 13 C. ► δ 18 O and δ 13 C values of the otoliths ranged from −0.2‰ to +1.7‰ and −5.4‰ to −1.4‰. ► No separation was observed from the isotopic data and δ 18 O vs. δ 13 C correlation. ► No significant difference was computed between WA and OR samples especially in δ 13 C. ► Canary rockfish may belong to a single spawning stock or population coast-wide. - Abstract: Canary rockfish are one of the commercially important rockfish species along the US Pacific coast. Yet little is known about their life history and stock structure. In this study 120 canary rockfish otoliths were collected from waters off the Washington and Oregon coast and subjected to stable O and C isotope (δ 18 O and δ 13 C) analyses. One powder sample was taken from the nucleus of each otolith, and the other from the 5th annual ring. Data from otolith nuclei can provide information on the natal sources and spawning stock separations, while data from age-1 to age-5 may indicate changes in fish habitat. Overall the δ 18 O values in otoliths of canary rockfish ranged from −0.2‰ to +1.7‰, whereas δ 13 C values of the same samples ranged from −5.4‰ to −1.4‰. The isotopic data and correlation of δ 18 O versus δ 13 C did not show clear separation between Washington and Oregon samples, similar to those for a previous study on yelloweye rockfish from the same region. These results suggest that canary rockfish may belong to a single spawning stock or population along the Washington and Oregon coast
International Nuclear Information System (INIS)
Anon.
1988-01-01
This study evaluates the commonly used oxytetracycline hydrochloride (OTC) and an alternate chemical, the radioisotope calcium-45, in terms of their success as time-markers to validate daily growth increment formation in the otoliths of juvenile black rockfish, Sebastes melanops
Kim, Jun-Hwan; Kang, Ju-Chan
2017-05-01
Juvenile rockfish Sebastes schlegelii (mean length 10.8±1.4cm, and mean weight 31.7±3.6g) were exposed for 4 weeks with the different levels of dietary chromium (Cr 6+ ) at 0, 120 and 240mg/L and ascorbic acids (AsA) at 100, 200 and 400mg/L. Significant accumulation occurred in specific tissues and hematological parameters were altered: red blood cell count, hematocrit, and hemoglobin increased; plasma components were altered including calcium, glucose, cholesterol, total protein, glutamic oxalate transaminase, and glutamic pyruvate transaminase. However, magnesium and alkaline phosphatase concentrations were unchanged. Ascorbic acids reduced both chromium uptake into tissues and altered hematological parameters. Copyright © 2017. Published by Elsevier Inc.
National Oceanic and Atmospheric Administration, Department of Commerce — Because rockfish (Sebastes spp.) are physoclystic, i.e. their gas bladders are closed off from the gut, they often suffer internal injuries from rapid, internal air...
Karageorge, Kurt W.; Wilson, Raymond R.
2017-01-01
Abstract Characterizing the mating systems of long‐lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity‐assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, a...
AFSC/ABL: Rockfish Habitat Dive Video Transects
National Oceanic and Atmospheric Administration, Department of Commerce — Many species of commercially valuable rockfish (Sebastes spp.) inhabit waters on the outer continental shelf in the Gulf of Alaska typically between depths of...
AFSC/ABL: Juvenile rockfish DNA species identification
National Oceanic and Atmospheric Administration, Department of Commerce — Many pelagic juvenile rockfish (Sebastes) were collected in juvenile salmonid surveys in the Gulf of Alaska (GOA) from 1998 to 2002. Often species identification of...
Kugapreethan, Roopasingam; Umasuthan, Navaneethaiyer; Wan, Qiang; Thulasitha, William Shanthakumar; Kim, Chul; Lee, Jehee
2017-02-01
Elevated levels of ROS can cause serious intracellular damages by reacting readily with nucleic acids, proteins and lipids, thus triggering tissue damage and cell death. Thioredoxin system is one of the principal factors that maintain the intracellular redox balance via its antioxidant property. In this study, we characterized two new thioredoxin isoforms (SsTXN-like 1 and SsMtTXN-like) from black rockfish, Sebastes schlegelii. The molecular and structural characteristics, as well as the evolutionary relationships of SsTXN-like 1 and SsMtTXN-like confirmed that they belong to the thioredoxin superfamily. A classical thioredoxin domain was found in both proteins with a conserved redox-active site CXYC, however, only the precursor of SsMtTXN-like protein possessed a mitochondrial targeting signal. The results from insulin disulfide reduction activity assay demonstrated that their recombinant proteins are capable of reducing the disulfide bonds of oxidatively damaged proteins via their oxidoreductase activities. The free radical scavenging activity assay revealed the prominent hydroxyl and DPPH scavenging activities of rSsTXN-like 1 and rSsMtTXN-like in a dose-dependent manner. Transcriptional studies showed a broad distribution of SsTXN-like 1 and SsMtTXN-like transcripts in all the examined tissues. Significant (p immune-related tissues after LPS, poly I:C and Streptococcus iniae challenges reflect their critical role in redox homeostasis in black rockfish. Taken together, SsTXN-like 1 and SsMtTXN-like, as two active members of thioredoxin superfamily, have significant antioxidant properties to housekeep the redox potential during various stress conditions and innate immune response of Sebastes schlegelii. Copyright © 2016 Elsevier Ltd. All rights reserved.
2010-10-01
... unexploited rockfish population in the California Current ecosystem, a non-quantitative assessment was... current equilibrium with these harvest specifications. q Widow rockfish was assessed in 2005, and an... Canary rockfish—A canary rockfish stock assessment was completed in 2007 and the stock was estimated to...
Kim, Jun-Hwan; Kang, Ju-Chan
2017-06-01
Juvenile rockfish, Sebastes schlegelii (mean length 11.3 ± 1.2 cm, and mean weight 32.5 ± 4.1 g) were exposed for four weeks to dietary lead (Pb 2+ ) at 0, 120, and 240 mg/L and ascorbic acid (AsA) at 100, 200, and 400 mg/L. The exposure concentrations and duration of significant Pb-induced accumulations in specific tissues of S. schlegelii were assessed. High levels of ascorbic acid significantly attenuated accumulations following exposure to dietary Pb. Dietary Pb exposure caused a significant increase in blood Pb concentrations, whereas red blood cell (RBC) count, hematocrit, and hemoglobin were significantly decreased. Notable changes were also observed in plasma calcium, magnesium, glucose, cholesterol, glutamic oxaloacetic transaminase (GOT), and glutamic pyruvate transaminase (GPT). The growth performance of S. schlegelii was significantly decreased. High doses AsA supplemention were effective in attenuating the changes brought about by dietary Pb exposure. Copyright © 2017 Elsevier Ltd. All rights reserved.
Harrenstien, Lisa A; Tornquist, Susan J; Miller-Morgan, Timothy J; Fodness, Brian G; Clifford, Kevin E
2005-01-15
To compare values of blood parameters in rockfish obtained by use of a point-of-care portable blood analyzer with values determined by a veterinary diagnostic laboratory, calculate reference ranges for various blood parameters in black rockfish, and compare values of blood parameters in clinically normal fish with those of fish with clinical abnormalities. Prospective study. 41 captive adult black rockfish (Sebastes melanops) and 4 captive adult blue rockfish (Sebastes mystinus). Rockfish were anesthetized with tricaine methanesulfonate for collection of blood samples. Heparinized blood samples were immediately analyzed with a point-of-care analyzer. Blood sodium, potassium, chloride, urea nitrogen, and glucose concentrations; Hct; pH; partial pressure of carbon dioxide; total carbon dioxide concentration; bicarbonate concentration; base excess; and hemoglobin concentration were determined. A microhematocrit technique was used to determine PCV, and a refractometer was used to estimate total plasma protein concentration. Paired heparinized blood samples were transported to a veterinary diagnostic laboratory for analyses. Data obtained with the point-of-care analyzer were reproducible; however, values for most blood parameters were significantly different from those obtained by the veterinary diagnostic laboratory. Fish with poor body condition had several blood parameter values that were lower than corresponding values in clinically normal fish. Point-of-care blood analyses may prove useful in rockfish. Point-of-care data for a large number of clinically normal fish must be obtained for reference ranges to be calculated, and further assessments of clinically abnormal fish are necessary to determine the relevance of the data.
Otolith shape lends support to the sensory drive hypothesis in rockfishes.
Tuset, V M; Otero-Ferrer, J L; Gómez-Zurita, J; Venerus, L A; Stransky, C; Imondi, R; Orlov, A M; Ye, Z; Santschi, L; Afanasiev, P K; Zhuang, L; Farré, M; Love, M S; Lombarte, A
2016-10-01
The sensory drive hypothesis proposes that environmental factors affect both signalling dynamics and the evolution of signals and receivers. Sound detection and equilibrium in marine fishes are senses dependent on the sagittae otoliths, whose morphological variability appears intrinsically linked to the environment. The aim of this study was to understand if and which environmental factors could be conditioning the evolution of this sensory structure, therefore lending support to the sensory drive hypothesis. Thus, we analysed the otolith shape of 42 rockfish species (Sebastes spp.) to test the potential associations with the phylogeny, biological (age), ecological (feeding habit and depth distribution) and biogeographical factors. The results showed strong differences in the otolith shapes of some species, noticeably influenced by ecological and biogeographical factors. Moreover, otolith shape was clearly conditioned by phylogeny, but with a strong environmental effect, cautioning about the use of this structure for the systematics of rockfishes or other marine fishes. However, our most relevant finding is that the data supported the sensory drive hypothesis as a force promoting the radiation of the genus Sebastes. This hypothesis holds that adaptive divergence in communication has significant influence relative to other life history traits. It has already been established in Sebastes for visual characters and organs; our results showed that it applies to otolith transformations as well (despite the clear influence of feeding and depth), expanding the scope of the hypothesis to other sensory structures. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.
Van Der Straaten, N.; Jacobson, A.; Halos, D.; Hershberger, P.; Kocan, A.A.; Kocan, R.
2005-01-01
Two morphologically distinct forms of an intraerythrocytic parasite(s) were detected by microscopic observation of Giemsa-stained blood films in 45.7% of 119 rockfish (Sebastes emphaeus) from the San Juan Archipelago (Washington State, U.S.A.). Infection prevalence for both forms was 53% in males, 44% in females, and 33% in fish of undetermined gender. A binucleate "ring-stage" was present at all 4 geographic sites, with a mean prevalence of 45.7%, while mean prevalence of a larger gamont-like form from the same sites was 5.1%. The relationship of the 2 forms to each other could not be determined. Neither schizogony nor binary fission was evident in any of the infected erythrocytes and the parasites contained no obvious pigment. The possibility of the 2 morphologic forms being 2 distinct species is supported by the observation that no difference in parasitemia was seen in the binucleate form among sites (1.6-1.9%), while parasitemia of the gamont-like form varied significantly among sites, ranging from a high of 4% to a low of 0.1%. Taxonomic status of either form could not be determined at this time based on limited existing morphologic data. ?? American Society of Parasitologists 2005.
Population Consequences of Age-Dependent Maternal Effects in Rockfish (Sebastes spp.)
Lucero, Yasmin
2007-01-01
I present a model of the early life history of a rockfish that includes an age-dependent maternal effect. The model is designed to accurately reflect the diverse uncertainties we have about early life history processes. The first portion of this thesis is devoted to an analytical treatment of the deterministic early life history model. I emphasize uncertainty about the functional form of density-dependent processes in the juvenile stage. The remainder of the thesis is devoted to demonstrating...
Karageorge, Kurt W; Wilson, Raymond R
2017-12-01
Characterizing the mating systems of long-lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity-assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, and reproductive life history traits-in the framework of sexual selection theory-to assess the mating system of Sebastes melanops . Microsatellite parentage analysis of 17 pregnant females, 1,256 of their progeny, and 106 adults from the population yielded one to four sires per brood, a mean of two sires, and a female mate frequency distribution with a truncated normal (random) pattern. The 11 multiple paternity broods all contained higher median allele richness than the six single paternity broods (Wilcoxon test: W = 0, p distributions that distinguish polygynandry and polyandrogyny mating systems, that is, variations of polygamy, but not polyandry. Inference for polygamy is consistent with weak premating sexual selection on males, expected in mid-water, schooling S. melanops , owing to polyandrous mating, moderately aggregated receptive females, an even ASR, and no territories and nests used for reproduction. Each of these characteristics facilitates more mating males and erodes conspicuous sexual dimorphism. Evaluation of male evolutionary responses of demersal congeners that express reproductively territorial behavior revealed they have more potential mechanisms for producing premating sexual selection, greater variation in reproductive success, and a reduced breeding effective population size of adults and annual effective size of a cohort, compared to S. melanops modeled with two mates per adult. Such divergence in behavior and mating system by territorial species may
Halos, D.; Hart, S.A.; Hershberger, P.; Kocan, R.
2005-01-01
In vitro explant cultures identified Ichthyophonus in 10.9% of 302 Puget Sound rockfish Sebastes emphaeus sampled from five sites in the San Juan Islands archipelago and Puget Sound, Washington, in 2003. None of the infected fish exhibited visible lesions and only a single fish was histologically positive. Significantly more females were infected (12.4%) than males (6.8%), and while infected males were only detected at two of the five sites, infected females were identified at all sites, with no significant differences in infection prevalence. Genomic sequences of Ichthyophonus isolates obtained from Puget Sound rockfish, Pacific herring Clupea pallasii, and Yukon River Chinook salmon Oncorhynchus tshawytscha were identical in both the A and B regions of the small subunit 18S ribosomal DNA but were different from Ichthyophonus sequences previously isolated from four different species of rockfish from the northeastern Pacific Ocean. Ichthyophonus in Puget Sound rockfish may not have been previously detected because the infection is subclinical in this species and earlier investigators did not utilize in vitro techniques for diagnosis of ichthyophoniasis. However, since clinical ichthyophoniasis has recently been identified in several other species of northeast Pacific rockfishes, it is hypothesized that this either is an emerging disease resulting from changing marine conditions or the result of introduction by infected southern species that appear during periodic El Nin??o events. ?? Copyright by the American Fisheries Society 2005.
Miller, J A
2009-07-01
Observations of multiple years of geographic variation in [Ba:Ca](otolith) and [Mn:Ca](otolith) in black rockfish Sebastes melanops prompted this study to examine the effects of temperature and water concentration on the otolith incorporation of Ba and Mn in this wholly marine species. The replicated experiment design consisted of two water temperatures (7.4 and 13.0 degrees C) and four water concentrations of Ba:Ca and Mn:Ca. A positive, linear relationship between [Ba:Ca](water) and [Ba:Ca](otolith) was observed at both temperatures. A positive temperature effect was also observed with mean partition coefficients for Ba (D(Ba)) greater in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.061 and 0.048, respectively). There was no relationship between [Mn:Ca](water) and [Mn:Ca](otolith) although a negative temperature effect was observed. Mean partition coefficients for Mn (D(Mn)) were lower in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.027 and 0.036, respectively). The data presented support the assumption of a positive, linear relationship between water and otolith Metal:Ca concentrations for Ba:Ca but not for Mn:Ca. Thus, although indicative of residence in distinct water masses, observed variation in [Metal:Ca](otolith) may not reflect variation in water concentration and can be affected by temperature. Caution should be applied in the interpretation of geographic variation of [Mn:Ca](otolith) until the mechanisms regulating its incorporation are more fully understood.
von Biela, Vanessa; Newsome, Seth D.; Zimmerman, Christian E.
2015-01-01
Otolith carbon isotope δ13C values may provide temporally resolved diet proxies in fish. If otolith δ13C values reflect diet, isotope values from recent otolith and muscle tissue should correlate and known ontogenetic diet shifts should be reflected in comparisons between otolith material deposited during different life history stages. We analyzed paired otolith and muscle samples for δ13C from black rockfish Sebastes melanops to examine the potential of otoliths to reflect diet in small (200-299 mm fork length) and large (≥300 mm) fish. We found a significant positive regression between δ13C values from recent (~12 mo) otolith material and muscle in large fish, but not in small fish. Within individual otoliths, δ13C values were enriched by ~3‰ in recent otolith edge material compared to age-0 otolith core material and were consistent with known nearshore-offshore gradients in δ13C values at the base of the food web. Bulk otolith δ13C appeared to provide a broad indicator of dietary carbon sources, but variation in metabolism and dissolved inorganic carbon δ13C among and within individuals likely influences otolith δ13C as well and limits precision. Nevertheless, the results are promising and bulk otolith δ13C may be an appropriate tool to examine large trophic and ecosystem level shifts that have occurred concurrently with changes in habitat, commercial fishing, invasive species, climate change, and other direct or indirect human impacts using historic or ancient otoliths. Future studies should continue to consider the utility of bulk otolith δ13C to describe diet in other marine fish using this simple approach.
Liu, Hui; Xu, Qiang; Xu, Qinzeng; Zhang, Yingqiu; Yang, Hongsheng
2015-01-01
The assessment of population structure and abundance of fish assemblages associated with artificial reefs (ARs) is an important aspect of AR management. In the present study, we used a Dive-Operated Stereo Video (stereo-DOV) technique to assess the population structure and abundance of Sebastes schlegeli associated with two metallic, and three wooden, vessel reefs in Haizhou Bay during 2012 and 2013. The study used video systems to obtain length measurements and estimates of abundance. The size composition of S. schlegeli differed among reefs and individuals around vessel reefs were all adults, with total lengths (TL) of >20 cm. Juvenile fish were encountered by divers in a rocky area near the island away from the vessel reefs. The largest individual S. schlegeli (with the highest TL) among five reefs were found around a metallic vessel reef in both 2012 and 2013. TL of S. s chlegeli from all reefs increased by an average of 3.2 cm ( P<0.05) from 2012 to 2013, with an estimated mean weight increase of 250.4 g ( P<0.05). The video survey also indicated a decrease in the biomass of schools near two metallic vessels between the years. Stereo-video technology was found to be suitable for rockfish surveys around the reefs.
International Nuclear Information System (INIS)
Marty, G.D.; Okihiro, M.S.; Hanes, D.
2003-01-01
Demersal rockfish are the only fish species that have been found dead in significant numbers after major oil spills, but the link between oil exposure and effect has not been well established. After the 1989 Exxon Valdez oil spill in Prince William Sound, Alaska, several species of rockfish (Sebastes spp.) from oiled and reference sites were analyzed for hydrocarbon metabolites in bile (1989-1991) and for microscopic lesions (1990 and 1991). Biliary hydrocarbons consistent with exposure to Exxon Valdez oil were elevated in 1989, but not in 1990 or 1991. Significant microscopic findings included pigmented macrophage aggregates and hepatic megalocytosis, fibrosis, and lipid accumulation. Site differences in microscopic findings were significant with respect to previous oil exposure in 1991 (P=0.038), but not in 1990. However, differences in microscopic findings were highly significant with respect to age and species in both years (P<0.001). We concluded that demersal rockfish were exposed to Exxon Valdez oil in 1989, but differences in microscopic changes in 1990 and 1991 were related more to age and species differences than to previous oil exposure. (author)
Directory of Open Access Journals (Sweden)
Brad F Reynolds
Full Text Available Loss and/or degradation of nearshore habitats have led to increased efforts to restore or enhance many of these habitats, particularly those that are deemed essential for marine fishes. Copper rockfish (Sebastes caurinus and lingcod (Ophiodon enlongatus are dominant members of the typical reef fish community that inhabit rocky and high-relief substrates along the Pacific Northwest. We used acoustic telemetry to document their residency and movements in the nearshore waters of Prince William Sound, Alaska in order to assess use of created reef habitat in an individual-based manner. A total of 57 fish were surgically implanted with acoustic transmitters. Forty-five fish were captured and monitored in three habitats: artificial reef, low-relief natural reef, and patchy high-relief natural reef. Within each habitat, both rockfish and lingcod exhibited long periods of residency with limited movements. Twelve rockfish were captured at the natural reefs and displaced a distance of 4.0 km to the artificial reef. Five of the 12 rockfish returned within 10 d of their release to their initial capture site. Another five of the 12 displaced fish established residency at the artificial reef through the duration of our study. Our results suggest the potential for artificial reefs to provide rockfish habitat in the event of disturbances to natural habitat.
Kim, Jun-Hwan; Kang, Ju-Chan
2016-01-01
Juvenile rockfish (mean length 13.7±1.7 cm, and mean weight 55.6±4.8 g) were exposed for 4 weeks with the different levels of dietary chromium (Cr(6+)) at 0, 30, 60, 120 and 240 mg/kg. The profile of chromium in the tissues of rockfish is dependent on the exposure periods and chromium concentration. After 4 weeks, the order of chromium accumulation in tissues was liver>kidney>spleen>intestine>gill>muscle. The dietary chromium exposure decreased the growth rate and hepatosomatic index of rockfish. The major hematological findings were significant decrease in the red blood cell (RBC) count, hematocrit (Ht) value, and hemoglobin (Hb) concentration exposed to ≥120 mg/kg chromium concentrations. The dietary chromium exposure (≥120 mg/kg) led to notable increase in glucose, cholesterol, glutamic oxalate transaminase (GOT), and glutamic pyruvate transaminase (GPT) in plasma, whereas there was no considerable change in calcium, magnesium, total protein, and alkaline phosphatase (ALP). The results indicated that the dietary chromium exposure to rockfish can induce significant chromium accumulation in the specific tissues, inhibition of growth, and hematological alterations. Copyright © 2015 Elsevier B.V. All rights reserved.
Thompson, Andrew R; Chen, Dustin C; Guo, Lian W; Hyde, John R; Watson, William
2017-09-01
Marine protected areas (MPAs) can facilitate recovery of diminished stocks by protecting reproductive adults. To effectively augment fisheries, however, reproductive output must increase within the bounds of MPAs so that larvae can be exported to surrounding areas and seed the region. In response to dramatic declines of rockfishes ( Sebastes spp.) in southern California by the late 1990s two large MPAs, the Cowcod Conservation Areas (CCAs), were established in 2001. To evaluate whether the CCAs affected rockfish productivity we evaluated the dynamics of 8 species that were, and 7 that were not, historically targeted by fishing. Abundances of 6/8 targeted and 4/7 non-targeted species increased regionally from 1998 to 2013. These upturns were probably affected by environmental conditions in addition to changes in fishing pressure as the presence of most species correlated negatively with temperature, and temperature was lower than the historic average in 11/15 years. Seventy-five per cent of the targeted, but none of the non-targeted species increased at a greater rate inside than outside the CCAs while controlling for environmental factors. Results indicate that management actions, coupled with favourable environmental conditions, facilitated the resurgence of multiple rockfish species that were targeted by intense fishing effort for decades.
Lyu, Likang; Wen, Haishen; Li, Yun; Li, Jifang; Zhao, Ji; Zhang, Simin; Song, Min; Wang, Xiaojie
2018-06-14
In the present study, we conducted an RNA-Seq analysis to characterize the genes and pathways involved in acute thermal and cold stress responses in the liver of black rockfish, a viviparous teleost that has the ability to cope with a wide range of temperature changes. A total of 584 annotated differentially expressed genes (DEGs) were identified in all three comparisons (HT vs NT, HT vs LT and LT vs NT). Based on an enrichment analysis, DEGs with a potential role in stress accommodation were classified into several categories, including protein folding, metabolism, immune response, signal transduction, molecule transport, membrane, and cell proliferation/apoptosis. Considering that thermal stress has a greater effect than cold stress in black rockfish, 24 shared DEGs in the intersection of the HT vs LT and HT vs NT groups were enriched in 2 oxidation-related gene ontology (GO) terms. Nine important heat-stress-reducing pathways were significantly identified and classified into 3 classes: immune and infectious diseases, organismal immune system and endocrine system. Eight DEGs (early growth response protein 1, bile salt export pump, abcb11, hsp70a, rtp3, 1,25-dihydroxyvitamin d(3) 24-hydroxylase, apoa4, transcription factor jun-b-like and an uncharacterized gene) were observed among all three comparisons, strongly implying their potentially important roles in temperature stress responses.
Species-Specific Responses of Juvenile Rockfish to Elevated pCO2: From Behavior to Genomics.
Directory of Open Access Journals (Sweden)
Scott L Hamilton
Full Text Available In the California Current ecosystem, global climate change is predicted to trigger large-scale changes in ocean chemistry within this century. Ocean acidification-which occurs when increased levels of atmospheric CO2 dissolve into the ocean-is one of the biggest potential threats to marine life. In a coastal upwelling system, we compared the effects of chronic exposure to low pH (elevated pCO2 at four treatment levels (i.e., pCO2 = ambient [500], moderate [750], high [1900], and extreme [2800 μatm] on behavior, physiology, and patterns of gene expression in white muscle tissue of juvenile rockfish (genus Sebastes, integrating responses from the transcriptome to the whole organism level. Experiments were conducted simultaneously on two closely related species that both inhabit kelp forests, yet differ in early life history traits, to compare high-CO2 tolerance among species. Our findings indicate that these congeners express different sensitivities to elevated CO2 levels. Copper rockfish (S. caurinus exhibited changes in behavioral lateralization, reduced critical swimming speed, depressed aerobic scope, changes in metabolic enzyme activity, and increases in the expression of transcription factors and regulatory genes at high pCO2 exposure. Blue rockfish (S. mystinus, in contrast, showed no significant changes in behavior, swimming physiology, or aerobic capacity, but did exhibit significant changes in the expression of muscle structural genes as a function of pCO2, indicating acclimatization potential. The capacity of long-lived, late to mature, commercially important fish to acclimatize and adapt to changing ocean chemistry over the next 50-100 years is likely dependent on species-specific physiological tolerances.
2010-12-03
... more heavily towards the most recent year, to predict how current management measures will affect the... bycatch rate of co-occurring overfished species, primarily widow rockfish and canary rockfish, in the... initial testing of the jig gear, some additional catch of widow rockfish and canary rockfish is...
2010-10-01
... abundance of an unexploited rockfish population in the California Current ecosystem, a non-quantitative... remain at its current equilibrium with these harvest specifications. q/ Widow rockfish was assessed in... fishing activities. r/ Canary rockfish—A canary rockfish stock assessment was completed in 2007 and the...
50 CFR 679.82 - Rockfish Program use caps and sideboard limits.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Rockfish Program use caps and sideboard... ECONOMIC ZONE OFF ALASKA Rockfish Program § 679.82 Rockfish Program use caps and sideboard limits. (a) Use caps—(1) General. Use caps limit the amount of rockfish QS and CQ of primary rockfish species that may...
Directory of Open Access Journals (Sweden)
Darienne Lancaster
2015-09-01
Full Text Available International declines in marine biodiversity have lead to the creation of marine protected areas and fishery reserve systems. In Canada, 164 Rockfish Conservation Areas (RCAs were implemented between 2003 and 2007 and now cover 4847.2 km² of ocean. These reserves were created in response to widespread concern from fishers and nongovernmental organizations about inshore rockfish (genus Sebastes population declines. We used the design principles for effective common-pool resource management systems, originally developed by Elinor Ostrom, to assess the social and ecological effectiveness of these conservation areas more than 10 years after their initial implementation. We assessed the relative presence or absence of each design principle within current RCA management. We found that 2 of the 11 design principles were moderately present in the recreational fishery. All other design principles were lacking for the recreational sector. We found that 2 design principles were fully present and 5 were moderately present in the commercial sector. Four design principles were lacking in the commercial sector. Based on this analysis, we highlight 4 main areas for management improvement: (1 create an education and outreach campaign to explain RCA rules, regulations, boundaries, and the need for marine conservation; (2 increase monitoring of users and resources to discourage noncompliance and gather the necessary data to create social buy-in for marine conservation; (3 encourage informal nested governance through stakeholder organizations for education and self-regulation (e.g. fisher to fisher; and (4 most importantly, create a formal, decadal RCA review process to gather stakeholder input and make amendments to regulations and RCA boundaries. This information can be used to inform spatial management systems both in Canada and internationally. This analysis also contributes to a growing literature on effectively scaling up small-scale management techniques
Central Gulf of Alaska Rockfish Permit Program
National Oceanic and Atmospheric Administration, Department of Commerce — The North Pacific Fishery Management Council adopted the Central Gulf of Alaska Rockfish Program (Rockfish Program) on June 14, 2010, to replace the expiring Pilot...
50 CFR 679.81 - Rockfish Program annual harvester and processor privileges.
2010-10-01
... as permitted by general antitrust law; and (ii) The rockfish cooperative must establish a monitoring... cooperative is formed or is operating in compliance with antitrust law. (5) Application for the rockfish... the antitrust laws of the rockfish cooperative's proposed conduct. Membership in a rockfish...
AFSC/ABL: Gulf of Alaska Diel Trawl Survey, 2005-2006
National Oceanic and Atmospheric Administration, Department of Commerce — Diel epipelagic sampling for juvenile Pacific salmon (Oncorhynchus spp.), rockfish (Sebastes spp.), sablefish (Anoplopoma fimbria), and associated species was...
2011-12-21
... (50 CFR part 660, subparts C through G). Changes to current groundfish management measures implemented... Groundfish Fishery Management Measures The State of Washington manages canary and yelloweye rockfish under a... guidelines for canary and/or yelloweye rockfish. During 2011, the Washington State Department of Fish and...
Yan, Quangen; Zhu, Xiaoming; Yang, Yunxia; Han, Dong; Xie, Shouqi
2014-12-01
An 8-week feeding experiment was conducted in an indoor recirculation seawater system to investigate the effects of partial replacement of dietary fishmeal with proteins from five sources on the growth performance and feed utilization of Sebastes schlegeli. Six isonitrogenous and isoenergetic diets were formulated using fishmeal (FM, the control) as sole protein source, or proteins from five sources including poultry by-product meal (PBM), meat and bone meal (MBM), soybean meal (SBM), cottonseed meal (CSM) and canola meal (CNM). Fifteen percent of the crude protein provided by fish meal was replaced, respectively. The results showed that the differences in specific growth rate (SGR) and survival rate (SR) among fish fed PBM, MBM, SBM, CSM and whole FM diets were not significant. However, SGR and SR of fish fed CNM diet was significantly lower than that of other treatments. Feeding rate, feed conversion, nutrient retention showed similar patterns to that of growth. Fish fed CSM and CNM showed significantly lower apparent digestibility coefficient (ADC) of dry matter and gross energy than those fed others while fish fed CNM showed lower ADC of crude protein than those fed others ( Preplacement with CNM reduced fish growth and feed utilization.
AFSC/RACE/GAP/Conrath: Reproduction of Groundfish
National Oceanic and Atmospheric Administration, Department of Commerce — Data are currently limited or lacking for several federally managed rockfish species of the genus Sebastes found within the Gulf of Alaska. This project is related...
Love, Milton S.
2009-01-01
Resource managers are concerned that offshore oil platforms in the Southern California Bight may be contributing to environmental contaminants accumulated by marine fishes. To examine this possibility, 18 kelp bass (Paralabrax clathratus), 80 kelp rockfish (Sebastes atrovirens), and 98 Pacific sanddab (Citharichthys sordidus) were collected from five offshore oil platforms and 10 natural areas during 2005-2006 for whole-body analysis of 63 elements. The natural areas, which served as reference sites, were assumed to be relatively uninfluenced by contaminants originating from platforms. Forty-two elements were excluded from statistical comparisons for one of three reasons: they consisted of major cations that were unlikely to accumulate to potentially toxic concentrations under ambient exposure conditions; they were not detected by the analytical procedures; or they were detected at concentrations too low to yield reliable quantitative measurements. The remaining 21 elements consisted of aluminum, arsenic, barium, cadmium, chromium, cobalt, copper, gallium, iron, lead, lithium, manganese, mercury, nickel, rubidium, selenium, strontium, tin, titanium, vanadium, and zinc. Statistical comparisons of these 21 elements indicated that none consistently exhibited higher concentrations at oil platforms than at natural areas. Eight comparisons yielded significant interaction effects between total length (TL) of the fish and the two habitat types (oil platforms and natural areas). This indicated that relations between certain elemental concentrations (i.e., copper, rubidium, selenium, tin, titanium, and vanadium) and habitat type varied by TL of affected fish species. To better understand these interactions, we examined elemental concentrations in very small and very large individuals of affected species. Although significant interactions were detected for rubidium, tin, and selenium in kelp rockfish, the concentrations of these elements did not differ significantly between
Juvenile Rockfish Recruitment Cruise
National Oceanic and Atmospheric Administration, Department of Commerce — In 1983, the groundfish analysis project began a series of yearly cruises designed to assess the annual abundance of juvenile rockfish along the central California...
2012-04-17
... (50 CFR part 660, subparts C through G). Changes to current groundfish management measures implemented... indicate that the probability of encountering canary rockfish, darkblotched rockfish, Pacific ocean perch...
50 CFR 660.160 - Catcher/processor (C/P) Coop Program.
2010-10-01
... Pacific whiting, canary rockfish, darkblotched rockfish, Pacific Ocean perch, widow rockfish; (ii) Species... issuance for C/P endorsement—(i) Eligibility criteria for C/P endorsement. Only current owners of a current... with the current limited entry trawl permit accrues to the current permit owner. NMFS will not...
2011-09-02
... final rule and current codified regulations that resulted from incorrect amendatory instructions in the... bag limit is 10 RCG Complex fish per day coastwide. Retention of canary rockfish, yelloweye rockfish...
Directory of Open Access Journals (Sweden)
Rahman Md Mizanur
2014-09-01
Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.
Rockfish Pilot Permit Program (RPP)
National Oceanic and Atmospheric Administration, Department of Commerce — The Rockfish Pilot Program was a five-year project that allowed harvesters to form voluntary cooperatives and receive an exclusive harvest privilege for groundfish...
Isolation and expression analysis of FTZ-F1 encoding gene of black rock fish ( Sebastes schlegelii)
Shafi, Muhammad; Wang, Yanan; Zhou, Xiaosu; Ma, Liman; Muhammad, Faiz; Qi, Jie; Zhang, Quanqi
2013-03-01
Sex related FTZ-F1 is a transcriptional factor regulating the expression of fushi tarazu (a member of the orphan nuclear receptors) gene. In this study, FTZ-F1 gene ( FTZ-F1) was isolated from the testis of black rockfish ( Sebastes schlegeli) by homology cloning. The full-length cDNA of S. schlegeli FTZ-F1 ( ssFTZ-F1) contained a 232bp 5' UTR, a 1449bp ORF encoding FTZ-F1 (482 amino acid residules in length) with an estimated molecular weight of 5.4kD and a 105bp 3' UTR. Sequence, tissue distribution and phylogenic analysis showed that ssFTZ-F1 belonged to FTZ group, holding highly conserved regions including I, II and III FTZ-F1 boxes and an AF-2 hexamer. Relatively high expression was observed at different larva stages. In juveniles (105 days old), the transcript of ssFTZ-F1 can be detected in all tissues and the abuncance of the gene transcript in testis, ovary, spleen and brain was higher than that in other tissues. In mature fish, the abundance of gene transcript was higher in testis, ovary, spleen and brain than that in liver (trace amount), and the gene was not transcribed in other tissues. The highest abundance of gene transcript was always observed in gonads of both juvenile and mature fish. In addition, the abundance of gene transcript in male tissues were higher than that in female tissue counterparts ( P<0.05).
West Coast Rockfish Conservation Areas, 2015
National Oceanic and Atmospheric Administration, Department of Commerce — These data delineate Rockfish Conservation Areas (RCA) off the West Coast of the United States for 2015. There are three types of areas closures depicted in this...
78 FR 44213 - Spring 2013 Semiannual Agenda of Regulations
2013-07-23
... Distinct Population Segments of Yelloweye Rockfish, Canary Rockfish, and Bocaccio. 64 Amending the Atlantic... Biological Opinion; and, (3) consider revising the current smoothhound shark quota based on updated catch... generic amendment is to change the current reporting requirements for those dealers who purchase fish...
Cryptic Sebastes norvegicus species in Greenland waters revealed by microsatellites
DEFF Research Database (Denmark)
Saha, Atal; Hauser, Lorenz; Hedeholm, Rasmus
2017-01-01
Identification of cryptic species can have profound implications in fishery management, conservation and biodiversity contexts. In the North Atlantic, the genus Sebastes is currently represented by four species, although additional cryptic species have been assumed. The connectivity of the gene...
2012-05-15
... decrease in estimated current abundance from the prior assessment. The SRG met in Seattle, Washington, from... that the current modeling approach, which implements a relatively simple base case in the Stock...[deg] N. lat. The 2012 allocations of Pacific Ocean perch, canary rockfish, darkblotched rockfish, and...
2010-04-28
... Sound/ Georgia Basin DPS designation. Comment 2: One reviewer stated that the genetic data from other... finding of discreteness was questionable for each species given the lack of genetic data. One of the.... Response: While we lack genetic data for yelloweye rockfish, canary rockfish and bocaccio within each DPS...
AFSC/ABL: Embryonic development of quillback rockfish
National Oceanic and Atmospheric Administration, Department of Commerce — Maternal effects on the quality of progeny can have direct impacts on population productivity. Rockfish are viviparous and the oil globule size of larvae at...
Ichthyophonus in sport-caught groundfishes from southcentral Alaska.
Harris, Bradley P; Webster, Sarah R; Wolf, Nathan; Gregg, Jacob L; Hershberger, Paul K
2018-05-07
This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.
Otolith patterns of rockfishes from the northeastern Pacific.
Tuset, Victor M; Imondi, Ralph; Aguado, Guillermo; Otero-Ferrer, José L; Santschi, Linda; Lombarte, Antoni; Love, Milton
2015-04-01
Sagitta otolith shape was analysed in twenty sympatric rockfishes off the southern California coast (Northeastern Pacific). The variation in shape was quantified using canonical variate analysis based on fifth wavelet function decomposition of otolith contour. We selected wavelets because this representation allow the identifications of zones or single morphological points along the contour. The entire otoliths along with four subsections (anterior, ventral, posterodorsal, and anterodorsal) with morphological meaning were examined. Multivariate analyses (MANOVA) showed significant differences in the contours of whole otolith morphology and corresponding subsection among rockfishes. Four patterns were found: fusiform, oblong, and two types of elliptic. A redundancy analysis indicated that anterior and anterodorsal subsections contribute most to define the entire otolith shape. Complementarily, the eco-morphological study indicated that the depth distribution and strategies for capture prey were correlated to otolith shape, especially with the anterodorsal zone. © 2014 Wiley Periodicals, Inc.
Genetic diversity and population structure of the marbled rockfish ...
Indian Academy of Sciences (India)
Key Laboratory for Marine Living Resources and Molecular Engineering, College of Marine Science,. Zhejiang ... MgCl2, 0.2 mM dNTPs, 0.2 μM of the forward and reverse ..... and tolerance, and oxygen consumption of the marbled rockfish,.
A new trichosomoidid from the skin of Sebastes spp. (Pisces) from British Columbia, Canada
Czech Academy of Sciences Publication Activity Database
Moravec, František; Conboy, G. A.; Speare, D. J.
2005-01-01
Roč. 91, č. 2 (2005), s. 411-414 ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z60220518 Keywords : Huffmanela * Sebastes * Canada Subject RIV: EA - Cell Biology Impact factor: 1.524, year: 2005
2011-09-09
... in the Monterey and Conception areas; canary rockfish; cowcod south of Point Conception to the U.S... easy access to the current rebuilding plans. Consistent with the existing provisions of the FMP, any...
The Limacidae of the Canary Islands
Regteren Altena, van C.O.
1950-01-01
CONTENTS Introduction............... 3 Systematic survey of the Limacidae of the central and western Canary Islands 5 Biogeographical notes on the Limacidae of the Canary Islands . . . . 21 Alphabetical list of the persons who collected or observed Limacidae in the Canary Islands.............. 31
Ichthyophonus in sport-caught groundfishes from southcentral Alaska
Harris, Bradley P.; Webster, Sarah R.; Wolf, Nathan; Gregg, Jacob L.; Hershberger, Paul
2018-01-01
This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.
Using RAD-seq to recognize sex-specific markers and sex chromosome systems.
Gamble, Tony
2016-05-01
Next-generation sequencing methods have initiated a revolution in molecular ecology and evolution (Tautz et al. ). Among the most impressive of these sequencing innovations is restriction site-associated DNA sequencing or RAD-seq (Baird et al. ; Andrews et al. ). RAD-seq uses the Illumina sequencing platform to sequence fragments of DNA cut by a specific restriction enzyme and can generate tens of thousands of molecular genetic markers for analysis. One of the many uses of RAD-seq data has been to identify sex-specific genetic markers, markers found in one sex but not the other (Baxter et al. ; Gamble & Zarkower ). Sex-specific markers are a powerful tool for biologists. At their most basic, they can be used to identify the sex of an individual via PCR. This is useful in cases where a species lacks obvious sexual dimorphism at some or all life history stages. For example, such tests have been important for studying sex differences in life history (Sheldon ; Mossman & Waser ), the management and breeding of endangered species (Taberlet et al. ; Griffiths & Tiwari ; Robertson et al. ) and sexing embryonic material (Hacker et al. ; Smith et al. ). Furthermore, sex-specific markers allow recognition of the sex chromosome system in cases where standard cytogenetic methods fail (Charlesworth & Mank ; Gamble & Zarkower ). Thus, species with male-specific markers have male heterogamety (XY) while species with female-specific markers have female heterogamety (ZW). In this issue, Fowler & Buonaccorsi () illustrate the ease by which RAD-seq data can generate sex-specific genetic markers in rockfish (Sebastes). Moreover, by examining RAD-seq data from two closely related rockfish species, Sebastes chrysomelas and Sebastes carnatus (Fig. ), Fowler & Buonaccorsi () uncover shared sex-specific markers and a conserved sex chromosome system. © 2016 John Wiley & Sons Ltd.
SWFSC FED Mid Water Trawl Juvenile Rockfish Survey, Surface Data, 1987-2015
National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC FED Mid Water Trawl Juvenile Rockfish Survey: Station Information and Surface Data. Surveys have been conducted along the central California coast in May/June...
Seasonal varability of the Canary Current
Vélez-Belchí, P.; Hernandez-Guerra, A.; Pérez-Hernández, M. D.
2016-02-01
The Atlantic meridional overturning circulation (AMOC) is recognized as an important component of the climate system, contributing to the relatively mild climate of northwest Europe. Due to its importance, the strength of the AMOC is continually monitored along 26ºN with several moorings, east of the Bahamas, in the Middle Atlantic Ridge and south of the Canary islands, known as the RAPID array. The measurements of the RAPID array show a 6 Sv seasonal cycle for the AMOC, and recent studies have pointed out the dynamics of the eastern Atlantic as the main driver for this seasonal cycle, specifically, rossby waves excited south of the Canary Islands.Due to the important role of the eastern Atlantic, in this study we describe the seasonal cycle of the Canary Current (CC) and the Canary Upwelling Current (CUC), using hydrographic data from two cruises carried out in a box around the Canary Islands, the region where the eastern component of the RAPID array is placed. CTD, VMADCP and LADCP data were combined with inverse modeling in order to determine absolute geostrophic transports in the Canary Islands region in fall and spring. During spring, the overall transport of Canary Current and the CUC was southward. In the Lanzarote Passage (LP), between the Canary Islands and Africa, the CUC transported 0.6±0.20 Sv southward, while the Canary Current transported 1.0±0.40 Sv in the oceanic waters of the Canary Islands Archipelago. During fall, the CUC transported 2.8±0.4Sv northward, while the CC transported 2.9±0.60 Sv southward in the oceanic waters of the Canary Islands Archipelago. The seasonal cycle observed has and amplitude of 3.4Sv for the CUC and 1.9Sv for the CC. Data from a mooring in the LP and the hydrographic data was used to calibrate geostrophic transport estimated using altimetry data. The amplitude of the seasonal cycle of the geostrophic transport obtained using the calibrated altimetry data (Figure 1) was quite similar to the seasonal cycle of the
Seasonal cycle of the Canary Current.
Vélez-Belchí, P.; Hernandez-Guerra, A.; Pérez-Hernández, M. D.
2015-12-01
The Atlantic meridional overturning circulation (AMOC) is recognized as an important component of the climate system, contributing to the relatively mild climate of northwest Europe. Due to its importance, the strength of the AMOC is continually monitored along 26ºN with several moorings east of the Bahamas, in the Middle Atlantic Ridge and south of the Canary islands, known as the RAPID array. The measurements of the RAPID array show a 6 Sv seasonal cycle for the AMOC, and recent studies have pointed out the dynamics of the eastern Atlantic as the main driver for this seasonal cycle, specifically, rossby waves excited south of the Canary Islands. Due to the important role of the eastern Atlantic, in this study we describe the seasonal cycle of the Canary Current (CC) and the Canary Upwelling Current (CUC) using hydrographic data from two cruises carried out in a box around the Canary Islands, the region where the eastern component of the RAPID array is placed. CTD, VMADCP and LADCP data were combined with inverse modeling in order to determine absolute geostrophic transports in the Canary Islands region in fall and spring. During spring, the overall transport of Canary Current and the CUC was southward. In the Lanzarote Passage (LP), between the Canary Islands and Africa, the CUC transported 0.6±0.20 Sv southward, while the Canary Current transported 1.0±0.40 Sv in the oceanic waters of the Canary Islands Archipelago. During fall, the CUC transported 2.8±0.4Sv northward, while the CC transported 2.9±0.60 Sv southward in the oceanic waters of the Canary Islands Archipelago. The seasonal cycle observed has an amplitude of 3.4Sv for the CUC and 1.9Sv for the CC. Data from a mooring in the LP and the hydrographic data was used to calibrate geostrophic transport estimated using altimetry data. The amplitude of the seasonal cycle of the geostrophic transport obtained using the calibrated altimetry data (Figure 1) was quite similar to the seasonal cycle of the
SWFSC FED Mid Water Trawl Juvenile Rockfish Survey, CTD Data, 1987-2015
National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC FED Mid Water Trawl Juvenile Rockfish Survey: CTD Data. Surveys have been conducted along the central California coast in May/June every year since 1983. In...
Quantifying Physiological, Behavioral and Ecological Consequences of Hypoxic Events in Kelp Forest
Litvin, S. Y.; Beers, J. M.; Woodson, C. B.; Leary, P.; Fringer, O. B.; Goldbogen, J. A.; Micheli, F.; Monismith, S. G.; Somero, G. N.
2016-02-01
Rocky reef kelp forests that extend along the coast of central California, like many habitats in upwelling systems, often experience inundations of low dissolved oxygen (DO) or hypoxic waters. These events have the potential to influence the structure and function of coastal ecosystems. The ecological consequences of hypoxia for these systems will be mediated by physiological thresholds and behavioral responses of resident organisms in the context of the spatial and temporal variability of DO, and other potential stressors. Our research focuses on Sebastes (i.e. rockfish) because of their commercial, recreational and ecological importance, high abundance across near shore habitats and the potentially severe impacts of physiological stress due to hypoxia. In the lab, to investigate how hypoxic events physiologically effect rockfish, we exposed young of the year (YOY) of 5 species and two life stages of blue rockfish, S. mystinus (YOY and 1+), to DO concentrations representative of upwelling conditions and measured a suite of whole organisms and tissue level responses including metabolic rate, ventilation, tissue-level metabolism, and blood biochemistry. Results demonstrate species and life stage specific differences in physiological stress under upwelling driven hypoxic conditions and suggest YOY rockfishes may currently be living near their physiological limits. In the laboratory we further explored if physiological impacts result in behavioral consequences by examining the startle response of YOY rockfish, a relative measure of predator avoidance ability, under a range of DO concentrations and exposure durations. To further explore behavioral responses of rockfish to low in DO within the kelp forest we are using two approaches, monitoring the vertical distribution of fish communities across the water column using an acoustic imaging camera (ARIS 3000, Soundmetrics Inc.) and acoustic tagging, with 3-D positioning ability (VPS, VEMCO Inc.), of larger blue rockfish
50 CFR 679.84 - Rockfish Program recordkeeping, permits, monitoring, and catch accounting.
2010-10-01
..., monitoring, and catch accounting. 679.84 Section 679.84 Wildlife and Fisheries FISHERY CONSERVATION AND..., permits, monitoring, and catch accounting. (a) Recordkeeping and reporting. See § 679.5(r). (b) Permits... cooperative or rockfish limited access fishery. The requirements under paragraphs (c)(1) through (9) of this...
The deep Canary poleward undercurrent
Velez-Belchi, P. J.; Hernandez-Guerra, A.; González-Pola, C.; Fraile, E.; Collins, C. A.; Machín, F.
2012-12-01
Poleward undercurrents are well known features in Eastern Boundary systems. In the California upwelling system (CalCEBS), the deep poleward flow has been observed along the entire outer continental shelf and upper-slope, using indirect methods based on geostrophic estimates and also using direct current measurements. The importance of the poleward undercurrents in the CalCEBS, among others, is to maintain its high productivity by means of the transport of equatorial Pacific waters all the way northward to Vancouver Island and the subpolar gyre but there is also concern about the low oxygen concentration of these waters. However, in the case of the Canary Current Eastern Boundary upwelling system (CanCEBS), there are very few observations of the poleward undercurrent. Most of these observations are short-term mooring records, or drifter trajectories of the upper-slope flow. Hence, the importance of the subsurface poleward flow in the CanCEBS has been only hypothesized. Moreover, due to the large differences between the shape of the coastline and topography between the California and the Canary Current system, the results obtained for the CalCEBS are not completely applicable to the CanCEBS. In this study we report the first direct observations of the continuity of the deep poleward flow of the Canary Deep Poleward undercurrent (CdPU) in the North-Africa sector of the CanCEBS, and one of the few direct observations in the North-Africa sector of the Canary Current eastern boundary. The results indicate that the Canary Island archipelago disrupts the deep poleward undercurrent even at depths where the flow is not blocked by the bathymetry. The deep poleward undercurrent flows west around the eastern-most islands and north east of the Conception Bank to rejoin the intermittent branch that follows the African slope in the Lanzarote Passage. This hypothesis is consistent with the AAIW found west of Lanzarote, as far as 17 W. But also, this hypothesis would be coherent
Henneguya sp. (Cnidospora:Myxosporida) parasitic in the heart of the bluefish, Pomatomus saltatrix.
Meyers, T R; Sawyer, T K; MacLean, S A
1977-10-01
A myxosporidan parasite, Henneguya sp., was discovered in the bulbus and truncus arteriosus of bluefish, Pomatomus saltatrix. Infected fish were captured from the Atlantic Ocean near Montauk Point, Long Island, New York, Raritan Bay, New Jersey, and Chesapeake Bay, Maryland. Comparative features of mature spores showed that they were similar to those of Henneguya sebasta Moser and Love 1975, from the bulbus arteriosus of seven species of California rockfish, Sebastes. Studies on growth stages of the parasite from both host species are necessary before a definite identification of the bluefish parasite can be made.
77 FR 5473 - Pacific Halibut Fisheries; Catch Sharing Plan
2012-02-03
... regulations in one Federal Register notice. Section 300.63(b)(1) of the current regulations provides that NMFS... primary directed sablefish fishery north of Point Chehalis, WA, in 2012 under the current preliminary IPHC... of the ESA because of the listing of yelloweye, canary, and bocaccio rockfish of the Puget Sound...
50 CFR 660.150 - Mothership (MS) Coop Program.
2010-10-01
... follows: (i) Species with formal allocations to the MS Coop Program are Pacific whiting, canary rockfish... issuance for MS permit—(i) Eligibility criteria for MS permit. Only the current owner of a vessel that... mail the application by certified mail to the current address of record in the NMFS permit database...
Canary: an atomic pipeline for clinical amplicon assays.
Doig, Kenneth D; Ellul, Jason; Fellowes, Andrew; Thompson, Ella R; Ryland, Georgina; Blombery, Piers; Papenfuss, Anthony T; Fox, Stephen B
2017-12-15
High throughput sequencing requires bioinformatics pipelines to process large volumes of data into meaningful variants that can be translated into a clinical report. These pipelines often suffer from a number of shortcomings: they lack robustness and have many components written in multiple languages, each with a variety of resource requirements. Pipeline components must be linked together with a workflow system to achieve the processing of FASTQ files through to a VCF file of variants. Crafting these pipelines requires considerable bioinformatics and IT skills beyond the reach of many clinical laboratories. Here we present Canary, a single program that can be run on a laptop, which takes FASTQ files from amplicon assays through to an annotated VCF file ready for clinical analysis. Canary can be installed and run with a single command using Docker containerization or run as a single JAR file on a wide range of platforms. Although it is a single utility, Canary performs all the functions present in more complex and unwieldy pipelines. All variants identified by Canary are 3' shifted and represented in their most parsimonious form to provide a consistent nomenclature, irrespective of sequencing variation. Further, proximate in-phase variants are represented as a single HGVS 'delins' variant. This allows for correct nomenclature and consequences to be ascribed to complex multi-nucleotide polymorphisms (MNPs), which are otherwise difficult to represent and interpret. Variants can also be annotated with hundreds of attributes sourced from MyVariant.info to give up to date details on pathogenicity, population statistics and in-silico predictors. Canary has been used at the Peter MacCallum Cancer Centre in Melbourne for the last 2 years for the processing of clinical sequencing data. By encapsulating clinical features in a single, easily installed executable, Canary makes sequencing more accessible to all pathology laboratories. Canary is available for download as source
von Biela, Vanessa R.; Kruse, Gordon H.; Mueter, Franz J.; Black, Bryan A.; Douglas, David C.; Helser, Thomas E.; Zimmerman, Christian E.
2015-01-01
Fish otolith growth increments were used as indices of annual production at nine nearshore sites within the Alaska Coastal Current (downwelling region) and California Current (upwelling region) systems (~36–60°N). Black rockfish (Sebastes melanops) and kelp greenling (Hexagrammos decagrammus) were identified as useful indicators in pelagic and benthic nearshore food webs, respectively. To examine the support for bottom-up limitations, common oceanographic indices of production [sea surface temperature (SST), upwelling, and chlorophyll-a concentration] during summer (April–September) were compared to spatial and temporal differences in fish growth using linear mixed models. The relationship between pelagic black rockfish growth and SST was positive in the cooler Alaska Coastal Current and negative in the warmer California Current. These contrasting growth responses to SST among current systems are consistent with the optimal stability window hypothesis in which pelagic production is maximized at intermediate levels of water column stability. Increased growth rates of black rockfish were associated with higher chlorophyll concentrations in the California Current only, but black rockfish growth was unrelated to the upwelling index in either current system. Benthic kelp greenling growth rates were positively associated with warmer temperatures and relaxation of downwelling (upwelling index near zero) in the Alaska Coastal Current, while none of the oceanographic indices were related to their growth in the California Current. Overall, our results are consistent with bottom-up forcing of nearshore marine ecosystems—light and nutrients constrain primary production in pelagic food webs, and temperature constrains benthic food webs.
Nutrition and energetics of the canary (Serinus canarius).
Harper, E J; Turner, C L
2000-07-01
Canaries appear to be primarily seed-eaters, although there are no reports of their feeding ecology in the wild. In captivity, they are offered seed-based diets, preferring to consume seeds such as canary, rapeseed and millet. The mean daily dry-matter intake ranges from 3 to 4 g, which corresponds to a mean gross energy intake of approximately 70 kJ per bird per day. The efficiency of dietary metabolism is high (0.85), which equates to individual metabolizable energy intakes of 45-75 kJ per bird per day. For a canary of average body weight (22 g) the data can be fitted to a regression equation to predict a requirement of 62 kJ ME per day. This corresponds to published information on the energy requirements of other passerine species, but deviates from the predictive equation for poultry. The digestibility values for protein, fat and carbohydrate are similar to those obtained for the budgerigar, although it is likely that the digestibility coefficient is dependent upon the seed type and alimentary tract lipase and amylase activities. Nutrient requirements of canary chicks have not yet been determined, although recent studies have provided data on the nutrient intakes of developing chicks. The newly-hatched canary chick has a rapid growth rate, achieving 90% of its asymptotic body mass by 11 days of age. Gross energy intake is approximately 3 kJ per day following hatching and by day 10 is equivalent to that of an adult canary. It appears that the protein intake should lie between 16.5 and 21.9% of the diet (as is), with peak intake occurring between 8 and 10 days of age.
Temporal variability of mass transport across Canary Islands Channels
Marrero-Díaz, Ángeles; Rodríguez-Santana, Ángel; José Machín, Francisco; García-Weil, Luis; Sangrà, Pablo; Vélez-Belchí, Pedro; Fraile-Nuez, Eugenio
2014-05-01
The equatorward flowing Canary Current (CC) is the main feature of the circulation in the Canary Islands region. The CC flow perturbation by the Canary Islands originate the Canary Eddy Corridor which is the major pathway for long lived eddies in the subtropical North Atlantic (Sangrà et al., 2009, DSR). Therefore the variability of the CC passing through the Canary Archipelago will have both local and regional importance. Past studies on the CC variability trough the Canary Islands point out a clearly seasonal variability (Fraile-Nuez et al, 2010 (JGR); Hernández-Guerra et al, 2002 (DSR)). However those studies where focused on the eastern islands channels missing the variability through the western island channels which are the main source of long lived eddies. In order to fill this gap from November 2012 until September 2013 we conducted trimonthly surveys crossing the whole islands channels using opportunity ships (Naviera Armas Ferries). XBT and XCTD where launched along the cross channels transects. Additionally a closed box circling the Archipelago was performed on October 2013 as part of the cruise RAPROCAN-2013 (IEO) using also XBT and XCTD. Dynamical variables where derived inferring salinity from S(T,p) analytical relationships for the region updated with new XCTD data. High resolution, vertical sections of temperature, potential density, geostrophic velocity and transport where obtained. Our preliminary results suggest that the CC suffer a noticeable acceleration in those islands channels where eddy shedding is more frequent. They also indicate a clearly seasonal variability of the flows passing the islands channels. With this regard we observed significant differences on the obtained seasonal variability with respect the cited past studies on the eastern islands channel (Lanzarote / Fuerteventura - Africa coast). This work was co-funded by Canary Government (TRAMIC project: PROID20100092) and the European Union (FEDER).
Ratite eggshells from lanzarote, canary islands.
Franz Sauer, E G; Rothe, P
1972-04-07
Struthious and aepyornithoid eggshells from Tertiary calcareous sediments on Lanzarote prove the presence, until about 12 million years ago, of large flightless birds. The calcarenite horizon is recognized as an old land surface. Mesozoic sedimentary rocks in the basement of the volcanic islands of Lanzarote and neighboring Fuerteventura indicate that at least part of the Canary Archipelago is underlain by continental crust. Separation of the eastern Canaries from Africa raight have been by rifting, and a land connection might still have existed in the lower Pliocene.
Dietary intake of aluminum in a Spanish population (Canary Islands).
González-Weller, Dailos; Gutiérrez, Angel José; Rubio, Carmen; Revert, Consuelo; Hardisson, Arturo
2010-10-13
The aim of this study was to analyze the aluminum content in foods and beverages most commonly consumed by the Canary Island population to determine the dietary intake of this metal throughout the Canary Islands as a whole and in each of the seven islands (Gran Canaria, Lanzarote, Fuerteventura, Tenerife, La Palma, La Gomera, and El Hierro). Four hundred and forty samples were analyzed by ICP-OES. Estimated total intake of aluminum for the Canary population was 10.171 mg/day, slightly higher than the provisional tolerable weekly intake (PTWI; 10 mg/day for a person weighing 70 kg). Aluminum intake by age and sex of the Canary Island population was also determined and compared values from other populations, both national and international.
Fractionation of hairless canary seed (Phalaris canariensis) into starch, protein, and oil.
Abdel-Aal, El-Sayed M; Hucl, Pierre; Patterson, Carol Ann; Gray, Danielle
2010-06-09
Canary seed is an important specialty crop in Canada. The current market for this true cereal (i.e., belonging to the family Poaceae as wheat) is limited to feed for caged birds. However, canary seed holds a promise for many food and industrial applications based on its composition. Three wet milling procedures based on ethanol (E), water (W), and alkaline (A) extractions used in different order were investigated to determine extraction efficiency and purity of starch, protein, oil, and fiber separated from hairless canary seed, a variety developed for human consumption. Highest extraction efficiencies were obtained when canary seed was defatted with ethanol and then extracted with alkali and water (EAW process). Using this process, approximately 92% pure starch, 75% pure protein, and oil were recovered from canary seed groats. The highest purity of protein, however, was obtained when canary seed was fractionated by the EWA process, that is, defatted and then extracted with water followed by alkali. Fiber component separated prior to alkaline extraction contained high amounts of nonfiber components as indicated by its yield. The EAW extraction process seems to be more promising in canary seed fractionation based on recovery and purity of components.
1992-01-01
This easterly looking view shows the seven major volcanic islands of the Canary Island chain (28.0N, 16.5W) and offers a unique view of the islands that have become a frequent vacation spot for Europeans. The northwest coastline of Africa, (Morocco and Western Sahara), is visible in the background. Frequently, these islands create an impact on local weather (cloud formations) and ocean currents (island wakes) as seen in this photo.
Estrada-Salas, Patricia A; Montero-Morán, Gabriela M; Martínez-Cuevas, Pedro P; González, Carmen; Barba de la Rosa, Ana P
2014-01-15
Canary grass is used as traditional food for diabetes and hypertension treatment. The aim of this work is to characterize the biological activity of encrypted peptides released after gastrointestinal digestion of canary seed proteins. Canary peptides showed 43.5% inhibition of dipeptidyl peptidase IV (DPPIV) and 73.5% inhibition of angiotensin-converting enzyme (ACE) activity. An isolated perfused rat heart system was used to evaluate the canary seed vasoactive effect. Nitric oxide (NO), a major vasodilator agent, was evaluated in the venous effluent from isolated perfused rat heart. Canary seed peptides (1 μg/mL) were able to induce the production of NO (12.24 μM) in amounts similar to those induced by captopril (CPT) and bradykinin (BK). These results show that encrypted peptides in canary seed have inhibitory activity against DPPIV and ACE, enzymes that are targets for diabetes and hypertension treatments.
Dust Storm Hits Canary Islands
2002-01-01
A thick pall of sand and dust blew out from the Sahara Desert over the Atlantic Ocean yesterday (January 6, 2002), engulfing the Canary Islands in what has become one of the worst sand storms ever recorded there. In this scene, notice how the dust appears particularly thick in the downwind wake of Tenerife, the largest of the Canary Islands. Perhaps the turbulence generated by the air currents flowing past the island's volcanic peaks is churning the dust back up into the atmosphere, rather than allowing it to settle toward the surface. This true-color image was captured by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite, on January 7, 2002. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC
Safety assessment of consumption of glabrous canary seed (Phalaris canariensis L.) in rats.
Magnuson, B A; Patterson, C A; Hucl, P; Newkirk, R W; Ram, J I; Classen, H L
2014-01-01
Canary seed is a nutrient-rich cereal grain; however, it has not been used in human food in part due to concerns regarding safety of consumption. Glabrous or hairless canary seed has potential human food use as trichomes are absent. The objective of the oral feeding studies reported here was to assess the safety of yellow and brown glabrous canary seed cultivars as human cereal foods. The first study was a 90-day rat oral toxicity study, which compared the effects of diets containing 50% of either brown dehulled glabrous, brown hulled glabrous, or brown hulled pubescent (hairy) hulled canary seed to a diet containing 50% wheat. No significant adverse effects were observed. In a 28-day and a 90-day study rats were fed yellow or brown glabrous canary seed groats in the AIN-76 diet at concentrations levels of 2.5%, 5% and 10%. The NOAELs in 90-day study were 5.15 g/kg/d and 5.23 g/kg/d for yellow and brown canary seed groats. Consumption of canary seed was associated with reduced incidence and severity of liver lipidosis as compared to controls. The combined results of these studies clearly demonstrate the safety of consumption of glabrous canary seed, and support its use as a human cereal grain. Copyright © 2013 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Paulrud, Susanne; Davidsson, Kent; Holmgren, Magnus A. (Swedish National Testing and Research Inst., Boraas (Sweden)); Hedman, Henry; Oehman, Rikard; Leffler, Joel (ETC, Piteaa (Sweden))
2010-09-15
The aim of this study was to test fuel blends of briquettes and chopped reed canary grass in three existing heating plants (50 kW - 500 kW) and elucidate the requirements for good performance and low emissions. In addition, the study investigated production of reed canary grass briquettes using a Polish screw press developed for straw. Some tests with a bale shredder were also undertaken. The screw press technique is of interest for reed canary grass because it is a simple technique, easy to handle, developed for small scale production, and for straw. The test with reed canary grass in this study showed that the technique worked well but that further adjustments and a longer test period are needed in order to achieve higher bulk density and mechanical strength. The test with chopped reed canary grass shows that a system with a forage harvester is slightly more effective than baling and cutting in a bale shredder. The study concluded that few existing heating plants of size 50 kW-1 MW that currently use wood fuels will be able to use reed canary grass without adjustment, conversion or replacement of the combustion equipment. Reed canary grass has 15-20 times higher ash content than wood briquettes and 2-3 times higher ash content than forest residue; the combustion equipment must be able to handle these properties. The boiler must be equipped with a continuously operating ashing system and it must be possible to move the ash bed mechanically. There is a risk of high content of unburned matter if the residence time in the boiler is too short, due to the structure and low bulk density of the reed canary grass ash. Using a blend of wood briquettes and reed canary briquettes results in lower ash content, but also affects the ash chemistry and tends to lower the initial ash fusion temperature compared to using 100 % reed canary grass. Blending chopped reed canary grass and wood chips in an existing small scale heating plant also requires measures to achieve an even fuel
2011-08-30
... Flatfish, Sharks, and Skates in the Bering Sea and Aleutian Islands Management Area AGENCY: National Marine...-specified reserve to the initial total allowable catch of other rockfish, other flatfish, sharks, and skates..., BSAI other flatfish, BSAI sharks, and BSAI skates was established as 425 metric tons (mt), 2,550 mt, 43...
On freshwater Ostracoda (Crustacea) collected on the Canary Islands
Meisch, Claude; Broodbakker, Nico W.
1990-01-01
Les auteurs ont examiné une collection de 38 échantillons d’Ostracodes d’eau douce récoltés par le Prof. J. H. Stock sur les Iles Canaries de 1985 à 1987. Seules quelques espèces ont été trouvées. Cypridopsis lanzarotensis fut décrite par Mallwitz (1984) de l’île de Lanzarote (îles Canaries); c’est
Reza, Kheirandish; Nasrin, Askari; Mahmoud, Salehi
2013-03-01
To investigate clinical, pathological and mycological findings in canaries, in which pox lesions and Aspergillus fumigatus (A. fumigatus) infection were observed simultaneously. This study was performed on a breeding colony (about 100 canaries) affected by fatal wasting disease. Necropsy was undertaken on 10 severely affected canaries, and gross lesions were recorded. Samples from internal organs displaying lesions were obtained for histopathological evaluation. Tracheal swap samples of internal organs of the all infected animals with lesions at necropsy were cultured in Sabouraud Dextrose Agar for mycological examination. At necropsy, caseous foci were determined in the lungs, on the air sacs, liver, spleen, heart. Swelling of the eyelids, diffuse hemorrhages in the subcutaneous tissue with small papular lesions of the skin were other typical necropsy findings. Histopathologically, pathognomonic eosinophilic intracytoplasmic inclusion bodies, which called Bollinger bodies, in both skin cells and vacuolated air way epithelial cells confirmed canary pox infection. Moreover, histopathological examination of the white-yellowish caseous foci revealed necrotic granulomatous reaction consisting of macrophages, heterophil leukocytes and giant cells encapsulated with a fibrous tissue. After the culture of the tissue samples, the formation of bluish green colonies confirmed A. fumigatus infection. Canary pox has been known as the disease that can result in high losses in a short time, as a re-emerging disease that has not been present during recent years in canary flocks in Iran. So, the current paper provides useful information to prevent misdiagnosed of canary pox disease which can cause secondary mycotic infection.
Directory of Open Access Journals (Sweden)
Alejandro Frid
Full Text Available As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus, younger lingcod, copper rockfish (Sebastes caurinus and quillback rockfish (S. maliger. Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps. We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery
Frid, Alejandro; Marliave, Jeff; Heithaus, Michael R
2012-01-01
As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus) are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus), younger lingcod, copper rockfish (Sebastes caurinus) and quillback rockfish (S. maliger). Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps). We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery removal of top
Incidence of Ichthyophonus hoferi in Puget Sound fishes and its increase with age of Pacific herring
Hershberger, P.K.; Stick, K.; Bui, B.; Carroll, C.; Fall, B.; Mork, C.; Perry, J.A.; Sweeney, E.; Wittouck, J.; Winton, J.; Kocan, R.
2002-01-01
A recent decrease in the mean age of adult Pacific herring Clupea pallasi in Puget Sound was associated with a high prevalence of Ichthyophonus hoferi, a protistan parasite that can be highly pathogenic to Pacific herring. In Puget Sound, high intensities of I. hoferiinfection may be maintained in older cohorts of Pacific herring because the prevalence ofI. hoferi increased with age from 12% among juveniles to 58% among the oldest, age-6 and older cohorts. Low intensities of I. hoferi infection in the region may be maintained in alternative fish hosts, such as surf smelt Hypomesus pretiosus, Puget Sound rockfishSebastes emphaeus, Pacific tomcod Microgadus proximus, and speckled sanddabCithanichthys stigmaeus.
Stock, Jan H.
1988-01-01
Pseudoniphargus was known from inland stygohabitats in the Iberian peninsula, the Azores, Madeira, N.W. Africa, and Bermuda, but not from the Canary Islands. Systematic sampling in six of the seven larger islands of the latter archipelago has revealed the presence of the genus in Tenerife (4
Interannual variability of mass transport in the Canary region from LADCP data
Comas-Rodríguez, Isis; Hernández-Guerra, Alonso; Vélez-Belchí, Pedro; Fraile-Nuez, Eugenio
2010-05-01
The variability of the Canary Current is a widely studied topic regarding its role as eastern boundary of the North Atlantic Subtropical Gyre. The Canary region provides indeed an interesting study area in terms of estimating variability scales of the Subtropical Gyre as well as the water masses dynamics. RAPROCAN (RAdial PROfunda de CANarias - Canary deep hydrographic section) is a project based on the reaching of these goals through the obtaining of hydrographic measures during cruises taking place approximately along 29°N, to the North of the Canary Archipelago, twice a year since 2006. The full depth sampling carried out allows the study of temperature and salinity distribution and the calculation of mass transports across the section. The transport estimates are compared to those obtained from previous measurements and estimates in the region. Therefore, transports and their variability through the last decade are quantified. The most significant advance made to previous works is the use of LADCP (Lowered Acoustic Doppler Current Profiler) data informing the initial geostrophic calculations. Thus, corrections are applied to each geostrophic profile considering the reference velocity obtained from LADCP data. ADCP-referenced transport estimates are obtained, providing a successful comparison between the velocity fields obtained from the hydrographic measures. While this work shows the interannual variability observed in winter since 1997, preliminary results confirm previous hypotheses about the magnitude of the Canary Current. Those results including LADCP data also provide new aspects in the circulation distribution across the Canary Archipelago. Also moored current meter data were taken into account in the up close study of the Current through the Lanzarote Passage. Interesting conclusions were drawn that certify the usefulness of LADCP data in referencing geostrophic calculations, while corroborating the results obtained through this methodology. Hence
Construct exploit constraint in crash analysis by bypassing canary
Huang, Ning; Huang, Shuguang; Huang, Hui; Chang, Chao
2017-08-01
Selective symbolic execution is a common program testing technology. Developed on the basis of it, some crash analysis systems are often used to test the fragility of the program by constructing exploit constraints, such as CRAX. From the study of crash analysis based on symbolic execution, this paper find that this technology cannot bypass the canary stack protection mechanisms. This paper makes the improvement uses the API hook in Linux. Experimental results show that the use of API hook can effectively solve the problem that crash analysis cannot bypass the canary protection.
Recirculation of the Canary Current in fall 2014
Hernández-Guerra, Alonso; Espino-Falcón, Elisabet; Vélez-Belchí, Pedro; Dolores Pérez-Hernández, M.; Martínez-Marrero, Antonio; Cana, Luis
2017-10-01
Hydrographic measurements together with Ship mounted Acoustic Doppler Current Profilers and Lowered Acoustic Doppler Current Profilers (LADCP) obtained in October 2014 are used to describe water masses, geostrophic circulation and mass transport of the Canary Current System, as the Eastern Boundary of the North Atlantic Subtropical Gyre. Geostrophic velocities are adjusted to velocities from LADCP data to estimate an initial velocity at the reference layer. The adjustment results in a northward circulation at the thermocline layers over the African slope from an initial convergent flow. Final reference velocities and consequently absolute circulation are estimated from an inverse box model applied to an ocean divided into 13 neutral density layers. This allows us to evaluate mass fluxes consistent with the thermal wind equation and mass conservation. Ekman transport is estimated from the wind data derived from the Weather Research and Forecasting model. Ekman transport is added to the first layer and adjusted with the inverse model. The Canary Current located west of Lanzarote Island transports to the south a mass of - 1.5 ± 0.7 Sv (1 Sv = 106 m3 s- 1 ≈ 109 kg s- 1) of North Atlantic Central Water at the surface and thermocline layers ( 0-700 m). In fall 2014, hydrographic data shows that the Canary Current in the thermocline (below at about 80 m depth to 700 m) recirculates to the north over the African slope and flows through the Lanzarote Passage. At intermediate layers ( 700-1400 m), the Intermediate Poleward Undercurrent transports northward a relatively fresh Antarctic Intermediate Water in the range of 0.8 ± 0.4 Sv through the Lanzarote Passage and west of Lanzarote Island beneath the recirculation of the Canary Current.
Science of active galactic nuclei with the GTC and CanariCam
Levenson, Nancy A.; Packham, Christopher C.; Alonso-Herrero, Almudena; Aretxaga, Itziar; Colina, Luis; Díaz-Santos, Tanio; Elitzur, Moshe; Mason, Rachel E.; Perlman, Eric S.; Radomski, James T.; Roche, Patrick F.; Rodríguez Espinosa, José Miguel; Young, Stuart; Telesco, Charles M.
2008-07-01
CanariCam is the facility mid-infrared (MIR) instrument for the Gran Telescopio Canarias (GTC), a 10.4m telescope at the Observatorio del Roque de los Muchachos on La Palma. One of the science drivers for CanariCam is the study of active galactic nuclei (AGN). We will exploit the instrument's high sensitivity in imaging, spectroscopy, and polarimetry modes to answer fundamental questions of AGN and their host galaxies. Dust in the nucleus of an active galaxy reprocesses the intrinsic radiation of the central engine to emerge in the MIR. Current work demonstrates that the hot dust immediately associated with the AGN, which blocks direct views of the AGN from some lines of sight, is confined to small (parsec) scales. Thus, high spatial resolution is essential to probe the "torus" of unified AGN models separate from the host galaxy. CanariCam provides a 0.08" pixel scale for Nyquist sampling the diffraction-limited point spread function at 8μm, and narrow (0.2") spectroscopy slits (with R=120-1300). New observations with the GTC/CanariCam will provide key constraints on the physical conditions in the clumpy torus, and we will sensitively determine AGN obscuration as a function of nuclear activity. We will therefore address the fueling process and its relationship to the torus, the interaction with the host galaxy, and dust chemistry. These data will be essential preparation for the next generation of telescopes that will observe the distant universe directly to explore galaxy and black hole formation and evolution, and the GTC/CanariCam system uniquely provides multiple modes to probe AGN.
Non-native vascular plants from Canary Islands (Spain): nomenclatural and taxonomical adjustments
Verloove, F.
2013-01-01
Se propone correcciones taxonómicas y nomenclaturales respecto a 88 taxones no nativos de la lista de plantas vasculares de las Islas Canarias (España). Non-native vascular plants from Canary Islands (Spain): nomenclatural and taxonomical adjustments. Corrections and other adjustments are proposed for 88 non-native taxa from the checklist of vascular plants from the Canary Islands (Spain).
Long term volcanic hazard analysis in the Canary Islands
Becerril, L.; Galindo, I.; Laín, L.; Llorente, M.; Mancebo, M. J.
2009-04-01
Historic volcanism in Spain is restricted to the Canary Islands, a volcanic archipelago formed by seven volcanic islands. Several historic eruptions have been registered in the last five hundred years. However, and despite the huge amount of citizens and tourist in the archipelago, only a few volcanic hazard studies have been carried out. These studies are mainly focused in the developing of hazard maps in Lanzarote and Tenerife islands, especially for land use planning. The main handicap for these studies in the Canary Islands is the lack of well reported historical eruptions, but also the lack of data such as geochronological, geochemical or structural. In recent years, the use of Geographical Information Systems (GIS) and the improvement in the volcanic processes modelling has provided an important tool for volcanic hazard assessment. Although this sophisticated programs are really useful they need to be fed by a huge amount of data that sometimes, such in the case of the Canary Islands, are not available. For this reason, the Spanish Geological Survey (IGME) is developing a complete geo-referenced database for long term volcanic analysis in the Canary Islands. The Canarian Volcanic Hazard Database (HADA) is based on a GIS helping to organize and manage volcanic information efficiently. HADA includes the following groups of information: (1) 1:25.000 scale geologic maps, (2) 1:25.000 topographic maps, (3) geochronologic data, (4) geochemical data, (5) structural information, (6) climatic data. Data must pass a quality control before they are included in the database. New data are easily integrated in the database. With the HADA database the IGME has started a systematic organization of the existing data. In the near future, the IGME will generate new information to be included in HADA, such as volcanological maps of the islands, structural information, geochronological data and other information to assess long term volcanic hazard analysis. HADA will permit
The water landscapes of the Canary Islands
DEFF Research Database (Denmark)
Lee, Gini; Braae, Ellen Marie; Diedrich, Lisa
2013-01-01
Island environments, particularly small archipelagos such as the Canary Islands, are more visible subject to the vagaries of change wrought by ecological and climate dynamics, shifting social conditions and economic impacts subject to global markets, than is witnessed on continental worlds....
Late Pliocene and Quaternary Eurasian locust infestations in the Canary Archipelago
Meco, J.; Muhs, D.R.; Fontugne, M.; Ramos, A.J.; Lomoschitz, A.; Patterson, D.
2011-01-01
The Canary Archipelago has long been a sensitive location to record climate changes of the past. Interbedded with its basalt lavas are marine deposits from the principal Pleistocene interglacials, as well as aeolian sands with intercalated palaeosols. The palaeosols contain African dust and innumerable relict egg pods of a temperate-region locust (cf. Dociostaurus maroccanusThunberg 1815). New ecological and stratigraphical information reveals the geological history of locust plagues (or infestations) and their palaeoclimatic significance. Here, we show that the first arrival of the plagues to the Canary Islands from Africa took place near the end of the Pliocene, ca. 3Ma, and reappeared with immense strength during the middle Late Pleistocene preceding MIS (marine isotope stage) 11 (ca. 420ka), MIS 5.5 (ca. 125ka) and probably during other warm interglacials of the late Middle Pleistocene and the Late Pleistocene. During the Early Holocene, locust plagues may have coincided with a brief cool period in the current interglacial. Climatically, locust plagues on the Canaries are a link in the chain of full-glacial arid-cold climate (calcareous dunes), early interglacial arid-sub-humid climate (African dust inputs and locust plagues), peak interglacial warm-humid climate (marine deposits with Senegalese fauna), transitional arid-temperate climate (pedogenic calcretes), and again full-glacial arid-cold climate (calcareous dunes) oscillations. During the principal interglacials of the Pleistocene, the Canary Islands recorded the migrations of warm Senegalese marine faunas to the north, crossing latitudes in the Euro-African Atlantic. However, this northward marine faunal migration was preceded in the terrestrial realm by interglacial infestations of locusts. ??? Locust plagues, Canary Islands, Late Pliocene, Pleistocene, Holocene, palaeoclimatology. ?? 2010 The Authors, Lethaia ?? 2010 The Lethaia Foundation.
Imaging Canary Island hotspot material beneath the lithosphere of Morocco and southern Spain
Miller, Meghan S.; O'Driscoll, Leland J.; Butcher, Amber J.; Thomas, Christine
2015-12-01
The westernmost Mediterranean has developed into its present day tectonic configuration as a result of complex interactions between late stage subduction of the Neo-Tethys Ocean, continental collision of Africa and Eurasia, and the Canary Island mantle plume. This study utilizes S receiver functions (SRFs) from over 360 broadband seismic stations to seismically image the lithosphere and uppermost mantle from southern Spain through Morocco and the Canary Islands. The lithospheric thickness ranges from ∼65 km beneath the Atlas Mountains and the active volcanic islands to over ∼210 km beneath the cratonic lithosphere in southern Morocco. The common conversion point (CCP) volume of the SRFs indicates that thinned lithosphere extends from beneath the Canary Islands offshore southwestern Morocco, to beneath the continental lithosphere of the Atlas Mountains, and then thickens abruptly at the West African craton. Beneath thin lithosphere between the Canary hot spot and southern Spain, including below the Atlas Mountains and the Alboran Sea, there are distinct pockets of low velocity material, as inferred from high amplitude positive, sub-lithospheric conversions in the SRFs. These regions of low seismic velocity at the base of the lithosphere extend beneath the areas of Pliocene-Quaternary magmatism, which has been linked to a Canary hotspot source via geochemical signatures. However, we find that this volume of low velocity material is discontinuous along strike and occurs only in areas of recent volcanism and where asthenospheric mantle flow is identified with shear wave splitting analyses. We propose that the low velocity structure beneath the lithosphere is material flowing sub-horizontally northeastwards beneath Morocco from the tilted Canary Island plume, and the small, localized volcanoes are the result of small-scale upwellings from this material.
Kirsch, Eileen M.; Gray, Brian R.
2017-01-01
Floodplain forest of the Upper Mississippi River provides habitat for an abundant and diverse breeding bird community. However, reed canary grass Phalaris arundinacea invasion is a serious threat to the future condition of this forest. Reed canary grass is a well-known aggressive invader of wetland systems in the northern tier states of the conterminous United States. Aided by altered flow regimes and nutrient inputs from agriculture, reed canary grass has formed dense stands in canopy gaps and forest edges, retarding tree regeneration. We sampled vegetation and breeding birds in Upper Mississippi River floodplain forest edge and interior areas to 1) measure reed canary grass cover and 2) evaluate whether the breeding bird assemblage responded to differences in reed canary grass cover. Reed canary grass was found far into forest interiors, and its cover was similar between interior and edge sites. Bird assemblages differed between areas with more or less reed canary grass cover (.53% cover breakpoint). Common yellowthroat Geothlypis trichas, black-capped chickadee Parus atricapillus, and rose-breasted grosbeak Pheucticus ludovicianus were more common and American redstart Setophaga ruticilla, great crested flycatcher Myiarchus crinitus, and Baltimore oriole Icterus galbula were less common in sites with more reed canary grass cover. Bird diversity and abundance were similar between sites with different reed canary grass cover. A stronger divergence in bird assemblages was associated with ground cover ,15%, resulting from prolonged spring flooding. These sites hosted more prothonotary warbler Protonotaria citrea, but they had reduced bird abundance and diversity compared to other sites. Our results indicate that frequently flooded sites may be important for prothonotary warblers and that bird assemblages shift in response to reed canary grass invasion.
Surface currents in the Canary Basin from drifter observations
Zhou, Meng; Paduan, Jeffrey D.; Niiler, Pearn P.
2000-09-01
Satellite-tracked drifting buoys, deployed in the Canary Basin as part of the Subduction Experiment between July 1991 and October 1993 and the French Semaphore Experiment during October 1993, were used to obtain a description of surface currents and temperature in the Canary Basin. The study focuses on surface water convergence, eddy energy production, and heat transport. The Azores Current associated with the subtropical convergence zone is clearly visible at 34°N, and bifurcates around 22°W, with the major branch of the current circling the Madeira plateau and joining the Canary Current along the continental slope. Eddy kinetic energy maxima are found along the Azores Current. The mean current revealed a region of maximum convergence north of the Azores Current around longitude 29°W occurring with a negative heating anomaly and positive work done by the Reynolds stress. The southward meridional temperature fluxes in the Ekman layer (0-50 m) between 37°W and the African and European coast are estimated between -0.076±0.022×l015 W, produced by mean southward volume transport in our study area. The residual between local surface heat fluxes and horizontal convergence of heat implies a vertical heat convergence process associated with mesoscale temperature and flow fields.
Newkirk, R W; Ram, J I; Hucl, P; Patterson, C A; Classen, H L
2011-12-01
A nutrient retention study and a growth study were conducted with broiler chickens to evaluate the nutritive value and potential toxicity of 2 hairless canary seed products-hulled seed and groats (cultivar CDC Maria), and one hairy hulled canary seed (cultivar Keet). Each treatment was replicated 6 times (6 groups of 4 birds each). The hairless canary seed groat, hairless hulled canary seed, and the hairy hulled canary seed contained 24.5, 21.8, and 16.3% CP; 7.1, 5.8, and 6.6% ether extract; 1.5, 14.2, and 12.3% acid detergent fiber, and 3,867, 3,205 and 3,292 kcal/kg of AME(n), on a DM basis, respectively. The hairless canary seed groat, hairless hulled canary seed, and the hairy hulled canary seed protein comprised, respectively, 0.49, 0.33, and 0.33% lysine (DM basis), which was 79, 78, and 67% digestible (apparent ileal); 0.65, 0.53, and 0.60% cysteine (DM basis), which was 86, 87, and 85% apparent ileal digestible; and 0.40, 0.30, and 0.25% methionine (DM basis), which was 89, 90, and 86% apparent ileal digestible. In the second study, a 35-d feeding study with male broiler chickens was conducted. The canary seed products were compared with a Canadian Western Red Spring wheat control. Each treatment was replicated 6 times (6 groups of 4 birds each). The test ingredients comprised 50% of the corn/soybean diets. The birds fed the hulled canary seed (hairy or hairless) had similar weight gain, feed intake, and G:F to those fed wheat. There were no statistically significant (P = 0.05) differences in the weights of the bursa, heart, kidneys, liver, spleen, or the pancreas, nor was there any effect on serum lactate dehydrogenase or creatine kinase. The data indicated that feeding hulled canary seed increased the number of gizzard ulcers (P < 0.01). It was concluded that canary seed does not contain anti-nutritional components that negatively affect broiler performance or bird health. However, the canary seed hulls may damage the gizzard lining.
Pasteau, Magali; Ung, Davy; Kreutzer, Michel; Aubin, Thierry
2012-07-01
Song discrimination and recognition in songbird species have usually been studied by measuring responses to song playbacks. In female canaries, Serinus canaria, copulation solicitation displays (CSDs) are used as an index of female preferences, which are related to song recognition. Despite the fact that many studies underline the role of song syntax in this species, we observed that short segments of songs (a few seconds long) are enough for females to discriminate between conspecific and heterospecific songs, whereas such a short duration is not sufficient to identify the syntax rules. This suggests that other cues are salient for song recognition. In this experiment, we investigated the influence of amplitude modulation (AM) on the responses (CSDs) of female canaries to song playbacks. We used two groups of females: (1) raised in acoustic isolation and (2) raised in normal conditions. When adult, we tested their preferences for sexy phrases with different AMs. We broadcast three types of stimuli: (1) songs with natural canary AM, (2) songs with AM removed, or (3) song with wren Troglodytes troglodytes AM. Results indicate that female canaries prefer and have predispositions for a song type with the natural canary AM. Thus, this acoustic parameter is a salient cue for song attractiveness.
Hofmeister, Erik K; Lund, Melissa; Shearn Bochsler, Valerie
2018-01-01
This study investigated the susceptibility of American singer canaries ( Serinus canaria) to West Nile virus (WNV) infection. Adult canaries were inoculated with 10 5 , 10 2 , and 10 1 plaque forming units (PFU) of WNV. All birds became infected and mortality occurred by 5 days postinoculation. The load of viral RNA as determined by RT-qPCR was dose dependent, and was higher at all doses than the level of viral RNA detected in American crows ( Corvus brachyrhynchos) challenged with 10 5 PFU of WNV. In a subset of birds, viremia was detected by virus isolation; canaries inoculated with 10 1 PFU of WNV developed viremia exceeding 10 10 PFU/mL serum, a log higher than American crows inoculated with 10 5 PFU of virus. In canaries euthanized at 3 days postinoculation, WNV was isolated at >10 7 PFU of virus/100 mg of lung, liver, heart, spleen, and kidney tissues. Pallor of the liver and splenomegaly were the most common macroscopic observations and histologic lesions were most severe in liver, spleen, and kidney, particularly in canaries challenged with 10 2 and 10 1 PFU. Immunoreactivity to WNV was pronounced in the liver and spleen. IgG antibodies to WNV were detected in serum by enzyme immunoassay in 11 of 21 (52%) challenged canaries and, in 4 of 5 (20%) of these sera, neutralization antibodies were detected at a titer ≥ 1:20. American singer canaries provide a useful model as this bird species is highly susceptible to WNV infection.
Hofmeister, Erik K.; Lund, Melissa; Shearn-Bochsler, Valerie I.
2018-01-01
This study investigated the susceptibility of American singer canaries (Serinus canaria) to West Nile virus (WNV) infection. Adult canaries were inoculated with 105, 102, and 101plaque forming units (PFU) of WNV. All birds became infected and mortality occurred by 5 days postinoculation. The load of viral RNA as determined by RT-qPCR was dose dependent, and was higher at all doses than the level of viral RNA detected in American crows (Corvus brachyrhynchos) challenged with 105 PFU of WNV. In a subset of birds, viremia was detected by virus isolation; canaries inoculated with 101 PFU of WNV developed viremia exceeding 1010 PFU/mL serum, a log higher than American crows inoculated with 105 PFU of virus. In canaries euthanized at 3 days postinoculation, WNV was isolated at >107 PFU of virus/100 mg of lung, liver, heart, spleen, and kidney tissues. Pallor of the liver and splenomegaly were the most common macroscopic observations and histologic lesions were most severe in liver, spleen, and kidney, particularly in canaries challenged with 102 and 101 PFU. Immunoreactivity to WNV was pronounced in the liver and spleen. IgG antibodies to WNV were detected in serum by enzyme immunoassay in 11 of 21 (52%) challenged canaries and, in 4 of 5 (20%) of these sera, neutralization antibodies were detected at a titer ≥ 1:20. American singer canaries provide a useful model as this bird species is highly susceptible to WNV infection.
An Overview of Geodetic Volcano Research in the Canary Islands
Fernández, José; González, Pablo J.; Camacho, Antonio G.; Prieto, Juan F.; Brú, Guadalupe
2015-11-01
The Canary Islands are mostly characterized by diffuse and scattered volcanism affecting a large area, with only one active stratovolcano, the Teide-Pico Viejo complex (Tenerife). More than 2 million people live and work in the 7,447 km2 of the archipelago, resulting in an average population density three times greater than the rest of Spain. This fact, together with the growth of exposure during the past 40 years, increases volcanic risk with respect previous eruptions, as witnessed during the recent 2011-2012 El Hierro submarine eruption. Therefore, in addition to purely scientific reasons there are economic and population-security reasons for developing and maintaining an efficient volcano monitoring system. In this scenario geodetic monitoring represents an important part of the monitoring system. We describe volcano geodetic monitoring research carried out in the Canary Islands and the results obtained. We consider for each epoch the two main existing constraints: the level of volcanic activity in the archipelago, and the limitations of the techniques available at the time. Theoretical and observational aspects are considered, as well as the implications for operational volcano surveillance. Current challenges of and future perspectives in geodetic volcano monitoring in the Canaries are also presented.
The ichthyoplankton assemblage of the Canaries-African Coastal Transition Zone: A review
Rodriguez, J. M.; Moyano, M.; Hernandez-Leon, S.
2009-12-01
In this paper we review information on the ichthyoplankton assemblage of the Canaries-African Coastal Transition Zone (C-ACTZ). This CTZ shows the singularity that the Canary Archipelago interrupts the main flow of the Canary Current and Trade Winds, introducing large mesoscale variability, in the form of island warm wakes and cyclonic and anticyclonic eddies downstream of the islands. Besides, upwelling filaments stretch towards the archipelago from the African coastal upwelling, transporting phytoplankton, zooplankton and fish larvae. They also interact with eddies shed from the islands to exchange water properties and biogenic material. All these mesoscale features influence the composition, structure, abundance and distribution of the larval fish community (LFC) of the region. The Canary Current (CC) and eddies shed from the islands drag larvae of island neritic fish species into the oceanic region and contribute, along warm wakes, to the horizontal distribution of fish larvae. Upwelling and upwelling filaments transport larvae of African neritic species into the oceanic region. These larvae dominate the LFC and account for the relatively high average larval fish abundance found in the C-ACTZ during the summer upwelling season. Filaments originated in the region of Cape Juby-Cape Bojador are entrained around a quasi-permanent cyclonic eddy, trapped between Gran Canaria Island and the African coast, forming a system through which most of the African neritic larvae may return to the African shelf. However, some larvae reach the eastern islands of the Canary archipelago and they may be spread all over the neritic region of the archipelago by eddies shed from the islands. Also in summer, the distribution of the LFC of the C-ACTZ is vertically stratified and fish larvae seem to carry out little or not diel vertical migration. Overall, this study highlights the strong relationship between mesoscale oceanographic processes and the LFC in the C-ACTZ.
DynaGuard: Armoring Canary-Based Protections against Brute-Force Attacks
2015-12-11
format of the canary check or a function’s prologue and epilogue. Finally, due to the small number of canary-protected frames that (on average) are...sje ng 462 .lib qua ntu m 464 .h2 64r ef 471 .om net pp 473 .as tar 483 .xa lan cbm k Apa che Ng inx Pos tgre SQ L SQ Lite My SQ L Sl ow do w n (n...k 456 .hm me r 458 .sje ng 462 .lib qua ntu m 464 .h2 64r ef 471 .om net pp 473 .as tar 483 .xa lan cbm k Apa che Ng inx
The Caridean Crustacea of the Canary Islands
Holthuis, L.B.
1949-01-01
The present paper is based mainly on material collected at the Canary Islands during the spring of 1947 by Dr. G. Thorson of Universitetets Zoologiske Museum at Copenhagen and Dr. C. O. van Regteren Altena of the Rijksmuseum van Natuurlijke Historie at Leiden. Most of the specimens were collected by
2010-10-01
... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r Canary rockfish—A canary...
Wine tourism in the Canary Islands: An exploratory study
Directory of Open Access Journals (Sweden)
Duarte Alonso, Abel
2008-04-01
Full Text Available Wine tourism is experiencing significant development in both new and old European wine regions. In the case of the Canary Islands, wine has been produced and traded for centuries but little is known about the current state or potential for wine tourism on the islands, despite the fact that millions of tourists, including many potential wine tourists, visit the islands each year. In this exploratory study, the perspectives of winery owners and managers on wine tourism are examined via in-depth face-to-face interviews among 23 small winery operators to reveal that the scope for exploiting wine tourism on the islands has been recognized and that some wineries are either already involved in wine tourism, includ-ing as part of a wine trail, or plan to be more involved in the future. It was also discovered, that there were a number of issues that challenge the development of their wine and wine tourism industry, includ-ing competition from non-Canary Island wines and anti-drink-drive laws that are inhibit passers by to consume wine at the cellar door. Operators stressed the need to find a balance between mass tourism and the niche produce of wine. Moreover, the findings identify avenues for future research on wine tourism development in the Canary Islands.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Velazquez, A.
2008-07-01
This article is intended to analyse and point out the benefits that could be reached for the Canary Islands electrical systems in relation to wind technology adaptation (actual and future) to the voltage hollow, as required by the Canary Islands Government Directive 1541, dated November 15th 2006. This subject is of vital importance due to the increasing volume of wind power plants foreseen in the Energy Plan for the Canary Islands 2006 (PECAN), who will turn the Canary Islands into a pilot system in relation to wind power integration within an isolated system. (Author)
Prevalence of multiple sclerosis in Lanzarote (Canary Islands)
Garcia, J R; Rodriguez, S; Sosa Henriquez, M; Batista, E; Corujo, E; Font de Mora Turon, A; Hernandez Hernandez, D; Betancor Leon, P
1989-02-01
In the island of Lanzarote of the Province of Las Palmas, which is part of the Spanish archipelago of the Canary Islands, the prevalence of multiple sclerosis is 15 per 100,000. The prevalence of MS in Lanzarote seems related more to ethnic conditions than to geography.
Carbonate system distribution south of the Canary Islands in spring 2000
Directory of Open Access Journals (Sweden)
Iván R. Ucha
2010-11-01
Full Text Available The measurement of the surface molar fraction of CO2 (atmosphere and sea water and water column pHT, total alkalinity, AT, nutrients and oxygen were carried out in spring 2000 at the European Station for Time Series in the Ocean at the Canary Islands (ESTOC and in the area located south of the Canary Islands. The significant eddy field strongly affecting the pattern of the chemical and carbonate system variables is presented and discussed. A mixing model based on the thermohaline properties of the water masses was established. The model explained over 97% of the variability found in the distribution of the chemical variables. Intermediate waters to the south of the Canary Islands show a high contribution of Antarctic waters with about 5% of pure Antarctic Intermediate Water. Moreover, the surface structure affected the atmosphere-ocean carbon dioxide exchange, making the area act as a CO2 sink taking up 9.1 mmol m-2 week-1, corresponding to 0.03 Mt of CO2 which were taken up by the area in a week at the end of March 2000.
Xenopsylla spp. (Siphonaptera: Pulicidae) in murid rodents from the Canary Islands: an update.
Sánchez, S; Gómez, M S
2012-11-01
The geographical and host distributions of Xenopsylla fleas parasitizing murid rodents on the Canary Islands have been reported. Three Xenopsylla species, X. cheopis, X. brasiliensis and X. guancha, have been detected on two rodents species, Mus musculus and Rattus rattus. X. guancha has been the most prevalent species detected, specifically on M. musculus, the most abundant rodent, but it has been detected only on three eastern islands, where the species is endemic. X. cheopis has been shown to be the most widely distributed species throughout the archipelago and the species most frequently found on R. rattus. X. brasiliensis has been shown to be the least prevalent Xenopsylla species, with the lowest geographical distribution on the Canary Islands and focused only on R. rattus. The detection of both X. cheopis and X. brasiliensis on the island of Lanzarote, and of X. guancha on the island of Fuerteventura and the islet of La Graciosa represents the first report of these species on those particular Canary Islands.
Xenopsylla spp. (Siphonaptera: Pulicidae in murid rodents from the Canary Islands: An update
Directory of Open Access Journals (Sweden)
Sánchez S.
2012-11-01
Full Text Available The geographical and host distributions of Xenopsylla fleas parasitizing murid rodents on the Canary Islands have been reported. Three Xenopsylla species, X. cheopis, X. brasiliensis and X. guancha, have been detected on two rodents species, Mus musculus and Rattus rattus. X. guancha has been the most prevalent species detected, specifically on M. musculus, the most abundant rodent, but it has been detected only on three eastern islands, where the species is endemic. X. cheopis has been shown to be the most widely distributed species throughout the archipelago and the species most frequently found on R. rattus. X. brasiliensis has been shown to be the least prevalent Xenopsylla species, with the lowest geographical distribution on the Canary Islands and focused only on R. rattus. The detection of both X. cheopis and X. brasiliensis on the island of Lanzarote, and of X. guancha on the island of Fuerteventura and the islet of La Graciosa represents the first report of these species on those particular Canary Islands.
(Ceramiales, Rhodophyta) from the Canary Islands, eastern Atlantic
African Journals Online (AJOL)
The genus Osmundea is a strongly supported monophyletic group within the Laurencia complex and shows a disjunct distribution occurring in the North-East and South-West Pacific, the Indian and Atlantic oceans and the Mediterranean Sea. Its phenotypic plasticity on the Canary Islands may be the result of the high ...
The Lithospheric Structure Beneath Canary Islands from Receiver Function Analysis
Martinez-Arevalo, C.; Mancilla, F.; Helffrich, G. R.; Garcia, A.
2009-12-01
The Canary Archipelago is located a few hundred kilometers off the western Moroccan coast, extending 450 km west-to-east. It is composed of seven main islands. All but one have been active in the last million years. The origin of the Canary Islands is not well established and local and regional geology features cannot be completely explained by the current models. The main aim of this study is to provide new data that help us to understand and constrain the archipelago's origin and tectonic evolution. The crustal structure under each station is obtained applying P-receiver function technique to the teleseismic P arrivals recorded by the broadband seismic network installed at the Canary Island by the Instituto Geográfico Nacional (IGN) and two temporary stations (MIDSEA and IRIS). We computed receiver functions using the Extended-Time Multitaper Frequency Domain Cross-Correlation Receiver Function (ET-MTRF) method. The results show that the crust is thicker, around 22 km, in the eastern islands (Fuerteventura and Lanzarote) than in the western ones (El Hierro, La Palma, Tenerife), around 17 km, with the exception of La Gomera island. This island, located in the west, exhibits similar crustal structure to Fuerteventura and Lanzarote. A discontinuity at 70-80 km, possibly the LAB (Lithosphere Asthenosphere Boundary) is clearly observed in all the stations. It appears that Moho depths do not track the LAB discontinuity.
Institute of Scientific and Technical Information of China (English)
王腾腾; 韦秀梅; 常城; 韩慧宗; 姜海滨
2017-01-01
为筛选具有广谱抑菌活性的乳酸菌用于微生态制剂开发,本研究自野生许氏平鲉肠道内共分离出35株细菌,从中筛选出1株乳酸菌YH1,其革兰氏染色呈阳性,且可发酵脱脂乳产生凝固、无气泡、呈酸性现象,基于形态学观察、生理生化和16S rDNA序列鉴定乳酸菌YH1为食窦魏斯氏菌.分析了酸碱度、温度和NaC1含量对食窦魏斯氏菌YH1生长的影响;选取金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌和哈维氏弧菌等多种病原指示菌,以琼脂扩散法测定YH1培养12h产物的抑菌活性;并采用肌肉注射和腹腔注射两种方式对YH1的动物安全性进行检测.实验结果显示,食窦魏斯氏菌YH1适宜的生长条件为pH5.7-8.8、温度20-40℃,最适生长条件为pH7.2-8.4,温度35℃,在MRS培养基中添加NaC1会抑制YH1的生长;食窦魏斯氏菌YH1的无菌培养产物可显著抑制金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌、哈维氏弧菌等病原指示菌的生长;食窦魏斯氏菌YH1在108CFU/mL及以下浓度对许氏平鲉是相对安全的.以上研究表明了食窦魏斯氏菌YH1具有广谱抑菌性和动物安全性,为其应用于水产养殖业奠定了理论基础.%To screen wide-spectrum bacteriostatic activity for probiotics application,a lactic acid bacteria strain Weissella cibaria YH1 was recognized among 35 bacterial strains isolated from the intestine of wild Sebastes schlegelii.Morphological observation,physiological and biochemical characteristic analyses,and 16S rDNA sequencing were applied.Skim milk was fermented into coagulation with this gram-positive YH1 without bubbling,and the supernatant was acidic.The effects of pH,temperature,and NaC1 content on the growth of strain YH1 were analyzed.Some indicator pathogens(Staphylococcus aureus
Virtual Community, social network and media environment of Canary Isands regional digital newspapers
Directory of Open Access Journals (Sweden)
Dr. Francisco Manuel Mateos Rodríguez
2008-01-01
Full Text Available The impact of the new communication and information technologies has favoured the creation of multiple local newspaper websites in the Canary Islands, thus making the regional press emerge as an alternative on the rise. This tendency affects significantly both traditional and new editions of the different regional and local newspapers from the Canaries and motivates a different distribution, positioning and development within the local media environment in which these media share a novel dimension of communication with a specific virtual community and social network within the World Wide Web.
Cadmium dietary intake in the Canary Islands, Spain
International Nuclear Information System (INIS)
Rubio, C.; Hardisson, A.; Reguera, J.I.; Revert, C.; Lafuente, M.A.; Gonzalez-Iglesias, T.
2006-01-01
Cadmium (Cd) in the human diet constitutes a potential chronic hazard to health. In the nonsmoking general population, diet is the major source of cadmium exposure; therefore, it is important to monitor the dietary intake of this heavy metal to quantify and improve the understanding of Cd accumulation in the human body. The purpose of this study was to determine the levels of Cd in a range of food and drink commonly consumed in the Canary Islands. Food samples (420) were analyzed for Cd by atomic absorption spectrometry. The most recent nutritional survey conducted for the Canarian population was used to define the food and drink groups analyzed. The measured Cd concentrations combined with the food consumption data resulted in a total Cd intake in the Canary Islands of 0.16 μg/kg of body weight/day, which is well below the respective provisional tolerable weekly intake of Cd of 1 μg/kg of body weight per day determined by the FAO/WHO. The results are also compared with values reported for other national and international communities
Epigean freshwater Gammaridae (Crustacea, Amphipoda) from La Gomera (Canary Islands)
Beyer, Gabriele; Stock, Jan H.
1994-01-01
Description of two new species of freshwater amphipods from La Gomera (Canary Islands), both found in the higher parts of the island: Chaetogammarus chaetocerus n. sp. and Rhipidogammarus gomeranus n. sp. Both species have distinct Afro- Iberian relationships.
Fishing methods for sustainable shrimp fisheries in the Canary ...
African Journals Online (AJOL)
During the past 20 years, experimental cruises have been conducted around the Canary Islands (North-West Africa) to investigate the biodiversity of the deep-sea ecosystem and to explore new fisheries resources. Although pandalid shrimps were shown to be very abundant in this region, information is lacking regarding ...
Demographic history of Canary Islands male gene-pool: replacement of native lineages by European
Directory of Open Access Journals (Sweden)
Amorim António
2009-08-01
Full Text Available Abstract Background The origin and prevalence of the prehispanic settlers of the Canary Islands has attracted great multidisciplinary interest. However, direct ancient DNA genetic studies on indigenous and historical 17th–18th century remains, using mitochondrial DNA as a female marker, have only recently been possible. In the present work, the analysis of Y-chromosome polymorphisms in the same samples, has shed light on the way the European colonization affected male and female Canary Island indigenous genetic pools, from the conquest to present-day times. Results Autochthonous (E-M81 and prominent (E-M78 and J-M267 Berber Y-chromosome lineages were detected in the indigenous remains, confirming a North West African origin for their ancestors which confirms previous mitochondrial DNA results. However, in contrast with their female lineages, which have survived in the present-day population since the conquest with only a moderate decline, the male indigenous lineages have dropped constantly being substituted by European lineages. Male and female sub-Saharan African genetic inputs were also detected in the Canary population, but their frequencies were higher during the 17th–18th centuries than today. Conclusion The European colonization of the Canary Islands introduced a strong sex-biased change in the indigenous population in such a way that indigenous female lineages survived in the extant population in a significantly higher proportion than their male counterparts.
Directory of Open Access Journals (Sweden)
Ruben V. Horn
2015-06-01
Full Text Available Abstract: The Enterobacteriaceae family contains potentially zoonotic bacteria, and their presence in canaries is often reported, though the current status of these in bird flocks is unknown. Therefore, this study aimed to identify the most common genera of enterobacteria from canaries (Serinus canaria and their antimicrobial resistance profiles. From February to June of 2013, a total of 387 cloacal swab samples from eight domiciliary breeding locations of Fortaleza city, Brazil, were collected and 58 necropsies were performed in canaries, which belonged to the Laboratory of Ornithological Studies. The samples were submitted to microbiological procedure using buffered peptone water and MacConkey agar. Colonies were selected according to their morphological characteristics on selective agar and submitted for biochemical identification and antimicrobial susceptibility. A total of 61 isolates were obtained, of which 42 were from cloacal swabs and 19 from necropsies. The most isolated bacteria was Escherichia coli with twenty five strains, followed by fourteen Klebsiellaspp., twelve Enterobacterspp., seven Pantoea agglomerans, two Serratiaspp. and one Proteus mirabilis. The antimicrobial to which the strains presented most resistance was sulfonamides with 55.7%, followed by ampicillin with 54.1% and tetracycline with 39.3%. The total of multidrug-resistant bacteria (MDR was 34 (55.7%. In conclusion, canaries harbor members of the Enterobacteriaceae family and common strains present a high antimicrobial resistance rate, with a high frequency of MDR bacteria.
Biochemical characteristics of four marine fish skins in Korea.
Cho, Jae-Kwon; Jin, Young-Guk; Rha, Sung-Ju; Kim, Seon-Jae; Hwang, Jae-Ho
2014-09-15
In this study, we investigated the biochemical characteristics of the fish skins of four industrial species: olive flounder (Paralichthys olivaceus), black rockfish (Sebastes schlegeli), sea bass (Lateolabrax maculatus) and red sea bream (Pagrus major). There is high domestic demand in Korea for farming of these fish for human consumption. Crude protein contents in the skin of these fish ranged from 73% to 94% by dry weight; this was in part due to a high content of the structural protein, collagen. Among the four species, olive flounder had the thickest dermal and epidermal layers in the dorsal skin. This species was also associated with the highest extraction ratio of acid-soluble collagen. We also examined whether fish skin could be a cost-effective alternative to current fish meal sources. Our analysis indicates that, when supplemented with additional fish oils and essential amino acids, fish skin is a viable alternative for fish meal formulations. Copyright © 2014 Elsevier Ltd. All rights reserved.
Histopathology of Marine and Freshwater Fish Lymphocytosis Disease Virus (LCDV)
International Nuclear Information System (INIS)
Hossain, M.; Myung-Joo, Oh
2011-01-01
Lymphocytosis disease (LCD) in fishes is caused by the agent called lymphocytosis disease virus (LCDV). LCDV is a chronic and benign virus. The disease affects 96 species of marine and fresh water fishes ranged among 34 families in the world. Affected fish with LCD has a typical external symptom with clusters consisted of enormously hypertrophied dermal cells on the skin and fins. The hypertrophied cells, generally named lymphocytosis cells, have a thick hyaline capsule, an enlarged nucleus and prominent basophilic cytoplasmic inclusions. Among the four species of fishes, olive flounder Paralichthys olivaceus, and rockfish Sebastes schlegeli were marine cultured fish, and gourami Trichogaster leeri and painted glass fish Channa baculis were freshwater ornamental fish. Although LCD causes low mortality, the disfigurement of infected fish can make them unsellable. Thus LCD has resulted in an important economic loss in the aquaculture industry. This study of histopathology may be adequate for a presumptive diagnosis of lymphocytosis diseases both in marine and freshwater fish species. (author)
Tenarife Island, Canary Island Archipelago, Atlantic Ocean
1991-01-01
Tenarife Island is one of the most volcanically active of the Canary Island archipelago, Atlantic Ocean, just off the NW coast of Africa, (28.5N, 16.5W). The old central caldera, nearly filled in by successive volcanic activity culminating in two stratocones. From those two peaks, a line of smaller cinder cones extend to the point of the island. Extensive gullies dissect the west side of the island and some forests still remain on the east side.
Energy Technology Data Exchange (ETDEWEB)
Palmborg, Cecilia; Lindvall, Eva
2011-03-15
Reed canary grass (RCG) is a bio-energy crop with large potential. It is a 1.5 . 2.5 m tall grass that is harvested in spring when it is grown as a fuel. At spring harvest it yields 3 . 10 ton field dried material per ha and year. One disadvantage when reed canary grass is used as a fuel is the high ash content, 5-10 %. This means that large quantities of ash have to be deposited which is expensive, about 1000 SEK/ton. However, since reed canary grass ash contains reasonable amounts of plant nutrients like phosphorous (P), potassium (K) and magnesium (Mg) it could be recycled as fertilizer in agriculture. The ash can be used without any pretreatment since, in agriculture, plant availability is desirable. The aim of this project, was to evaluate a field experiment, where ash was used as a fertilizer in reed canary grass. The experiment was established at the SLU research station in Umea, Sweden in the spring 2002. Three different fertilizer treatments were applied: Treatment A was fertilized with an ash produced by combustion of RCG together with municipal wastes (paper, plastic, leather), treatment B, an ash from combustion of RCG, and for treatment C commercial fertilizers were used. In total, 100 kg ha-1 of nitrogen (N), 15 kg ha-1 of phosphorous (P) and 80 kg ha-1 of potassium (K), were applied each year in all treatments. The amount of ash in treatment A and B was calculated from the chemical analysis of the ashes to be equal to the required amount of P, while K and N were supplied also by commercial fertilizers. [Table 1. Composition of the ashes] Literature study: There is a lack of knowledge about fertilization with reed canary grass ash, since few experiments have been conducted. The composition of reed canary grass is dependent of harvest date and the soil substrate. The amount of ash and the amount of harmful substances such as potassium and chloride generally decreases over winter, giving an increased fuel quality from spring harvest compared to autumn
Systematics of Serinus canaries and the status of Cape and Yellow ...
African Journals Online (AJOL)
] canicollis) and Yellow-crowned (S. [c.] flavivertex) canaries (2.8%) was similar to differences between other closely-related species and there are marked plumage differences between these taxa, we suggest that they be elevated to full ...
Analysis of volcano rock from Canary islands
International Nuclear Information System (INIS)
Sitek, J.; Sedlackova, K.; Dekan, J.
2013-01-01
In this work we have analyzed the basalt rock from Lanzarote, which is the easternmost island of the Canary Islands lying in the Atlantic Ocean and has a volcanic origin. It was born through fiery eruptions and has solidified lava streams as well as extravagant rock formations. We compared our results with composition of basalt rocks from some other places on the Earth. Different iron oxides created on the volcanic rocks during their weathering on the Earth surface has been also analyzed. (authors)
Leví García-Romero; Antonio I. Hernández-Cordero; Elisabeth Fernández-Cabrera; Carolina Peña-Alonso; Luis Hernández-Calvento; Emma Pérez-Chacón
2016-01-01
Aeolian sedimentary systems in the Canary Islands differ significantly from other European and African systems due to their natural characteristics (climate, vegetation and insular isolation). Consequently, their geomorphological processes are unique. In turn, they are areas under high human pressure from touristic development. The aim of this paper is to analyze the impacts of urban-touristic development in four aeolian sedimentary systems in the Canaries: Maspalomas, Corralejo, Lambra and J...
Upgrated fuel from reed canary grass
Energy Technology Data Exchange (ETDEWEB)
Oravainen, H. [VTT Energy, Jyvaeskylae (Finland)
1997-12-01
Results described in this presentation are from a large EU-project - Development of a new crop production system based on delayed harvesting and system for its combined processing to chemical pulp and biofuel powder. This is a project to develop the use of Reed Canary Grass (Phalaris Arundinaceae) both for pulp industry and energy production. The main contractor of the project is Swedish University of Agricultural Sciences (coordinator), task coordinators are United Milling Systems A/S from Denmark, and Jaakko Poeyry Oy and VTT Energy from Finland In addition, there are partners from several countries participating in the project
Magaña, C; Beroiz, B; Hernández-Crespo, P; Montes de Oca, M; Carnero, A; Ortego, F; Castañera, P
2007-12-01
The banana weevil (BW), Cosmopolites sordidus (Coleoptera: Curculionidae), is one of the most important insect pests of bananas and plantains. The mobility and the origin of BW infestations at the Canary Islands (Tenerife, La Gomera and La Palma) have been analysed using Random Amplified Polymorphic DNA (RAPD) as molecular markers. Populations from Costa Rica, Colombia, Uganda and Madeira were also included for comparison. One hundred and fifteen reproducible bands from eight primers were obtained. The level of polymorphism in the populations from the Canary Islands (40-62%) was in the range of those found in other populations. Nei's genetic distances, pair-wise fixation index (FST) values indicate that the closest populations are Tenerife populations among themselves (Nei's genetic distance=0.054-0.100; FST=0.091-0.157) and Costa Rica and Colombia populations (Nei's genetic distance=0.049; FST=0.113). Our results indicate the existence of BW local biotypes with limited gene flow and affected by genetic drift. These results are compatible with a unique event of colonization at Tenerife; whereas, the outbreaks in La Gomera and La Palma may come from independent introductions. The Madeira population is phylogenetically and geographically closer to the Canary Islands populations, suggesting that it is the most likely source of the insects introduced in the Canary Islands.
Nannofossils in 2011 El Hierro eruptive products reinstate plume model for Canary Islands
Zaczek, Kirsten; Troll, Valentin R.; Cachao, Mario; Ferreira, Jorge; Deegan, Frances M.; Carracedo, Juan Carlos; Soler, Vicente; Meade, Fiona C.; Burchardt, Steffi
2015-01-01
The origin and life cycle of ocean islands have been debated since the early days of Geology. In the case of the Canary archipelago, its proximity to the Atlas orogen led to initial fracture-controlled models for island genesis, while later workers cited a Miocene-Quaternary east-west age-progression to support an underlying mantle-plume. The recent discovery of submarine Cretaceous volcanic rocks near the westernmost island of El Hierro now questions this systematic age-progression within the archipelago. If a mantle-plume is indeed responsible for the Canaries, the onshore volcanic age-progression should be complemented by progressively younger pre-island sedimentary strata towards the west, however, direct age constraints for the westernmost pre-island sediments are lacking. Here we report on new age data obtained from calcareous nannofossils in sedimentary xenoliths erupted during the 2011 El Hierro events, which date the sub-island sedimentary rocks to between late Cretaceous and Pliocene in age. This age-range includes substantially younger pre-volcanic sedimentary rocks than the Jurassic to Miocene strata known from the older eastern islands and now reinstate the mantle-plume hypothesis as the most plausible explanation for Canary volcanism. The recently discovered Cretaceous submarine volcanic rocks in the region are, in turn, part of an older, fracture-related tectonic episode.
Vélez-Belchí, Pedro; Pérez-Hernández, M. Dolores; Casanova-Masjoan, María.; Cana, Luis; Hernández-Guerra, Alonso
2017-06-01
The Atlantic Meridional Overturning Circulation (AMOC) is continually monitored along 26°N by the RAPID-MOCHA array. Measurements from this array show a 6.7 Sv seasonal cycle for the AMOC, with a 5.9 Sv contribution from the upper mid-ocean. Recent studies argue that the dynamics of the eastern Atlantic is the main driver for this seasonal cycle; specifically, Rossby waves excited south of the Canary Islands. Using inverse modeling, hydrographic, mooring, and altimetry data, we describe the seasonal cycle of the ocean mass transport around the Canary Islands and at the eastern boundary, under the influence of the African slope, where eastern component of the RAPID-MOCHA array is situated. We find a seasonal cycle of -4.1 ± 0.5 Sv for the oceanic region of the Canary Current, and +3.7 ± 0.4 Sv at the eastern boundary. This seasonal cycle along the eastern boundary is in agreement with the seasonal cycle of the AMOC that requires the lowest contribution to the transport in the upper mid-ocean to occur in fall. However, we demonstrate that the linear Rossby wave model used previously to explain the seasonal cycle of the AMOC is not robust, since it is extremely sensitive to the choice of the zonal range of the wind stress curl and produces the same results with a Rossby wave speed of zero. We demonstrate that the seasonal cycle of the eastern boundary is due to the recirculation of the Canary Current and to the seasonal cycle of the poleward flow that characterizes the eastern boundaries of the oceans.
Seasonal variability of the diapycnal mixing in the Canary Islands channels
Rodríguez-Santana, Angel; Marrero-Díaz, Angeles; Machín, Francisco Jose; García-Weil, Luis; Sangrà, Pablo; Vélez-Belchí, Pedro; Fraile-Nuez, Eugenio; Estrada-Allis, Sheila
2014-05-01
Trimonthly surveys of XBT and XCTD (Expandable Bathytermograph and Conductivity-Temperature-Depth) crossing the whole Canary Islands channels were carried out (projects TRAMIC and PROMECA) from November 2012 until September 2013 using opportunity ships (Naviera Armas Ferries). With this data set and using salinity analytical relationships (Machín et al, 2010), vertical sections of temperature and potential density were obtained for each channel and season. In order to estimate the intensity of the diapycnal mixing in the first 500 m of the pycnocline, vertical sections of Thorpe length scale, Turner angle and gradient Richardson number (from the geostrophic vertical shear) were calculated for all the cases. The first results show how the diapycnal mixing due to the vertical shear instabilities is more intense close to the islands and in summer when the seasonal pycnocline is present. Mixing due to double diffusion processes (salt fingers) was found without sizable changes in the permanent pycnocline. Net turbulence diffusivities and diapycnal diffusive fluxes with their variability spatial and temporal will be estimate for each channel taking into account that processes of double diffusion and turbulence induced by vertical shear are present at the same time. Additionally the results obtained from hydrographic data from the cruise RAPROCAN-2013 (IEO) (October 2013) around Canary Islands will be used to compare them with the channels results. This work was co-funded by Canary Government (TRAMIC project: PROID20100092), European Union (FEDER) and Spanish Government (PROMECA: CTM2008-04057/MAR and CTM2009-06993-E/MAR)
Fine-structure contamination by internal waves in the Canary Basin
Gostiaux, L.; van Haren, H.
2012-01-01
Over a range of 132.5 m, 54 temperature sensors (1 mK relative accuracy) were moored yearlong while sampling at 1 Hz around 1455 m in the open Canary Basin. Coherence between individual records shows a weak but significant peak above the local buoyancy frequency N for all vertical separations Delta
International Nuclear Information System (INIS)
Zumbado, Manuel; Goethals, Muriel; Alvarez-Leon, Eva E.; Luzardo, Octavio P.; Cabrera, Felix; Serra-Majem, Lluis; Dominguez-Boada, Luis
2005-01-01
In 1998, one of the largest determinations of organochlorine pesticides in a representative sample of a Spanish population (682 serum samples from the Canary Islands) was made in the context of the 'Canary Islands Nutrition Survey' (ENCA). In the Canary Islands, extensive farming areas have been developed in these last decades, with greenhouses dedicated to intensive cultivation using DDT in huge amounts. In Spain, similarly to other European countries, DDT was banned in the late 1970s. The pesticide residues in human serum are indicative of past and present exposure to them. Our objective is to point out the differences of pesticide contamination between islands; and together with this, if a connection could be established with gender, age, or habitat of subjects. Concentration of selected persistent organochlorine pollutants (p,p'-DDT, o,p'-DDT, p,p'-DDE, o,p'-DDE, p,p'-DDD, and o,p'-DDD) was measured with gas chromatography-electron capture detector. Almost all of the samples (99.3%) presented detectable levels of some DDT-derivatives, being p,p'-DDE the most frequently detected organochlorine. The median concentration of total DDT body burden, expressed in ng/g fat, present in the Canary Islands (370 ng/g fat) was similar to that found in other European countries, although it was noteworthy that a fourth of the population showed a total DDT body burden higher than 715 ng/g. Interestingly, statistical significant differences were found in serum levels of organochlorine pesticides between islands, being these levels higher in people from Tenerife and Gran Canaria (415 and 612 ng/g fat, respectively), the islands that present both highest population and highest surface devoted to intensive agriculture. As expected, serum levels of both total DDT body burden and p,p'-DDE increased with age. Statistically significant differences were also found in relation to gender, women showing higher levels of these organochlorine pesticides than men. One of the most relevant
A new species of Sarcodictyon (Anthozoa: Stolonifera) from Tenerife, Canary Islands
Ocaña, O.; Brito, A.; Nuñez, J.
1992-01-01
A new species of Stolonifera, Sarcodictyon canariensis, from Tenerife, Canary Islands, is described and illustrated. It is characterized by its large size, the form of its sclerites and internal anatomy. The material was collected at a depth of 95-130 m in the community of Dendrophyllia ramea
Valverde, María Elena; Orona-Tamayo, Domancar; Nieto-Rendón, Blanca; Paredes-López, Octavio
2017-03-01
Canary seed (Phalaris canariensis) is used to feed birds but it has been recently considered a promising cereal with nutraceutical potential for humans. The aim of this work was to analyze the protein fractions from canary seed flour and from milk substitutes (prepared by soaking the seeds in water 12 and 24 h), and to evaluate antioxidant and antihypertensive capacity of peptides obtained after in vitro digestion. Prolamins were the major protein fraction, followed by glutelins. After digestion, albumins and prolamins fractions from milks presented higher levels of peptides than flour, globulins showed more peptides in flour and glutelins were found in similar concentrations in all samples; 24 h milk prolamins had the highest concentration of peptides. Purification by high performance liquid chromatography (HPLC), sequencing of peptides, in vitro antioxidant ABTS (2,2'-azino-bis, 3-ethylbenzothiazoline-6-sulphonic acid) and DPPH (2,2-diphenyl-1-picrylhydrazyl) assays, and antihypertensive capacity (angiotensin converting enzyme (ACE) assay), indicated that peptides from canary seed prolamins were the most efficient compounds with antioxidant and antihypertensive activity. Canary seeds may be considered an accessible and cheap source to prepare milk substitutes with high contents of bioactive peptides with remarkable functional properties to promote better human health and healthy ageing.
First record of Ligia oceanica (Linnaeus, 1767) (Isopoda: Ligiidae) in the Canary Islands
Ramírez, Rubén; Riera, Rodrigo
2013-01-01
This study presents the first record of L. oceanica in the Canary Islands. Additionally, body features between L. oceanica and Ligia italica Fabricius, 1798, the other sea-slater inhabiting the Archipelago, were compared.
Age and sex dimorphism in the Canary Blue Tit Cyanistes teneriffae ...
African Journals Online (AJOL)
The Canary Blue Tit Cyanistes teneriffae has recently been split off from the Common Blue Tit Cyanistes caeruleus as a separate species. Live biometrics from across the entire distribution on the island of Tenerife (subspecies teneriffae teneriffae) are reported. Results suggest that first-year birds had similar bill shape to ...
Pajuelo, José G.; González, José A.; Triay-Portella, Raül; Martín, José A.; Ruiz-Díaz, Raquel; Lorenzo, José M.; Luque, Ángel
2016-11-01
This work documents the introduction of non-native fish species to the Canary Islands (central-eastern Atlantic) through oil rigs. Methodological approaches have included surveys by underwater visual censuses around and under oil platforms and along the docking area of rigs at the Port of Las Palmas. Eleven non-native fish species were registered. Paranthias furcifer, Abudefduf hoefleri, Acanthurus bahianus, Acanthurus chirurgus, and Acanthurus coeruleus are first recorded from the Canaries herein. Other three species could not be identified, although they have never been observed in the Canaries. Cephalopholis taeniops, Abudefduf saxatilis, and Acanthurus monroviae had been previously recorded. Native areas of these species coincide with the areas of origin and the scale of oil rigs with destination the Port of Las Palmas. The absence of native species in the censuses at rigs and their presence at rigs docking area, together with the observation of non-native species after the departure of platforms, reject the possibility that these non-native species were already present in the area introduced by another vector. C. taeniops, A. hoefleri, A. saxatilis, A. chirurgus, A. coeruleus and A. monroviae are clearly seafarer species. A. bahianus seems to be a potential seafarer species. P. furcifer is a castaway species. For the moment, the number of individuals of the non-native species in marine ecosystems of the Canaries seems to be low, and more investigation is needed for controlling these translocations.
The One-humped Camel in the Canary Islands: History and Present Status
Directory of Open Access Journals (Sweden)
Wilson, RT.
2015-01-01
Full Text Available The one-humped camel (Camelus dromedarius L. is not indigenous to the Canary Islands but based on historical references was introduced at the very beginning of the fifteenth century. The camel thrived in the subtropical dry environment. A long period of isolation from other animals of the same species meant that the animals were virtually disease free. This made the Islands an ideal base for exporting camels to new areas such that camels from the Canaries went to Peru in the sixteenth century, to Brazil in the eighteenth century, Venezuela and Bolivia in the early part of the nineteenth century and Australia in 1840. Camels went to several Caribbean islands in the middle of the nineteenth century. More recently (late twentieth and early twenty-first centuries some animals were exported from the islands to mainland Europe, notably France, Spain and the Netherlands, and to South America. Camels have been used in military operations, as transport and draught animals in support of agriculture and have found a role in the tourist industry. In early 2013 there were some 1,300 camels distributed over four of the larger islands of the archipelago in herds varying in size from a single animal to herds of as many as 150 head: a large group of about 400 heads kept in a Safari Park on the island of Fuerteventura is considered as the national conservation herd. The "Canary" camel has recently been shown to be genetically distinct from most other populations and it has been proposed that it should be designated as a distinct breed.
Carbon neutral archipelago – 100% renewable energy supply for the Canary Islands
International Nuclear Information System (INIS)
Gils, Hans Christian; Simon, Sonja
2017-01-01
Highlights: • A pathway to a 100% renewable energy supply for the Canary Islands is presented. • Hourly system operation is analysed, considering flexibility options and sector linkage. • Results show feasibility of a carbon neutral energy supply with local resources. • High resolution power system model highlights importance of grid connections. - Abstract: As many other small islands and archipelagos, the Canary Islands depend to a high degree on energy imports. Despite its small surface, the archipelago has a high potential for renewable energy (RE) technologies. In this paper, we present a scenario pathway to a 100% RE supply in the Canary Islands by 2050. It relies on a back-casting approach linking the bottom-up accounting framework Mesap-PlaNet and the high resolution power system model REMix. Our analysis shows that locally available technology potentials are sufficient for a fully renewable supply of the islands’ power, heat, and land transport energy demands. To follow the pathway for achieving a carbon neutral supply, expansion of RE technology deployment needs to be accelerated in the short-term and efforts towards greater energy efficiency must be increased. According to our results, an extended linkage between energy sectors through electric vehicles as well as electric heating, and the usage of synthetic hydrogen can contribute notably to the integration of intermittent RE power generation. Furthermore, our results highlight the importance of power transmission in RE supply systems. Supply costs are found 15% lower in a scenario considering sea cable connections between all islands.
Energy Technology Data Exchange (ETDEWEB)
Semere, T.; Slater, F.M. [Llysdinam Field Centre, School of Biosciences, Cardiff University, Newbridge-on-Wye, Llandrindod Wells, Powys, LD1 6NB (United Kingdom)
2007-01-15
Monitoring of invertebrates at four field sites in Herefordshire, England, growing miscanthus and reed canary-grass was carried out in 2002, 2003 and 2004 to investigate the ecological impact of these crops on ground beetles, butterflies and arboreal invertebrates. Ground beetles were sampled by pitfall trapping; and arboreal invertebrates by sweep netting and stem beating. The Centre for Ecology and Hydrology's Butterflies Monitoring Scheme methodology was used to record butterflies. The effects of the biomass crops on invertebrates were indirect, through the use of weeds as food resources and habitat. The greater diversity of weed flora within miscanthus fields than within reed canary-grass fields had a greater positive effect on invertebrates. Ground beetles, butterflies and arboreal invertebrates were more abundant and diverse in the most floristically diverse miscanthus fields. The difference in crop architecture and development between miscanthus and reed canary-grass was reflected in their differences in crop height and ground cover early on in the season. However, most of the difference in arthropod abundance between the two crops was attributed to the difference in the agronomic practice of growing the crops such as plant density, and the effect of this on weed growth. Since perennial rhizomatous grasses require a single initial planting and related tillage, and also no major chemical inputs; and because the crops are harvested in the spring and the land is not disturbed by cultivation every year, the fields were used as over-wintering sites for invertebrates suggesting immediate benefits to biodiversity. (author)
New Oxidized Zoanthamines from a Canary Islands Zoanthus sp.
Directory of Open Access Journals (Sweden)
Francisco Cen-Pacheco
2014-10-01
Full Text Available Three new norzoanthamine-type alkaloids, named 2-hydroxy-11-ketonorzoan thamide B (1, norzoanthamide B (2 and 15-hydroxynorzoanthamine (3, were isolated from Zoanthus sp. specimens collected at the Canary Islands. Their structures were determined by interpretation of NMR and HR-ESIMS data. Relative configurations of their chiral centers were proposed on the basis of ROESY spectra and by comparison of their spectroscopic data with those of the well-known compound, norzoanthamine.
Mariana Wibowo, Lia Monica Tejo
2014-01-01
Research studies is about the application of vintage style in some cafe in Surabaya aims to determine the application of vintage design styles contained in the interior of the cafe Carpentier Kitchen , Canary Cafe , Daily Sweet Cafe , and Stilroad Cafe . Research studies of vintage style design will be carried out in Surabaya with a case study that some cafe in Surabaya that meets the criteria of vintage design styles , including the Carpentier Kitchen , Canary Cafe , Daily Sweet Cafe , and S...
Alberto, Filipe; Arnaud-Haond, Sophie; Duarte, Carlos M.; Serrao, Ester Álvares
2006-01-01
The seagrass Cymodocea nodosa forms a unique community in the Canary Islands, where it is classified as an endangered species. Biogeographic theory predicts that clonal species on islands near their distributional limits might show lower proportions of sexual (versus clonal) reproduction, lower genetic diversity, and higher differentiation. We addressed these hypotheses by comparing the genetic structure of C. nodosa from 10 meadows in the 4 main Canary Islands with 2 Iberian sites (Atlantic ...
Viso, Miguel; Rodríguez, Zulma; Loreto, Neydys; Fernández, Yolima; Callegari, Carlos; Nicita, Graciela; González, Julio; Cabrera de León, Antonio; Reigosa, Aldo
2011-12-01
In Venezuela as in the Canary Islands (Spain), cardiovascular disease is a major cause of morbidity and mortality. The purpose of this research is to estimate the cardiovascular risk in the Canary Islands migrants living in Venezuela and participating in the study cohort "CDC of the Canary Islands in Venezuela". 452 individuals, aged 18 to 93 years (54.9% women), were enrolled between June 2008 and August 2009. A data survey was performed and their weight, height, abdomen and hip circumferences, and blood pressure were measured. After a 12-hour fasting period, a blood sample was obtained for glucose and lipid profile determinations. 40.5% of the subjects were over 65 years of age and 8% corresponded to the younger group (18-30 years). In men, the average age was 57.69 +/- 18.17 years and the body mass index 29.39 +/- 5.71 kg/m2, whereas women were 56.50 +/- 16.91 years and 28.20 +/- 5.57 kg/m2, respectively. The prevalence of metabolic syndrome was 49.1%, overweight and obesity together 75,2%, abdominal obesity 85.4%, diabetes 17.4%, impaired fasting glucose (IFG) 12.2%, elevated blood pressure 52.9%, low HDL-cholesterol 53,8% and elevated serum triglycerides 31%. Among subjects without diabetes or IFG, a third showed a high triglycerides/HDL-cholesterol ratio, indicating insulin resistance. We conclude that the Canarian-Venezuelan community suffers high prevalence of cardiovascular risk factors (obesity, abdominal obesity, dyslipidemia, diabetes). In relation to the current population of the Canary Islands, they show a lower frequency of IFG and a higher frequency of low HDL-cholesterol. In comparison to the Venezuelan population (Zulia), they showed to have lower prevalence of IFG, low HDL cholesterol and elevated triglycerides.
Dicty_cDB: Contig-U05027-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available au_evk_975886 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE814922 ) EST_scau_e...vk_965902 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE812759 ) EST_scau_evk_973993 scauevk mixed_tissue Sebaste...s... 60 1e-04 1 ( GE812758 ) EST_scau_evk_963625 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE8089...60 ) EST_scau_evk_977800 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE808959 )... EST_scau_evk_962440 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE806311 ) EST_scau_evk_971428 scauevk mixed_tissue Sebaste
Pérez-Hernández, M. D.; McCarthy, G. D.; Vélez-Belchí, P.; Smeed, D. A.; Fraile-Nuez, E.; Hernández-Guerra, A.
2015-11-01
This study examines the seasonal cycle of the Atlantic Meridional Overturning Circulation (AMOC) and its eastern boundary contributions. The cycle has a magnitude of 6 Sv, as measured by the RAPID/MOCHA/WBTS project array at 26°N, which is driven largely by the eastern boundary. The eastern boundary variations are explored in the context of the regional circulation around the Canary Islands. There is a 3 month lag between maximum wind forcing and the largest eastern boundary transports, which is explained in terms of a model for Rossby wave generated at the eastern boundary. Two dynamic processes take place through the Lanzarote Passage (LP) in fall: the recirculation of the Canary Current and the northward flow of the Intermediate Poleward Undercurrent. In contrast, during the remaining seasons the transport through the LP is southward due to the Canary Upwelling Current. These processes are linked to the seasonal cycle of the AMOC.
Boye, Joyce Irene; Achouri, Allaoua; Raymond, Nancy; Cleroux, Chantal; Weber, Dorcas; Koerner, Terence B; Hucl, Pierre; Patterson, Carol Ann
2013-06-26
Glabrous (hairless) canary seed belongs to the Poaceae (Gramineae) family and could serve as an alternative source of gluten-free cereal grain. In this study, allergenic cross-reactivities between hairless, dehulled canary seeds (Phalaris canariensis) and major allergenic proteins from gluten, soy, peanuts, tree nuts, sesame, and mustard were studied using commercial enzyme-linked immune sorbent assay (ELISA) kits specific for these target allergens. Mass spectrometry (MS) and immunoblotting were further used to assess for the presence of gluten-specific protein fragments. MS results revealed the likely presence of proteins homologous with rice, oat, corn, carrot, tomato, radish, beet, and chickpea. However, no presence of celiac-related gluten fragments from wheat, rye, barley, or their derivatives was found. Immunoblotting studies yielded negative results, further confirming the absence of gluten in the canary seed samples tested. No cross-reactivities were detected between canary seeds and almond, hazelnut, mustard, peanut, sesame, soy, walnut, and gluten using ELISA.
Irani, Mahdi; Razavi, Seyed M A; Abdel-Aal, El-Sayed M; Hucl, Pierre; Patterson, Carol Ann
2016-06-01
Dilute solution properties of an unknown starch are important to understand its performance and applications in food and non-food industries. In this paper, rheological and molecular properties (intrinsic viscosity, molecular weight, shape factor, voluminosity, conformation and coil overlap parameters) of the starches from two hairless canary seed varieties (CO5041 & CDC Maria) developed for food use were evaluated in the dilute regime (Starch dispersions in DMSO (0.5g/dl)) and compared with wheat starch (WS). The results showed that Higiro model is the best among five applied models for intrinsic viscosity determination of canary seed starch (CSS) and WS on the basis of coefficient of determination (R(2)) and root mean square error (RMSE). WS sample showed higher intrinsic viscosity value (1.670dl/g) in comparison to CSS samples (1.325-1.397dl/g). Berry number and the slope of master curve demonstrated that CSS and WS samples were in dilute domain without entanglement occurrence. The shape factor suggested spherical and ellipsoidal structure for CO5041 starch and ellipsoidal for CDC Maria starch and WS. The molecular weight, coil radius and coil volume of CSSs were smaller than WS. The behavior and molecular characterization of canary seed starch showed its unique properties compared with wheat starch. Copyright © 2016 Elsevier B.V. All rights reserved.
The renewable energies in Canary Islands. Las energias renovables en las islas Canarias
Energy Technology Data Exchange (ETDEWEB)
Institute for Diversification and saving of energy.
1994-01-01
The situation of renewable energies in Canary Island is presented. Technical and economical aspects of renewable sources are studied: wind energy, solar thermal energy, photovoltaic energy, urban solid wastes incineration, biomass, hydropower and geothermal energy. Finally the environment aspects are presented.
Stygofauna of the Canary Islands, 8 Amphipoda (Crustacea) from inland groundwaters of Fuerteventura
Stock, Jan H.
1988-01-01
New material of Bogidiella from Fuenteventura (Canary Islands) provided evidence that the specimens of the genus previously recorded from inland groundwaters belong to a species new to science: B. (Stygogidiella) purpuriae, closely related to the thalassostygobiont, B. (S.) uniramosa from Lanzarote.
Montoya-Alonso, J A; Carretón, E; Morchón, R; Silveira-Viera, L; Falcón, Y; Simón, F
2016-01-30
Cardiopulmonary dirofilariosis (heartworm) is a zoonotic vector borne disease caused by Dirofilaria immitis which affects domestic dogs and cats. Two of the seven Canary Islands are historically hyperendemic areas of dirofilariosis, although no epidemiological study has ever been carried out which includes the other islands. The aim of the study was to complete the epidemiological status of cardiopulmonary dirofilariosis in the canine and feline population throughout all the Canary Islands. 1643 client-owned dogs and 707 client-owned cats were tested for D. immitis antigens (dogs), and anti-D. immitis and anti-Wolbachia antibodies (cats). The prevalence of canine dirofilariosis in the Canary Islands was 15.7%, and the seroprevalence of feline dirofilariosis was 18.1%. A remarkable disparity was found when evaluating the results by island separately, which ranged from from 0% in Lanzarote and El Hierro, low prevalences and seroprevalences in Fuerteventura (1.8% and 2.5% in dogs and cats, respectively), to higher prevalences on the other 4 islands; ranging between 15.7% (dogs) and 14.3% (cats) in La Palma 22.5% (dogs) and 24.1% (cats) in Tenerife. In addition, prevalences and seroprevalences were very variable within each island, these differences being associated to local climate conditions. The distribution and prevalence of dirofilariosis in the Canary Islands is heterogeneous and related to climate, demographic factors and management of pets in the studied areas. Dirofilariosis remains hyperendemic in 4 of the 7 Islands. Since D. immitis is a zoonosis, veterinary and health authorities should be aware of the current prevalence and seroprevalence of animal dirofilariosis. The results show the need for awareness raising campaigns to promote the implementation of prophylactic measures in pets, in order to achieve a decrease in the prevalence of animal dirofilariosis in the Canary Islands. Copyright © 2015 Elsevier B.V. All rights reserved.
Revision of the Cerobasis annulata group (Psocoptera: Trogiidae) from the Canary Islands
Baz, A.
1993-01-01
The species of the Cerobasis annulata group from the Canary Islands are revised. A key to the seven species is provided; the Holarctic C. annulata is added for comparison. Five new species are described: Cerobasis rosae spec. nov., C. ericaceus spec. nov., C. anagaensis spec. nov., C. longicornis
Mapping the geogenic radon potential of the eastern Canary Islands.
Rubiano, Jesús G.; Alonso, Hector; Arnedo, Miguel. A.; Tejera, Alicia; Martel, Pablo; Gil, Juan M.; Rodriguez, Rafael; González, Jonay
2014-05-01
The main contribution of indoor radon comes from soils and thus, the knowledge of the concentration of this gas in soils is important for estimating the risk of finding high radon indoor concentrations. To characterize the behavior of radon in soils, it is common to use the a quantity named Radon Potential which results of a combination of properties of the soil itself and from the underlying rock, such as concentration and distribution of radium, porosity, permeability, the moisture content and meteorological parameters, among others. In this work, the results three year of campaigns of measurement radon gas as well as the permeability in soils of the Eastern Canary Islands (Gran Canaria, Fuerteventura and Lanzarote) are presented. By combining these two parameters and through the use of geostatistic interpolation techniques, the radon potential of soils is estimated and it is used to carry on a classification of the territory into hazard zones according to their potential for radon emanation. To measure the radon soil gas a probe equipped with a "lost" sharp tip is inserted to the desired sampling depth. One of the characteristics of the Canary Islands is the absence of developed soils and so the bedrock is found typically at very shallow depth. This fact has led us to adopt a sampling depth of 50 cm at most. The probe is connected to the continuous radon monitor Durridge RAD7 equipped with a solid-state alpha spectrometer to determine concentration radon using the activity its short-lived progeny. Dried soil air is delivered to the RAD7 radon monitor by pumping. A half hour counting time for all sampling points has been taken. In parallel to the radon measurement campaign, the permeability of soils has also been determined at each point using the permeameter RADON-JOK. The principle of operation of this equipment consists of air withdrawal by means of negative pressure. The gas permeability is then calculated using the known flow of air flowing through the probe
Energy Technology Data Exchange (ETDEWEB)
Paulrud, Susanne; Lundmark, Bo
2009-07-01
The aim of this preliminary study was to summarize existing information and to develop an outline plan for a mobile briquette plant based on the conditions and requirements of reed canary grass production on forestry land. The results of the study show that there is potential to build up small-scale briquette production from reed canary grass in the areas around Arvidsjaur, Lycksele and Malaa. Important conclusions from the study are that there are potential users for reed canary grass briquettes in all three areas studied, but that profitability for mobile briquette plants is dependent on the willingness of the users to pay well for the briquettes. These briquette plants would need a relatively high degree of automation for commercial operation to be profitable. The first plant should therefore be collocated with another business so that staff, machinery (e.g. loader) and storage space can be shared with other operations. One appropriate location would be to build up activities for a mobile reed canary grass briquette plant around Glommers Miljoeenergi's pellet plant in Glommerstraesk. Thus, the plant could be used as a demonstration mobile unit, with a stationary 'home production base'CO{sub 2} Glommerstraesk
The effects of introducing natural gas in the Canary Islands for electricity generation
International Nuclear Information System (INIS)
Ramos-Real, Francisco Javier; Moreno-Piquero, Juan Carlos; Ramos-Henriquez, Jose Manuel
2007-01-01
This study analyses the economic effects of introducing natural gas in the Canary Islands to generate electricity in combined cycle gas turbine (CCGT) plants. To this end we will evaluate how this measure contributes to achieving the objectives of the islands' energy policy and we calculate the cost of generating a kWh from this technology. For this calculation we obtain the net present value (NPV) of the total production costs during the economic lifetime of the plant so as to subsequently find the unitary cost per kWh generated. The result obtained indicates that the kWh cost is some 25% lower than the cost of using petroleum derivatives. Additionally, if we consider the positive effect of CO 2 emissions reductions, the cost is 41% lower. The introduction of natural gas will also be a decisive factor in complying with Kyoto requirements and in diversifying supply sources in the Canaries
[Comparing the perspectives of primary care doctors in the Canary Islands and Alberta (Canada)].
Mahtani-Chugani, Vinita; López-Hijazo, Asunción; Manca, Donna; Sanz-Alvarez, Emilio
2012-05-01
To examine the advantages and disadvantages of two different Health Care Systems from the perspective of Primary Care (PC) physicians. Qualitative research based on the analysis of documents written as diaries for the study. Primary Care in the Canary Islands (Spain) and Alberta (Canada) CONTEXT AND PARTICIPANTS: Intentional sample to identify different profiles of physicians. Participants were asked to write a document describing their work activities, including the impact of the organisational system and on their personal life. Two representatives of the health care system were asked to write a detailed description about how PC is organised in their country. Nine diaries were collected (5 from the Canary Islands and 4 from Alberta). Ritchie & Spencer framework was used for the analysis. In Alberta, physicians have access to more complementary tests; they can offer hospital care; they have to sort out administrative work; they can choose were to work; and can specialise in different types of health care services. In the Canary Islands physicians can have paid holidays and the administrative issues do not depend on them, patients have a physician assigned and seem to have more institutional support. The results of this study allow us to constructively analyse the role of PC physicians, assess the advantages and re-think the disadvantages related to how we work in order to learn from other health care systems. Copyright © 2010 Elsevier España, S.L. All rights reserved.
Ichthyoplankton transport from the African coast to the Canary Islands
Brochier, Timothée; Mason, Evan; Moyano, Marta; Berraho, Amina; Colas, Francois; Sangrà, Pablo; Hernández-León, Santiago; Ettahiri, Omar; Lett, Christophe
2011-08-01
The Canary Upwelling System (CUS), a major eastern boundary upwelling system, sustains large cross-border fisheries of small pelagic fish, which poses the question of stock connectivity. Studies suggest that ichthyoplankton transport from the northwest African coast to the Canary Islands (CI) is facilitated by coastal-upwelling associated filaments. Here we analyze connections between larval supply to the CI and sardine and anchovy populations that spawn over the continental shelf. For both species, ichthyoplankton observations (1) at the shelf and (2) near the island of Gran Canaria (GC) are used. Predictions of ichthyoplankton transport to GC are obtained from the Ichthyop Lagrangian transport model, which is forced by a high-resolution hydrodynamic model (ROMS) that reproduces the regional circulation. Results show that upwelling filaments play an important role in the transport of larvae to GC. However, (1) filaments are not the only mechanism, and (2) filament presence does not necessarily imply larval transport. Anchovy and sardine larval presence at GC appears to be independent of the respective adult spawning seasonality. Combining of observed and modeled data does not succeed in reproducing the observed larval patterns at GC. Various hypotheses are proposed to explain this discrepancy in larval transport to GC.
Pascual Velasco, F; Otero Ferrio, I; Borobio Enciso, M V
1991-05-01
The Canary Islands area now appears to be a Q-fever endemic zone, especially the west side (La Palma island). The situation in the eastern islands in unknown. In order to evaluate the seric prevalence of Coxiella burnetii, 100 serum samples that were taken from the adult population of Lanzarote and, following strict criteria, were analysed using a complement fixation test; blood donors and patients who had suffered a recent infection were excluded. The study was carried out during November/1986. Three serum samples were positive, one had titers of 1/8 and the other two showed 1/64. This prevalence rate of residual Coxiella burnetii antibodies in Lanzarote (3%)--despite being low compared to other areas in Spain--together with te recent cases described, confirms the suspicion that the Canary Islands area is indeed a new endemic Q-fever zone.
Energy Technology Data Exchange (ETDEWEB)
Palmborg, Cecilia; Lindvall, Eva (Swedish Univ. of Agricultural Sciences, Dept. of Agricultural Research for Northern Sweden, Umeaa (Sweden)), e-mail: eva.lindvall@njv.slu.se
2010-07-15
In a field experiment close to Oestersund in mid Sweden reed canary grass was intercropped with barley, Alsike clover, Trifolium hybridum L., red clover, T. pratense L., goats rue, Galega orientalis L. or a combination of red clover and goats rue. There were also three fertilization treatments: A: Recommended amounts of N, P and K. B: Recommended amounts of P and K and half amount of N. C: Sewage sludge application before sowing (establishment year) and recommended amounts of P and K and half amount of N. The biomass was lower where reed canary grass had been undersown in barley, and higher with full N-fertilization than with half N-fertilization. However there were no significant differences between legume intercrops with half N-fertilization and pure reed canary grass with full Nfertilization. Alsike clover was the most productive legume, followed by red clover. The amount of nitrogen fixed by the legumes was less with full N-fertilization (29 kg/ha as a mean) than with half N-fertilization (38 kg/ha). Intercropping with legumes could substitute half of the N in fertilization but similar experiments in other parts of Sweden has shown that there is a higher risk of weed problems
The genus Alvania on the Canary Islands and Madeira (Mollusca: Gastropoda) Part 1
Moolenbeek, R.G.; Hoenselaar, H.J.
1989-01-01
Micromolluscs of the family Rissoidae and belonging to the genus Alvania s.l. from the Canary Islands and the Madeira archipelago are revised. For several species the type locality is restricted and lectotypes are designated for Rissoa canadensis d’Orbigny, 1839, R. euchila Watson, 1886, R.
Dicty_cDB: Contig-U05475-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available . 44 5.3 1 ( GE816148 ) EST_scau_evk_967301 scauevk mixed_tissue Sebastes... 44 5...1904 srasevg mixed_tissue Sebastes... 44 5.3 1 ( EW980904 ) EST_sras_evg_781520 srasevg mixed_tissue Sebaste...s... 44 5.3 1 ( EW979029 ) EST_sras_evg_780173 srasevg mixed_tissue Sebastes... 4
Canary: An NLP Platform for Clinicians and Researchers.
Malmasi, Shervin; Sandor, Nicolae L; Hosomura, Naoshi; Goldberg, Matt; Skentzos, Stephen; Turchin, Alexander
2017-05-03
Information Extraction methods can help discover critical knowledge buried in the vast repositories of unstructured clinical data. However, these methods are underutilized in clinical research, potentially due to the absence of free software geared towards clinicians with little technical expertise. The skills required for developing/using such software constitute a major barrier for medical researchers wishing to employ these methods. To address this, we have developed Canary, a free and open-source solution designed for users without natural language processing (NLP) or software engineering experience. It was designed to be fast and work out of the box via a user-friendly graphical interface.
Achterberg, van C.; Guerrero, E.R.
2003-01-01
Two new species of the genus Peristenus Foerster (Hymenoptera: Braconidae: Euphorinae) from the Canary Islands are described and illustrated: Peristenus angifemoralis spec. nov. from Tenerife, and P. gloriae spec. nov. from Gran Canaria and Tenerife.
Weis, Franz A.; Skogby, Henrik; Troll, Valentin R.; Deegan, Frances M.; Dahren, Börje
2015-07-01
Water is a key parameter in magma genesis, magma evolution, and resulting eruption styles, because it controls the density, the viscosity, as well as the melting and crystallization behavior of a melt. The parental water content of a magma is usually measured through melt inclusions in minerals such as olivine, a method which may be hampered, however, by the lack of melt inclusions suitable for analysis, or postentrapment changes in their water content. An alternative way to reconstruct the water content of a magma is to use nominally anhydrous minerals (NAMs), such as pyroxene, which take up low concentrations of hydrogen as a function of the magma's water content. During magma degassing and eruption, however, NAMs may dehydrate. We therefore tested a method to reconstruct the water contents of dehydrated clinopyroxene phenocrysts from the Western Canary islands (n = 28) through rehydration experiments followed by infrared and Mössbauer spectroscopy. Employing currently available crystal/melt partitioning data, the results of the experiments were used to calculate parental water contents of 0.71 ± 0.07 to 1.49 ± 0.15 wt % H2O for Western Canary magmas during clinopyroxene crystallization at upper mantle conditions. This H2O range is in agreement with calculated water contents using plagioclase-liquid-hygrometry, and with previously published data for mafic lavas from the Canary Islands and comparable ocean island systems elsewhere. Utilizing NAMs in combination with hydrogen treatment can therefore serve as a proxy for pre-eruptive H2O contents, which we anticipate becoming a useful method applicable to mafic rocks where pyroxene is the main phenocryst phase.
Goud, J.; Gulden, G.
2009-01-01
After revision of the Glycymerididae in the collection of the National Museum of Natural history, a new species, Glycymeris vanhengstumi is described here. It occurs off the coast of Madeira, the Selvagens and the Canary Islands.
Hansson, Bengt; Ljungqvist, Marcus; Illera, Juan-Carlos; Kvist, Laura
2014-01-01
Evolutionary molecular studies of island radiations may lead to insights in the role of vicariance, founder events, population size and drift in the processes of population differentiation. We evaluate the degree of population genetic differentiation and fixation of the Canary Islands blue tit subspecies complex using microsatellite markers and aim to get insights in the population history using coalescence based methods. The Canary Island populations were strongly genetically differentiated and had reduced diversity with pronounced fixation including many private alleles. In population structure models, the relationship between the central island populations (La Gomera, Tenerife and Gran Canaria) and El Hierro was difficult to disentangle whereas the two European populations showed consistent clustering, the two eastern islands (Fuerteventura and Lanzarote) and Morocco weak clustering, and La Palma a consistent unique lineage. Coalescence based models suggested that the European mainland forms an outgroup to the Afrocanarian population, a split between the western island group (La Palma and El Hierro) and the central island group, and recent splits between the three central islands, and between the two eastern islands and Morocco, respectively. It is clear that strong genetic drift and low level of concurrent gene flow among populations have shaped complex allelic patterns of fixation and skewed frequencies over the archipelago. However, understanding the population history remains challenging; in particular, the pattern of extreme divergence with low genetic diversity and yet unique genetic material in the Canary Island system requires an explanation. A potential scenario is population contractions of a historically large and genetically variable Afrocanarian population, with vicariance and drift following in the wake. The suggestion from sequence-based analyses of a Pleistocene extinction of a substantial part of North Africa and a Pleistocene/Holocene eastward
Directory of Open Access Journals (Sweden)
Bengt Hansson
Full Text Available Evolutionary molecular studies of island radiations may lead to insights in the role of vicariance, founder events, population size and drift in the processes of population differentiation. We evaluate the degree of population genetic differentiation and fixation of the Canary Islands blue tit subspecies complex using microsatellite markers and aim to get insights in the population history using coalescence based methods. The Canary Island populations were strongly genetically differentiated and had reduced diversity with pronounced fixation including many private alleles. In population structure models, the relationship between the central island populations (La Gomera, Tenerife and Gran Canaria and El Hierro was difficult to disentangle whereas the two European populations showed consistent clustering, the two eastern islands (Fuerteventura and Lanzarote and Morocco weak clustering, and La Palma a consistent unique lineage. Coalescence based models suggested that the European mainland forms an outgroup to the Afrocanarian population, a split between the western island group (La Palma and El Hierro and the central island group, and recent splits between the three central islands, and between the two eastern islands and Morocco, respectively. It is clear that strong genetic drift and low level of concurrent gene flow among populations have shaped complex allelic patterns of fixation and skewed frequencies over the archipelago. However, understanding the population history remains challenging; in particular, the pattern of extreme divergence with low genetic diversity and yet unique genetic material in the Canary Island system requires an explanation. A potential scenario is population contractions of a historically large and genetically variable Afrocanarian population, with vicariance and drift following in the wake. The suggestion from sequence-based analyses of a Pleistocene extinction of a substantial part of North Africa and a Pleistocene
Directory of Open Access Journals (Sweden)
Hyo Jae Yu
2016-06-01
Full Text Available Abstract The osteological development in Sebastes koreanus is described and illustrated on the basis of 32 larvae [6.11–11.10 mm body length (BL] and a single juvenile (18.60 mm BL collected from the Yellow Sea. The first-ossified skeletal elements, which are related to feeding, swimming, and respiration, appear in larvae of 6.27 mm BL; these include the jaw bones, palatine, opercular, hyoid arch, and pectoral girdle. All skeletal elements are fully ossified in the juvenile observed in the study. Ossification of the neurocranium started in the frontal, pterotic, and parietal regions at 6.27 mm BL, and then in the parasphenoid and basioccipital regions at 8.17 mm BL. The vertebrae had started to ossify at ~7.17 mm BL, and their ossification was nearly complete at 11.10 mm BL. In the juvenile, although ossification of the pectoral girdle was fully complete, the fusion of the scapula and uppermost radial had not yet occurred. Thus, the scapula and uppermost radial fuse during or after the juvenile stage. The five hypurals in the caudal skeleton were also fused to form three hypural elements. The osteological results are discussed from a functional viewpoint and in terms of the comparative osteological development in related species.
Husemann, Martin; Deppermann, Jana; Hochkirch, Axel
2014-12-01
Volcanic archipelagos represent ideal systems to study processes of colonization, differentiation and speciation. The Canary Islands are one of the best studied archipelagos, being composed of seven main islands with a well-known geological history. Most taxa have colonized these islands stepwise from the African or Iberian mainland from east to west, following their geological origin as well as the predominating wind direction and ocean currents. Furthermore, within-island radiations have been reported for several taxa. The grasshopper genus Sphingonotus is species-rich and occurs with nine fully winged species on the Canary Islands, seven of which are endemic to single or few islands. We inferred a phylogeny of these species and their North African and Iberian relatives based upon sequences of three mitochondrial genes and one nuclear gene of 136 specimens. Surprisingly, our results suggest that almost all Sphingonotus species colonized the archipelago independently from the mainland and nearly no inter-island colonization occurred. Despite their strong flight capabilities, only one pair of endemic species are closely related (S. sublaevis from Gran Canary and S. pachecoi from Lanzarote). Moreover, no within-island speciation events were detected. We hypothesize that passive wind dispersal from the African mainland was the main driver of the colonization process and that most Sphingonotus species are not able to cover inter-island distances by active flight. This, together with strong intrageneric niche overlap might explain the lack of within-island speciation in this taxon. Copyright © 2014 Elsevier Inc. All rights reserved.
CO2 - The Canary in the Energy Efficiency Coal Mine
Somssich, Peter
2011-04-01
While much of the discussion surrounding CO2 is focused on its role as a GHG (green house gas) and its affect on Climate Change, CO2 can also be viewed as an indicator for reductions in fossil fuel use and increased energy efficiency. Much as the canary in a mine was used to warn miners of unsafe health conditions in a mine, CO2 can be seen as allowing us to effectively track progress towards energy efficiency and sustainability. Such an effort can best be achieved by either a Carbon Tax or a Cap and Trade system which was highly effective as part of the 1992 Clean Air Act, contributing to a significant reduction of SO2 and acid rain. A similar attempt has been made using the 1997 Kyoto Protocol to reduce carbon emissions. The mechanisms of how this treaty was intended to work will be explained, and examples will be given, both in the USA and Europe, of how the protocol was used to reduce energy consumption and energy dependence, while also reducing CO2 emissions. Regardless of how strong an impact CO2 reduction may have for Climate Change issues, a reduction of CO2 is guaranteed to produce energy benefits, monetary benefits and can even enhance national security. For all of these reasons, we need the CO2 canary.
Long-term volcanic hazard assessment on El Hierro (Canary Islands)
Becerril, L.; Bartolini, S.; Sobradelo, R.; Martí, J.; Morales, J. M.; Galindo, I.
2014-07-01
Long-term hazard assessment, one of the bastions of risk-mitigation programs, is required for land-use planning and for developing emergency plans. To ensure quality and representative results, long-term volcanic hazard assessment requires several sequential steps to be completed, which include the compilation of geological and volcanological information, the characterisation of past eruptions, spatial and temporal probabilistic studies, and the simulation of different eruptive scenarios. Despite being a densely populated active volcanic region that receives millions of visitors per year, no systematic hazard assessment has ever been conducted on the Canary Islands. In this paper we focus our attention on El Hierro, the youngest of the Canary Islands and the most recently affected by an eruption. We analyse the past eruptive activity to determine the spatial and temporal probability, and likely style of a future eruption on the island, i.e. the where, when and how. By studying the past eruptive behaviour of the island and assuming that future eruptive patterns will be similar, we aim to identify the most likely volcanic scenarios and corresponding hazards, which include lava flows, pyroclastic fallout and pyroclastic density currents (PDCs). Finally, we estimate their probability of occurrence. The end result, through the combination of the most probable scenarios (lava flows, pyroclastic density currents and ashfall), is the first qualitative integrated volcanic hazard map of the island.
Directory of Open Access Journals (Sweden)
R. Otto
2016-07-01
Full Text Available Many years of field work in La Palma (western Canary Islands yielded a number of interesting new records of non-native vascular plants. Amaranthus blitoides, A. deflexus, Aptenia cordifolia, Argemone ochroleuca, Begonia schmidtiana, Capsella rubella, Cardamine hamiltonii, Centratherum punctatum, Cerastium fontanum subsp. vulgare, Chasmanthe floribunda (widely confused with C. aethiopica and Crocosmia xcrocosmiiflora in Macaronesia, Chenopodium probstii, Commelina latifolia var. latifolia, Dichondra micrantha, Dysphania anthelmintica, Epilobium ciliatum, Erigeron sumatrensis, Erodium neuradifolium, Eucalyptus globulus, Euphorbia hypericifolia, E. maculata, Gamochaeta antillana, Geranium pyrenaicum, Hedychium coronarium, Hypochaeris radicata, Kalanchoe daigremontiana, K. delagoensis, K. xhoughtonii, Kickxia commutata subsp. graeca, K. spuria subsp. integrifolia, Lactuca viminea subsp. ramosissima, Landoltia punctata, Malvastrum coromandelianum subsp. capitatospicatum, Oenothera jamesii, Orobanche nana, Oxalis latifolia, Papaver hybridum, P. setigerum, Pilea microphylla, Podranea ricasoliana, Polygonum arenastrum, Portulaca granulatostellulata, P. nicaraguensis, P. nitida, P. papillatostellulata, Rumex crispus subsp. crispus, R. pulcher subsp. pulcher, R. xpratensis, Sechium edule, Sida spinosa var. angustifolia, Silene nocturna, Solanum abutiloides, S. alatum, S. decipiens, Sonchus tenerrimus, Spergularia marina, Stellaria pallida, Tragopogon porrifolius subsp. australis, Tribulus terrestris and Trifolium repens subsp. repens are naturalized or (potentially invasive xenophytes, reported for the first time from either the Canary Islands or from La Palma. 37 additional, presumably ephemeral taxa are reported for the first time from the Canary Islands, whereas 56 ephemeral taxa are new for La Palma..
Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands
Directory of Open Access Journals (Sweden)
Morales-Mateos, J. B.
2012-12-01
Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.
Dicty_cDB: Contig-U04940-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available iscoideum chromosome 2 map 3622643... 32 0.081 12 ( GE806545 ) EST_scau_evk_971547 scauevk mixed_tissue Sebaste...s... 40 0.092 2 ( EW978238 ) EST_sras_evg_777463 srasevg mixed_tissue Sebastes... 40 0.093 2 ( EW984986 )... EST_sras_evg_777879 srasevg mixed_tissue Sebastes... 40 0.095 2 ( EW985351 ) EST..._sras_evg_778065 srasevg mixed_tissue Sebastes... 40 0.096 2 ( AC116305 ) Dictyostelium discoideum chromosom
Groot, de R.A.
1980-01-01
INTRODUCTION AND MATERIAL The boring sponges of the Canary Islands have never been studied in any detail, but the boring fauna of this archipelago cannot be expected to be very rich. All islands are volcanic and calcareous rocks are not common. Consequently, in most areas large shells and rhodophyte
Melt evolution beneath thick lithosphere: A magmatic inclusions study of La Palma, Canary Islands
Nikogosian, I.; Elliott, T.R.; Touret, J.L.R.
2002-01-01
Volcanism in the Canary Islands is notable for its highly alkalic character even in the shield building lavas of the currently most active island, La Palma. In order to understand better the processes responsible for this alkalic end of the compositional spectrum of ocean island basalts (OIB), we
Volcanic hazard assessment for the Canary Islands (Spain using extreme value theory
Directory of Open Access Journals (Sweden)
R. Sobradelo
2011-10-01
Full Text Available The Canary Islands are an active volcanic region densely populated and visited by several millions of tourists every year. Nearly twenty eruptions have been reported through written chronicles in the last 600 yr, suggesting that the probability of a new eruption in the near future is far from zero. This shows the importance of assessing and monitoring the volcanic hazard of the region in order to reduce and manage its potential volcanic risk, and ultimately contribute to the design of appropriate preparedness plans. Hence, the probabilistic analysis of the volcanic eruption time series for the Canary Islands is an essential step for the assessment of volcanic hazard and risk in the area. Such a series describes complex processes involving different types of eruptions over different time scales. Here we propose a statistical method for calculating the probabilities of future eruptions which is most appropriate given the nature of the documented historical eruptive data. We first characterize the eruptions by their magnitudes, and then carry out a preliminary analysis of the data to establish the requirements for the statistical method. Past studies in eruptive time series used conventional statistics and treated the series as an homogeneous process. In this paper, we will use a method that accounts for the time-dependence of the series and includes rare or extreme events, in the form of few data of large eruptions, since these data require special methods of analysis. Hence, we will use a statistical method from extreme value theory. In particular, we will apply a non-homogeneous Poisson process to the historical eruptive data of the Canary Islands to estimate the probability of having at least one volcanic event of a magnitude greater than one in the upcoming years. This is done in three steps: First, we analyze the historical eruptive series to assess independence and homogeneity of the process. Second, we perform a Weibull analysis of the
Improving GNSS time series for volcano monitoring: application to Canary Islands (Spain)
García-Cañada, Laura; Sevilla, Miguel J.; Pereda de Pablo, Jorge; Domínguez Cerdeña, Itahiza
2017-04-01
The number of permanent GNSS stations has increased significantly in recent years for different geodetic applications such as volcano monitoring, which require a high precision. Recently we have started to have coordinates time series long enough so that we can apply different analysis and filters that allow us to improve the GNSS coordinates results. Following this idea we have processed data from GNSS permanent stations used by the Spanish Instituto Geográfico Nacional (IGN) for volcano monitoring in Canary Islands to obtained time series by double difference processing method with Bernese v5.0 for the period 2007-2014. We have identified the characteristics of these time series and obtained models to estimate velocities with greater accuracy and more realistic uncertainties. In order to improve the results we have used two kinds of filters to improve the time series. The first, a spatial filter, has been computed using the series of residuals of all stations in the Canary Islands without an anomalous behaviour after removing a linear trend. This allows us to apply this filter to all sets of coordinates of the permanent stations reducing their dispersion. The second filter takes account of the temporal correlation in the coordinate time series for each station individually. A research about the evolution of the velocity depending on the series length has been carried out and it has demonstrated the need for using time series of at least four years. Therefore, in those stations with more than four years of data, we calculated the velocity and the characteristic parameters in order to have time series of residuals. This methodology has been applied to the GNSS data network in El Hierro (Canary Islands) during the 2011-2012 eruption and the subsequent magmatic intrusions (2012-2014). The results show that in the new series it is easier to detect anomalous behaviours in the coordinates, so they are most useful to detect crustal deformations in volcano monitoring.
Muhs, Daniel R.; Meco, Joaquín; Simmons, Kathleen R.
2014-01-01
We present the first U-series ages of corals from emergent marine deposits on the Canary Islands. Deposits at + 20 m are 481 ± 39 ka, possibly correlative to marine isotope stage (or MIS) 11, while those at + 12 and + 8 m are 120.5 ± 0.8 ka and 130.2 ± 0.8 ka, respectively, correlative to MIS 5.5. The age, elevations, and uplift rates derived from MIS 5.5 deposits on the Canary Islands allow calculations of hypothetical palaeo-sea levels during the MIS 11 high sea stand. Estimates indicate that the MIS 11 high sea stand likely was at least + 9 m (relative to present sea level) and could have been as high as + 24 m. The most conservative estimates of palaeo-sea level during MIS 11 would require an ice mass loss equivalent to all of the modern Greenland and West Antarctic ice sheets; the more extreme estimates would require additional ice mass loss from the East Antarctic ice sheet. Extralimital southern species of mollusks, found in both MIS 11 and MIS 5.5 deposits on the Canary Islands, imply warmer-than-modern sea surface temperatures during at least a part of MIS 11 and much warmer sea surface temperatures during at least a part of MIS 5.5. Both MIS 11 and MIS 5.5 marine deposits on the Canary Islands contain extralimital northern species of mollusks as well, indicating cooler-than-present waters at times during these interglacial periods. We hypothesize that the co-occurrence of extralimital southern and northern species of marine invertebrates in the fossil record of the Canary Islands reflects its geographic location with respect to major synoptic-scale controls on climate and ocean currents. Previous interglacials may have been characterized by early, insolation-forced warming, along with northward migration of the intertropical convergence zone (ITCZ), accompanied by weakened trade winds and diminished upwelling. This allowed the arrival of extralimital southern taxa from the tropical Senegalese faunal province. During later parts of the MIS 11 and 5
MIO-PLIOCENE CRUSTACEANS FROM THE CANARY ISLANDS, SPAIN
Directory of Open Access Journals (Sweden)
JUAN FRANCISCO BETANCORT
2014-11-01
Full Text Available There are few previous references to fossil crustaceans for the Neogene marine layers of the Canary Islands (Spain. The Mio-Pliocene marine sedimentary layers in the eastern islands (Gran Canaria, Fuerteventura and Lanzarote were previously characterised by the presence of numerous fossil fauna, mainly anthozoans and molluscs, which correspond to an equatorial-typepalaeoclimate, warmer than the present climate. This Mio-Pliocene transition dated between 9.3 and 4.1 Ma. In this paper, 12 fossil crustacean taxa are identified and classified, including decapods and barnacles: Balanus concavus Bronn, 1831, Balanus spongicola Brown, 1827, Balanus perforatus Bruguière, 1789, Chenolobia testudinaria Linnè, 1767, Tetraclita cf. rubescens Darwin, 1854, Callianassa matsoni Rathbun, 1935, Callianassa sp., Upogebia sp, Eriphia aff. verrucosa (Forskal, 1775 , Maja sp., Scylla michelini Milne-Edwards, 1861 and Ocypode sp. Some of these taxa mean new references for the Atlantic islands and the North African Atlantic and definitely enlarge the palaeographic distribution of Neogene crustaceans beyond the Mediterranean region, extending it to the North Atlantic. Particularly significant are the presence of Tetraclita cf. rubescens ,this being the first reported fossil occurrence of this barnacle outside the North America Pacific coasts, and Chenolobia testudinaria , indicating for the first time the existence of marine turtles in these islands during the Neogene. These results are coherent with previous research hypothesising the existence of a flow of surface water between the Pacific and Atlantic in the Mio-Pliocene transition (Central American Seaway, CAS which explains the arrival of organisms, in larval stage, from Central America to the Canary Islands.
Fish larvae from the Canary region in autumn
Directory of Open Access Journals (Sweden)
J. M. Rodríguez
2000-03-01
Full Text Available In this paper, the taxonomic composition of the fish larvae community in the Canary region in autumn 1991 is presented. In total, 8699 larvae belonging to 58 fish families were studied. 176 taxonomic groups were identified, 149 at species level and the rest were identified at a higher level. The most numerous family and the one that presented the greatest number of species was Myctophidae. The most frequently caught species was Cyclothone braueri. The taxonomic composition (at family level of the fish larvae community, dominated by four mesopelagic families, was typical of oceanic regions of warm waters. The most remarkable feature of the fish larvae community was its high specific diversity.
Abreu-Yanes, Estefania; Martin-Alonso, Aaron; Martin-Carrillo, Natalia; Livia, Katherine Garcia; Marrero-Gagliardi, Alessandro; Valladares, Basilio; Feliu, Carlos; Foronda, Pilar
2018-01-01
Bartonella genus is comprised of several species of zoonotic relevance and rodents are reservoirs for some of these Bartonella species. As there were no data about the range of Bartonella species circulating among rodents in the Canary Islands, our main aim was to overcome this lack of knowledge by targeting both the citrate synthase (gltA) and the RNA polymerase beta subunit (rpoB) genes. A total of 181 small mammals and 154 ectoparasites were obtained in three of the Canary Islands, namely Tenerife, La Palma, and Lanzarote. The overall prevalence of Bartonella DNA in rodents was 18.8%, whereas the prevalence in ectoparasites was 13.6%. Bartonella sequences closely related to the zoonotic species Bartonella elizabethae, Bartonella tribocorum, and Bartonella rochalimae were identified in rodents, whereas two different gltA haplotypes similar to B. elizabethae were also detected in fleas. Furthermore, Bartonella queenslandensis DNA was also identified in rodents. A strong host specificity was observed, since B. elizabethae DNA was only found in Mus musculus domesticus, whereas gltA and rpoB sequences closely related to the rest of Bartonella species were only identified in Rattus rattus, which is probably due to the host specificity of the arthropod species that act as vectors in these islands. Our results indicate that humans may contract Bartonella infection by contact with rodents in the Canary Islands.
International Nuclear Information System (INIS)
Love, M.S.; Westphal, W.
1990-01-01
Since 1958, 29 oil platforms have been sited in the southern California Bight of which 28 still remain in place. However, little is known of the fish populations surrounding these structures, particularly those sited in water deeper than 30 m. In the course of research on the Santa Barbara, California, party vessel sport fishery, it was noted that the platforms off Santa Barbara supported considerable sportfishing activity. Those platforms, located to the southeast of Santa Barbara in depths of 48-62 m, were particularly important and were fished intensively for various rockfishes (genus Sebastes). When fishing a platform, the vessel pulled up to within 5-10 m of a platform and drifts along one side, with the vessel operator using intermittent power to keep it near the structure. Most of the desirable species, particularly rockfishes, remained close to the platforms, rarely venturing more than perhaps 20 m from the structure. The party vessels also spent considerable time fishing over nearby natural reefs. In this survey, it was noted that there appeared to be differences in species catch composition and fish size between oil platforms and these natural reefs. Increased offshore oil drilling off California has raised interest in the role platforms play in marine systems. Questions have been raised regarding what fish live around platforms, how these structures influence populations over surrounding reefs, and whether the platforms act as fish enhancers (promoting recruitment) or only as aggregators. These questions are particularly relevant when the platforms are to be decommissioned and the possibility of allowing them to remain as artificial reefs is raised. This paper describes the results of the study on the fish populations around oil platforms and nearby natural reefs off Santa Barbara
Dicty_cDB: Contig-U04780-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Ancylostoma ceylanicum L3 Ancylostoma ... 44 6.7 1 ( GE813038 ) EST_scau_evk_974138 scauevk mixed_tissue Sebaste...s... 44 6.7 1 ( GE802768 ) EST_scau_evk_897256 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE802767 ) ES...T_scau_evk_896872 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE800881 ) EST_scau..._evk_891797 scauevk mixed_tissue Sebastes... 44 6.7 1 ( FD779328 ) NADG-aaa04h04.g1 Rhodnius_prolixus_EST_NA
"You Can't Go Home, Yankee:" Teaching U.S. History to Canary Islands Students
Cruz, Juan Jose
2002-01-01
In this article, the author shares his experience and the challenges he faced in teaching an inclusive American history to Canary Islands students. The author teaches two undergraduate courses related to the U.S., plus a graduate course in American culture and political liberalism. Presently, eleven credits (two semester courses) serve as the…
Beaudry, P.; Longpre, M. A.; Wing, B. A.; Bui, T. H.; Stix, J.
2017-12-01
The Earth's mantle contains distinct sulfur reservoirs, which can be probed by sulfur isotope analyses of volcanic rocks and gases. We analyzed the isotopic composition of reduced and oxidized sulfur in a diverse range of volcanically derived materials spanning historical volcanism in the Canary Islands. Our sample set consists of subaerial volcanic tephras from three different islands, mantle and sedimentary xenoliths, as well as lava balloon samples from the 2011-2012 submarine El Hierro eruption and associated crystal separates. This large sample set allows us to differentiate between the various processes responsible for sulfur isotope heterogeneity in the Canary archipelago. Our results define an array in triple S isotope space between the compositions of the MORB and seawater sulfate reservoirs. Specifically, the sulfide values are remarkably homogeneous around d34S = -1 ‰ and D33S = -0.01 ‰, while sulfate values peak at d34S = +4 ‰ and D33S = +0.01 ‰. Lava balloons from the El Hierro eruption have highly enriched sulfate d34S values up to +19.3 ‰, reflecting direct interaction between seawater sulfate and the erupting magma. Several sulfate data points from the island of Lanzarote also trend towards more positive d34S up to +13.8 ‰, suggesting interaction with seawater sulfate-enriched lithologies or infiltration of seawater within the magmatic system. On the other hand, the modal values and relative abundances of S2- and S6+ in crystal separates suggest that the Canary Island mantle source has a d34S around +3 ‰, similar to the S-isotopic composition of a peridotite xenolith from Lanzarote. We infer that the S2- and S6+ modes reflect isotopic equilibrium between those species in the magmatic source, which requires 80 % of the sulfide to become oxidized after melting, consistent with measured S speciation. This 34S enrichment of the source could be due to the recycling of hydrothermally-altered oceanic crust, which has been previously suggested
Geldmacher, J.; Hoernle, K.; Bogaard, P. v. d.; Duggen, S.; Werner, R.
2005-08-01
The role of mantle plumes in the formation of intraplate volcanic islands and seamount chains is being increasingly questioned. Particular examples are the abundant and somewhat irregularly distributed island and seamount volcanoes off the coast of northwest Africa. New 40Ar / 39Ar ages and Sr-Nd-Pb isotope geochemistry of volcanic rocks from seamounts northeast of the Madeira Islands (Seine and Unicorn) and northeast of the Canary Islands (Dacia and Anika), however, provide support for the plume hypothesis. The oldest ages of shield stage volcanism from Canary and Madeira volcanic provinces confirm progressions of increasing age to the northeast. Average volcanic age progression of ∼1.2 cm/a is consistent with rotation of the African plate at an angular velocity of ∼0.20° ± 0.05 /Ma around a common Euler pole at approximately 56° N, 45° W computed for the period of 0-35 Ma. A Euler pole at 35° N, 45° W is calculated for the time interval of 35-64 Ma. The isotope geochemistry further confirms that the Madeira and Canary provinces are derived from different sources, consistent with distinct plumes having formed each volcanic group. Conventional hotspot models, however, cannot easily explain the up to 40 m.y. long volcanic history at single volcanic centers, long gaps in volcanic activity, and the irregular distribution of islands and seamounts in the Canary province. A possible explanation could involve interaction of the Canary mantle plume with small-scale upper mantle processes such as edge-driven convection. Juxtaposition of plume and non-plume volcanism could also account for observed inconsistencies of the classical hotspot concept in other volcanic areas.
The genus Alvania on the Canary islands and Madeira (Mollusca: Gastropoda), part 2 [final part
Moolenbeek, R.G.; Hoenselaar, H.J.
1998-01-01
Five Alvania species from the Canary Islands and the Madeira Archipelago are revised. A new species to science, A. johannae is described and for three species lectotypes are designated. Altogether 13 littoral alvaniids are presently known from this area. Doubtful records are enumerated and a list of
Halle, F; Gahr, M.; Kreutzer, M.
2003-01-01
Particular features of the song of adult male canaries such as a large syllable repertoire resulting in a great diversity of song phrases and special so-called 'complex' syllables enhance various features of female reproductive behaviour. These features are produced in a species or strain dependent
Directory of Open Access Journals (Sweden)
Leví García-Romero
2016-05-01
Full Text Available Aeolian sedimentary systems in the Canary Islands differ significantly from other European and African systems due to their natural characteristics (climate, vegetation and insular isolation. Consequently, their geomorphological processes are unique. In turn, they are areas under high human pressure from touristic development. The aim of this paper is to analyze the impacts of urban-touristic development in four aeolian sedimentary systems in the Canaries: Maspalomas, Corralejo, Lambra and Jable Sur. Spatial and surface changes of variables related to geomorphology and vegetation are obtained by photo-interpretation of historical aerial photography and current orthophotos. The results indicate that the systems affected by urban-touristic development have experienced significant environmental changes. In contrast, the systems that have not been affected by building and construction of infrastructure show minor changes.
Wildlife-vehicle collisions in Lanzarote Biosphere Reserve, Canary Islands.
Tejera, Gustavo; Rodríguez, Beneharo; Armas, Carlos; Rodríguez, Airam
2018-01-01
Insular wildlife is more prone to extinction than their mainland relatives. Thus, a basic understanding of non-natural mortality sources is the first step in the development of conservation management plans. The Canary Islands are an important tourist destination due to their unique climate and rich scenery and biodiversity. During the last few decades, there has been significant development of urban areas and busy road networks. However, there have been no studies describing the effects of road mortality on wildlife in this archipelago. We describe the temporal and spatial patterns of wildlife roadkill in Lanzarote (UNESCO Biosphere Reserve), using counts from cars for an entire annual cycle. A total of 666 roadkills were recorded (monthly average of 0.09 birds/km and 0.14 mammals/km) comprising at least 37 species including native birds and introduced mammals. Seasonal abundance, richness and diversity of roadkills showed a high peak during summer months for both mammals and birds. GLMs indicated that accidents (including birds and mammals) have a higher probability of occurrence close to houses and on roads with high speed limits. When analysed separately, mammal kills occurred in sectors with high speed limits, close to houses and in areas surrounded by exotic bushes, while bird roadkills appeared in road sectors with high speed limits, close to houses and low traffic volume. Our findings highlight that roads are a potential threat to native birds in the eastern Canary Islands. Detailed studies on the local population dynamics of highly affected species, such as the Houbara Bustard, Eurasian Stone Curlew, Barn Owl or Southern Shrike, are urgently needed to determine whether these levels of road mortality are sustainable.
Phytoseiid mites of the Canary Islands (Acari, Phytoseiidae. II. Tenerife and La Gomera Islands
Directory of Open Access Journals (Sweden)
Ferragut, F.
2007-12-01
Full Text Available Phytoseiid mites (Acari, Phytoseiidae inhabiting plants in natural ecosystems from Tenerife and La Gomera islands (Canary Islands have been studied. Surveys were conducted from 1997 to 2002. Eleven species were collected, one of them being reported for the first time from the Canary Islands and six of them reported for the first time from Tenerife and La Gomera islands. Euseius machadoi n. sp. collected from woody plants in the Canarian laurisilva is proposed as a new species.
En muestreos realizados desde 1997 hasta 2002 se ha estudiado la fauna de ácaros fitoseidos (Acari, Phytoseiidae asociada a plantas de ecosistemas naturales de las islas de Tenerife y La Gomera (Islas Canarias. Se han recolectado un total de 11 especies, siendo una de ellas citada por vez primera en las islas Canarias y seis de ellas citadas por primera vez en las islas de Tenerife y La Gomera. Euseius machadoi n. sp., recolectado en plantas leñosas de la laurisilva canaria, se propone como una nueva especie.
Tang, Qisheng; Guo, Xuewu; Sun, Yao; Zhang, Bo
2007-09-01
The ecological conversion efficiencies in twelve species of fish in the Yellow Sea Ecosystem, i.e., anchovy ( Engraulis japonicus), rednose anchovy ( Thrissa kammalensis), chub mackerel ( Scomber japonicus), halfbeak ( Hyporhamphus sajori), gizzard shad ( Konosirus punctatus), sand lance ( Ammodytes personatus), red seabream ( Pagrus major), black porgy ( Acanthopagrus schlegeli), black rockfish ( Sebastes schlegeli), finespot goby ( Chaeturichthys stigmatias), tiger puffer ( Takifugu rubripes), and fat greenling ( Hexagrammos otakii), were estimated through experiments conducted either in situ or in a laboratory. The ecological conversion efficiencies were significantly different among these species. As indicated, the food conversion efficiencies and the energy conversion efficiencies varied from 12.9% to 42.1% and from 12.7% to 43.0%, respectively. Water temperature and ration level are the main factors influencing the ecological conversion efficiencies of marine fish. The higher conversion efficiency of a given species in a natural ecosystem is acquired only under the moderate environment conditions. A negative relationship between ecological conversion efficiency and trophic level among ten species was observed. Such a relationship indicates that the ecological efficiency in the upper trophic levels would increase after fishing down marine food web in the Yellow Sea ecosystem.
Methane emission to the atmosphere from landfills in the Canary Islands
Hernández, Pedro A.; Asensio-Ramos, María; Rodríguez, Fátima; Alonso, Mar; García-Merino, Marta; Amonte, Cecilia; Melián, Gladys V.; Barrancos, José; Rodríguez-Delgado, Miguel A.; Hernández-Abad, Marta; Pérez, Erica; Alonso, Monica; Tassi, Franco; Raco, Brunella; Pérez, Nemesio M.
2017-04-01
Methane (CH4) is one of the most powerful greenhouse gases, and is increasing in the atmosphere by 0.6% each year (Intergovernmental Panel on Climate Change, IPCC, 2013). This gas is produced in landfills in large quantities following the anaerobic degradation of organic matter. The IPCC has estimated that more than 10% of the total anthropogenic emissions of CH4 are originated in landfills. Even after years of being no operative (closed), a significant amount of landfill gas could be released to the atmosphere through its surface as diffuse or fugitive degassing. Many landfills currently report their CH4 emissions to the atmosphere using model-based methods, which are based on the rate of production of CH4, the oxidation rate of CH4 and the amount of CH4 recovered (Bingemer and Crutzen, 1987). This approach often involves large uncertainties due to inaccuracies of input data and many assumptions in the estimation. In fact, the estimated CH4 emissions from landfills in the Canary Islands published by the Spanish National Emission and Pollutant Sources Registration (PRTR-Spain) seem to be overestimated due to the use of protocols and analytical methodologies based on mathematical models. For this reason, direct measurements to estimate CH4 emissions in landfills are essential to reduce this uncertainty. In order to estimate the CH4 emissions to the atmosphere from landfills in the Canary Islands 23 surveys have been performed since 1999. Each survey implies hundreds of CO2and CH4 efflux measurements covering the landfill surface area. Surface landfill CO2 efflux measurements were carried out at each sampling site by means of a portable non-dispersive infrared spectrophotometer (NDIR) model LICOR Li800 following the accumulation chamber method. Samples of landfill gases were taken in the gas accumulated in the chamber and CO2 and CH4 were analyzed using a double channel VARIAN 4900 micro-GC. The CH4 efflux measurent was computed combining CO2 efflux and CH4/CO2 ratio
Teachers' Opinions of Student Dropout from Formal Music Education Centres of the Canary Islands
Lorenzo Socorro, Sonia; Escandell Bermúdez, María Olga; Castro Sánchez, José Juan
2016-01-01
One hundred and eighty-five teachers were surveyed to determine their opinion of student dropout from formal music centres in the Canary Islands. The goal of the study was to investigate the causes of dropout and strategies to prevent it. Teachers' opinions were collected by means of a questionnaire. The influence of the environment on the…
Shallow geothermal field in Lanzarote (Canary Island). Potential evaluation and heat extraction test
Energy Technology Data Exchange (ETDEWEB)
Diez-Gil, J.L.; Valentin, A. [Consejo Superior de Investigaciones Cientificas, Madrid (Spain); Torres, F. [Universidad de Barcelona (Spain); Albert, J.F.
1994-12-31
Boreholes were used to perform various experiments. A thermometry was carried out, as well as chemical analysis and an hydrodynamic modelling. This paper presents the scientific aims and conclusions of the whole project called ``Shallow H.D.R. geothermal field`` in Lanzarote (Canary Islands). Potential evaluation and heat extraction test are presented. (Project JOUG-0004 ES -JR - JOULE Program of the EEC). (TEC). 2 tabs.
Prevalence of chronic obstructive pulmonary disease in the Canary Islands.
Cabrera López, Carlos; Juliá Serdá, Gabriel; Cabrera Lacalzada, Cristina; Martín Medina, Ana; Gullón Blanco, José Antonio; García Bello, Miguel Ángel; Cabrera Navarro, Pedro
2014-07-01
The prevalence of chronic obstructive pulmonary disease (COPD) varies significantly among the different geographical areas reported. In Spain, two epidemiological studies have shown a prevalence of 9-10% in the population aged over 40. However, neither of these studies included the Canary Islands, which are of interest due to their climatic conditions and high incidence of smoking. A random group of 1,353 subjects aged between 40 and 70years was selected from a sample population of 596,478 individuals. Participants completed a questionnaire and then performed spirometry with bronchodilator testing if obstruction was observed. COPD was diagnosed when the post-bronchodilator FEV1/FVC ratio was less than 0.70. The prevalence of COPD was 7.3% (95%CI: 5.5-9.5) and was higher in males than in females (8.7% vs. 6.3%, P=.134). The incidence of smoking was 29.4% (95%CI: 25.4-33.1) and was also higher in males than in females (35.1% vs 25.4%, P<.001). The prevalence of COPD stratified by severity of obstruction, according to the GOLD criteria, was 16% in groupi, 69.9% in groupii, 10.4% in groupiii and 3.3% in groupiv. 71.6% of the subjects were underdiagnosed and 63.5% undertreated. Despite having one of the highest rates of smoking in Spain, the prevalence of COPD in the Canary Islands is lower than in most of the Spanish regions studied. Copyright © 2013 SEPAR. Published by Elsevier Espana. All rights reserved.
Mapping natural radioactivity of soils in the eastern Canary Islands.
Arnedo, M A; Rubiano, J G; Alonso, H; Tejera, A; González, A; González, J; Gil, J M; Rodríguez, R; Martel, P; Bolivar, J P
2017-01-01
The Canary Islands archipielago (Spain) comprises seven main volcanic islands and several islets that form a chain extending for around 500 km across the eastern Atlantic, between latitudes 27°N and 30°N, with its eastern edge only 100 km from the NW African coast. The administrative province of Las Palmas comprises the three eastern Canary Islands (Lanzarote, Fuerteventura and Gran Canaria). An extensive study of terrestrial gamma dose rates in surface soils has been carried out to cover the entire territory of the province (4093 km 2 ). The average outdoor gamma dose rate in air at 1 m above ground is 73 nGyh -1 at Gran Canaria, 32 nGyh -1 at Fuerteventura, and 25 nGyh -1 at Lanzarote. To complete the radiological characterization of this volcanic area, 350 soil samples at 0-5 cm depth were collected to cover all the geologic typologies of the islands. These samples were measured using high resolution gamma spectrometry to determine the activity concentrations of 226 Ra, 232 Th and 40 K. The average values obtained were 25.2 Bq/kg, 28.9 Bq/kg, and 384.4 Bq/kg, respectively. Maps of terrestrial gamma activity, effective dose, and activity concentrations of 226 Ra, 232 Th and 40 K for the region have been developed through the use of geostatistical interpolation techniques. These maps are in accord with the geology of the islands. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Olsson, Rolf (ed.) (and others)
2004-07-01
The Reed canary grass project has been performed by 13 partners 8 countries; Sweden, Finland, Germany, Denmark, England, Wales, Scotland and Ireland. The aim of the project has been to evaluate if new breeding lines of reed canary grass suits in different European agricultural areas and to evaluate if the new delayed harvesting method originally developed in Sweden can be used all over the northern parts of Europe. The other part of the project deals with developing a system for its combined processing to chemical pulp and biofuel powder. The scientific objectives are to develop the C3 plant reed canary grass to an economically and environmentally competitive industrial crop for combined production of high quality chemical pulp and bioenergy fuel powder. Main results obtained in the project can be summarised as follows: The screening trials with new breeding lines of reed canary grass have shown a large potential for getting higher yields and better quality in new industrial varieties of reed canary grass. The best breeding lines tested gave at average a yield 20 % higher than now existing forage varieties which all economic calculations are based on. The results show that the delayed harvesting method gives important quality improvements and can be used except in areas with maritime climate. The research on chemical pulping and paper making have been successfully developed in the project and the obtained results in laboratory and pilot scale made it also possible to increase the ambitions in the project and include research on mill scale in cooperation with industry. This gave also possibilities to develop technologies needed for the whole chain from production fields to long distance handling and transport technology of intermediate processed raw materials. Different cooking processes have been developed for reed canary grass and a new cooking method the soda-oxygen process has given extremely high pulp yields if combined with intermediate processed raw material
Geodetic Volcano Monitoring Research in Canary Islands: Recent Results
Fernandez, J.; Gonzalez, P. J.; Arjona, A.; Camacho, A. G.; Prieto, J. F.; Seco, A.; Tizzani, P.; Manzo, M. R.; Lanari, R.; Blanco, P.; Mallorqui, J. J.
2009-05-01
The Canarian Archipelago is an oceanic island volcanic chain with a long-standing history of volcanic activity (> 40 Ma). It is located off the NW coast of the African continent, lying over a transitional crust of the Atlantic African passive margin. At least 12 eruptions have been occurred on the islands of Lanzarote, Tenerife and La Palma in the last 500 years. Volcanism manifest predominantly as basaltic strombolian monogenetic activity (whole archipelago) and central felsic volcanism (active only in Tenerife Island). We concentrate our studies in the two most active islands, Tenerife and La Palma. In these islands, we tested different methodologies of geodetic monitoring systems. We use a combination of ground- and space-based techniques. At Tenerife Island, a differential interferometric study was performed to detect areas of deformation. DInSAR detected two clear areas of deformation, using this results a survey-based GPS network was designed and optimized to control those deformations and the rest of the island. Finally, using SBAS DInSAR results weak spatial long- wavelength subsidence signals has been detected. At La Palma, the first DInSAR analysis have not shown any clear deformation, so a first time series analysis was performed detecting a clear subsidence signal at Teneguia volcano, as for Tenerife a GPS network was designed and optimized taking into account stable and deforming areas. After several years of activities, geodetic results served to study ground deformations caused by a wide variety of sources, such as changes in groundwater levels, volcanic activity, volcano-tectonics, gravitational loading, etc. These results proof that a combination of ground-based and space-based techniques is suitable tool for geodetic volcano monitoring in Canary Islands. Finally, we would like to strength that those results could have serious implications on the continuous geodetic monitoring system design and implementation for the Canary Islands which is under
Directory of Open Access Journals (Sweden)
Roxana - Andreea SARAGEA
2011-12-01
Full Text Available In the context of increased competition on the international tourism market, the assessment of destination image has become a research subject for both managers aiming to improve destination positioning and academic researchers. In order to obtain a competitive advantage, every tourist destination must identify, maintain and reinforce, through appropriate marketing policies, unique items that form and build over time "the destination' s image". Accordingly, the ultimate target of the tourist destinations' promoters should be to achieve a high level of coincidence between the promoted or projected image and the perceived image of the destination, held by potential and actual tourists. Therefore, the aim of this paper is to illustrate promotional techniques and methods used by the authorities of the Canary Islands over the years (projected image, and to identify, through a survey among the citizens of Braşov, the image that they have of the Canary Islands (perceived image.
Arrival of radionuclides released by the Fukushima accident to Tenerife (Canary Islands)
International Nuclear Information System (INIS)
López-Pérez, M.; Ramos-López, R.; Perestelo, Nayra R.; Duarte-Rodriguez, X.; Bustos, J.J.; Alonso-Pérez, S.; Cuevas, E.; Hernández-Armas, J.
2013-01-01
Two weeks after the accident at the Fukushima-Daichi nuclear power plant, 131I, 137Cs and 134Cs activities were measured in two different stations located in Tenerife (Canary Islands), situated at 300 (FIMERALL) and 2400 (IZAÑA) m.a.s.l, respectively. Peak measured activity concentrations were: 1.851 mBq/m3 (131I); 0.408 mBq/m3 (137Cs) and 0.382 mBq/m3 (134Cs). The activities measured at the FIMERALL station were always higher than at IZAÑA station, suggesting that the radioactive plume arrived to the island associated with low altitude air masses. Simulations of potential dispersion of the radioactive cloud (137Cs) after the nuclear accident in reactor Fukushima I show that radioactive pollution reached remote regions such as the Canary Islands in the Eastern subtropical North Atlantic. The corresponding effective dose to the local population was 1.17 nSv, a value less than one millionth of the annual limit for the general public. Therefore, there was no risk to public health. - Highlights: ► Arrival of radionuclides to Tenerife following the accident of Fukushima. ► The atmospheric concentration of radionuclides was always higher at low altitude. ► After reaching the peak concentration a sharp decrease of radionuclides was observed. ► Air mass forward trajectory analysis confirms the potential arrival of radionuclides to Tenerife.
Foronda, Pilar; Abreu-Acosta, Néstor; Casanova, Juan Carlos; Ribas, Alexis; Valladares, Basilio
2009-06-01
A new species of anoplocephalid cestode is described from Gallotia atlantica (Reptilia, Lacertidae) on the Canary Islands, Spain. Oochoristica feliui n. sp. belongs to the group of Oochoristica spp. having circular suckers and fewer than 25 testes in a single cluster: O. lygosomae Burt, 1933; O. lygosomatis Skinker, 1935; O. elongata Dupouy et Kechemir, 1973; O. jonnesi Bursey, McAllister and Freed, 1997; O. junkea Johri, 1950; O. macallisteri Bursey and Goldberg, 1996; O. novaezelandae Schmidt and Allison, 1985; O. parvogenitalis Dupouy and Kechemir, 1973; and O. sobolevi (Spasskii, 1948) Spaskii, 1951. Oochoristica feliui n. sp. differs from these species in a variety of characters such as the number of proglottids, size of the scolex and suckers, presence of a neck, size and shape of the ovary (divided into 5-6 lobules), ovoid shape of the vitelline gland, a spined cirrus, size of eggs, oncosphere and oncosphere hooks, and the presence of 2 osmoregulatory canals. Gallotia spp. are endemic to the Canary Islands. This is the first report of an adult cestode species in this lizard.
Directory of Open Access Journals (Sweden)
Sébastien Fournel
2015-07-01
Full Text Available Agricultural producers are interested in using biomass available on farms to substitute fossil fuels for heat production. However, energy crops like reed canary grass contain high nitrogen (N, sulfur (S, potassium (K and other ash-forming elements which lead to increased emissions of gases and particulate matter (PM and ash-related operational problems (e.g., melting during combustion. To address these problematic behaviors, reed canary grass was blended with wood (50 wt% and fuel additives (3 wt% such as aluminum silicates (sewage sludge, calcium (limestone and sulfur (lignosulfonate based additives. When burned in a top-feed pellet boiler (29 kW, the four blends resulted in a 17%–29% decrease of PM concentrations compared to pure reed canary grass probably because of a reduction of K release to flue gas. Nitrogen oxides (NOx and sulfur dioxide (SO2 emissions varied according to fuel N and S contents. This explains the lower NOx and SO2 levels obtained with wood based products and the higher SO2 generation with the grass/lignosulfonate blend. The proportion of clinkers found in combustion ash was greatly lessened (27%–98% with the use of additives, except for lignosulfonate. The positive effects of some additives may allow agricultural fuels to become viable alternatives.
Recent changes and drivers of the atmospheric evaporative demand in the Canary Islands
Vicente-Serrano, Sergio M.; Azorin-Molina, Cesar; Sanchez-Lorenzo, Arturo; El Kenawy, Ahmed; Martín-Hernández, Natalia; Peña-Gallardo, Marina; Beguería, Santiago; Tomas-Burguera, Miquel
2016-08-01
We analysed recent evolution and meteorological drivers of the atmospheric evaporative demand (AED) in the Canary Islands for the period 1961-2013. We employed long and high-quality time series of meteorological variables to analyse current AED changes in this region and found that AED has increased during the investigated period. Overall, the annual ETo, which was estimated by means of the FAO-56 Penman-Monteith equation, increased significantly by 18.2 mm decade-1 on average, with a stronger trend in summer (6.7 mm decade-1). In this study we analysed the contribution of (i) the aerodynamic (related to the water vapour that a parcel of air can store) and (ii) radiative (related to the available energy to evaporate a quantity of water) components to the decadal variability and trends of ETo. More than 90 % of the observed ETo variability at the seasonal and annual scales can be associated with the variability in the aerodynamic component. The variable that recorded more significant changes in the Canary Islands was relative humidity, and among the different meteorological factors used to calculate ETo, relative humidity was the main driver of the observed ETo trends. The observed trend could have negative consequences in a number of water-depending sectors if it continues in the future.
Exercise Tiger: assessing the BCM impact of the 2012 Olympics on Canary Wharf.
Evett, Jonathan
2011-02-01
In this paper, collective corporate resilience is studied to see how a culture of sharing information and planning may assist other business communities to prepare for future events. The London 2012 Summer Olympic Games will see huge opportunity for businesses in London, and across Europe, but not without cost. Canary Wharf lies in the heart of London's Docklands and less than three miles from the Olympic Park at Stratford. Purpose-built as a business district, it accommodates a working population of 95,000 people, is home to some of the world's leading brands and has a vibrant retail complex of over 200 shops, bars and restaurants. This business community is preparing for every aspect of the Olympics and, in particular, the disruption the Games will bring. As a private estate, the community resilience approach fostered here is both better defined and finite in terms of those it includes as a result. Preparing together with joint exercises, forums and open communications in a network of trusted partners is yielding collective benefits and lending a stronger voice in the call for more information from official agencies. This paper outlines the benefits of collective planning and reports on the success of Canary Wharf's annual estate-wide business continuity exercise - the first major collective Olympics planning exercise in London.
Directory of Open Access Journals (Sweden)
Maria Reyes-Batlle
2015-10-01
Full Text Available Background: Free-living amoebae (FLA are protozoa that are widely distributed in the environment mainly in water and soil related habitats. Thermophilic amoebae are among the most common FLA in water bodies, being Vermamoeba vermiformis one of the most common species reported worldwide from these sources. Interestingly, V. vermiformis has often been reported to survive at high temperatures and osmotic pressure worldwide.Materials and Methods: In this study, snow samples were collected from Mount Teide, Tenerife, Canary Islands during the winter season of 2014. The samples were culture on non nutrient agar plates and checked daily for the presence of FLA. After a week, V. vermiformis amoebae were observed in the plates incubated at room temperature and 37ºC.Results: Molecular characterization was carried out by amplifying the 18S rDNA gene and DNA sequencing, confirmed that the isolated strain belonged to Vermamoeba vermiformis species.Conclusion: To the best of our knowledge, this is the first report of Vermamoeba vermiformis isolation from such an inusual habitat (low temperatures and high altitude and the first report of these species in the Canary islands.
Dewfall measurements on Lanzarote, Canary Islands
Energy Technology Data Exchange (ETDEWEB)
Graf, A.; Kuttler, W. [Univ. of Duisburg-Essen, Inst. of Geography, Essen (Germany); Werner, J. [Univ. of Muenster, Inst. of Landscape Ecology, Muenster (Germany)
2004-10-01
At Lanzarote, Canary Islands, condensation is considered to play a significant role in the water budget of fields mulched with porous volcanic products (''Picon''). Here, 68 nights of gravimetric condensation measurements with mulched and bare surfaces, along with meteorological measurements were carried out. Results presented here indicate two major findings of interest with respect to general assumption: Firstly, nocturnal condensation on the mulch surface is lower than on a dry bare (loam) soil surface. A slightly higher nocturnal cooling of the mulched surface, and resulting higher dewfall in the strict sense, is overcompensated by the stronger hygroscopic properties of the soil. Secondly, dewfall, though otherwise consistent in magnitude and meteorological dependency with empirical and theoretical knowledge in literature, can still be observed at high wind speeds (u {approx} 10 m s{sup -1} at 10 m a.g.l.) in northern to north-eastern trade winds that carry moist air from the sea. Dewfall to the mulched surface was observed in 39 of the measurement nights with a mean nocturnal sum of 0.07 mm. (orig.)
Long-range order in canary song.
Markowitz, Jeffrey E; Ivie, Elizabeth; Kligler, Laura; Gardner, Timothy J
2013-01-01
Bird songs range in form from the simple notes of a Chipping Sparrow to the rich performance of the nightingale. Non-adjacent correlations can be found in the syntax of some birdsongs, indicating that the choice of what to sing next is determined not only by the current syllable, but also by previous syllables sung. Here we examine the song of the domesticated canary, a complex singer whose song consists of syllables, grouped into phrases that are arranged in flexible sequences. Phrases are defined by a fundamental time-scale that is independent of the underlying syllable duration. We show that the ordering of phrases is governed by long-range rules: the choice of what phrase to sing next in a given context depends on the history of the song, and for some syllables, highly specific rules produce correlations in song over timescales of up to ten seconds. The neural basis of these long-range correlations may provide insight into how complex behaviors are assembled from more elementary, stereotyped modules.
Clinical presentation of acute Q fever in lanzarote (Canary Islands): a 2-year prospective study.
Pascual Velasco, F; Borobio Enciso, M V; González Lama, Z; Carrascosa Porras, M
1996-01-01
The clinical manifestations of acute Q fever may differ markedly from country to country. In this regard, fever and hepatitis seem to be the dominant clinical features of acute Coxiella burnetii infection in Lanzarote, Canary Islands. A possible interaction between environmental factors and some strains of C. burnetii could explain the different clinical presentations of acute Q fever.
The Canary Basin contribution to 26ºN AMOC Seasonality
Pérez-Hernández, M. D.; McCarthy, G.; Smeed, D.; Hernandez-Guerra, A.; Vélez-Belchí, P.
2014-12-01
Recent studies have shown that the seasonal transport of the Atlantic Meridional Overturning Circulation (AMOC) is linked with seasonal density changes in the eastern boundary of the Atlantic. As measured by the RAPID/MOCHA array, the AMOC has a seasonal peak-to-peak value of 6 Sv, with two relative maximums in July and October. The relative maximum in October coincides with the weakest transport of the upper mid-ocean transport (UMO), from the Bahamas to the eastern boundary, whose amplitude is 4 Sv. The seasonally averaged dynamic height indicates that the major source of seasonal variability in the UMO is due to the eastern boundary in fall. Data from the RAPID/MOCHA array at 26ºN is analyzed together with the data from a 15-year mooring between the African coast and the Canary Islands at 28ºN, in the Lanzarote Passage, the so-called Eastern Boundary Current Mooring (EBC4). The seasonal dynamics of the eastern boundary is analyzed: the recirculation of the Canary Current in fall through the Lanzarote Passage, the Rossby wave formation and the wind forcing. Significant correlations are found between the transport through the LP and the UMO. The transport of the North Atlantic Central Water (NACW) as measured by the EBC4 mooring has a correlation of 0.75 at zero lag with the UMO transport, and the transport of the Antarctic Intermediate Water (AAIW) and Mediterranean Water (MW) are correlated 0.77/0.85 respectively, with a lag of one moth with the UMO. The results stress the importance of the eastern boundary in determining the seasonal variability of the AMOC, as measured by the RAPID/MOCHA array.
Czech Academy of Sciences Publication Activity Database
Šrůtek, Miroslav; Doležal, J.; Hara, T.
2002-01-01
Roč. 34, č. 2 (2002), s. 201-210 ISSN 1523-0430 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : Pinus canariensis * Canary Islands Subject RIV: EF - Botanics Impact factor: 0.964, year: 2002
Gypsum speleothems in lava tubes from Lanzarote, Canary Islands. Did you say gypsum?
Huerta, Pedro; Martín-García, Rebeca; Rodríguez-Berriguete, Álvaro; Iglesia, A. la; Martín-Pérez, Andrea; Alonso-Zarza, Ana María
2015-01-01
Lanzarote is the easternmost island of the volcanic Canary archipielago considered together with Fuerteventura the low relief islands of the archipielago. These island receive less rain than 300 mm/year. Basaltic lava flows preserves lava tubes formed during cooling and solidification of external parts of lava, while internal parts were still hot and flowing. When lava flow stopped the lava abandoned the tubes, and the tubes preserved empty. These tubes actuate as caves and som...
Dicty_cDB: Contig-U01585-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available mRNA, clone: ARN01A01NGRM0003_F0... 54 0.010 1 ( GE817509 ) EST_scau_evk_969928 scauevk mixed_tissue Sebaste...s... 54 0.010 1 ( GE798818 ) EST_scau_evk_889236 scauevk mixed_tissue Sebastes... 54 0.010 1 ( FK742846 ) av...Mus musculus NOD-derived CD11c +ve dendritic cell... 52 0.038 1 ( GE798817 ) EST_scau_evk_887700 scauevk mixed_tissue Sebaste
Negredo, A. M.; Rodríguez-González, J.; Fullea, J.; Van Hunen, J.
2017-12-01
The close location between many hotspots and the edges of cratonic lithosphere has led to the hypothesis that these hotspots could be explained by small-scale mantle convection at the edge of cratons (Edge Driven Convection, EDC). The Canary Volcanic Province hotspot represents a paradigmatic example of this situation due to its close location to the NW edge of the African Craton. Geochemical evidence, prominent low seismic velocity anomalies in the upper and lower mantle, and the rough NE-SW age-progression of volcanic centers consistently point out to a deep-seated mantle plume as the origin of the Canary Volcanic Province. It has been hypothesized that the plume material could be affected by upper mantle convection caused by the thermal contrast between thin oceanic lithosphere and thick (cold) African craton. Deflection of upwelling blobs due to convection currents would be responsible for the broader and more irregular pattern of volcanism in the Canary Province compared to the Madeira Province. In this study we design a model setup inspired on this scenario to investigate the consequences of possible interaction between ascending mantle plumes and EDC. The Finite Element code ASPECT is used to solve convection in a 2D box. The compositional field and melt fraction distribution are also computed. Free slip along all boundaries and constant temperature at top and bottom boundaries are assumed. The initial temperature distribution assumes a small long-wavelength perturbation. The viscosity structure is based on a thick cratonic lithosphere progressively varying to a thin, or initially inexistent, oceanic lithosphere. The effects of assuming different rheologies, as well as steep or gradual changes in lithospheric thickness are tested. Modelling results show that a very thin oceanic lithosphere (models assuming temperature-dependent viscosity and large viscosity variations evolve to large-scale (upper mantle) convection cells, with upwelling of hot material being
Geldmacher, J.; Hoernle, K.; van den Bogaard, P.; Duggen, S.; Werner, R.
2004-12-01
The role of hotspots (mantle plumes) in the formation of intraplate volcanic island and seamount groups is being increasingly questioned, in particular concerning the abundant and somewhat irregularly distributed island and seamount volcanoes off the coast of northwest Africa. However, new 40Ar/39Ar ages and Sr-Nd-Pb isotope geochemistry of volcanic rocks from two seamounts northeast of the Canary Islands and two northeast of the Madeira Islands provide new support for the plume hypothesis. The oldest ages of shield stage volcanism from seamounts and islands northeast of the Canary and Madeira Islands confirm progressions of increasing age to the northeast for both island/seamount chains consistent with northeast directed plate motion. Calculated angular velocities for the average movement of the African plate in both regions gave similar values of about 0.45\\deg plus/minus 0.05\\deg/Ma around a rotation pole located north of the Azores Islands. Furthermore, the curvature of the chains clearly deviates from the E-W orientation of fracture zones in the East Atlantic. A local control of surface volcanism by lithospheric zones of weakness, however, is likely for some E-W elongated seamounts and islands. The isotope geochemistry additionally confirms that the two volcanic provinces are derived from distinct sources, consistent with distinct mantle plumes having formed both volcanic groups. Conventional hotspot models, however, cannot easily explain the wide distribution of seamounts in the Canary region and the long history of volcanic activity at single volcanic centers (e.g. Dacia seamount, 47-4 Ma; Selvagen Islands, 30-3 Ma). A possible explanation could involve interaction of a Canary mantle plume with small-scale upper mantle processes such as edge driven convection at the edge of the NW African craton (e.g. King and Ritsema, 2000, Science 290, 1137-1140).
Oceanic Platform of the Canary Islands: an ocean testbed for ocean energy converters
González, Javier; Hernández-Brito, Joaquín.; Llinás, Octavio
2010-05-01
The Oceanic Platform of the Canary Islands (PLOCAN) is a Governmental Consortium aimed to build and operate an off-shore infrastructure to facilitate the deep sea research and speed up the technology associated. This Consortium is overseen by the Spanish Ministry of Science and Innovation and the Canarian Agency for Research and Innovation. The infrastructure consists of an oceanic platform located in an area with depths between 50-100 meters, close to the continental slope and four kilometers off the coast of Gran Canaria, in the archipelago of the Canary Islands. The process of construction will start during the first months of 2010 and is expected to be finished in mid-year 2011. PLOCAN serves five strategic lines: an integral observatory able to explore from the deep ocean to the atmosphere, an ocean technology testbed, a base for underwater vehicles, an innovation platform and a highly specialized training centre. Ocean energy is a suitable source to contribute the limited mix-energy conformed in the archipelago of the Canary Islands with a total population around 2 million people unequally distributed in seven islands. Islands of Gran Canaria and Tenerife support the 80% of the total population with 800.000 people each. PLOCAN will contribute to develop the ocean energy sector establishing a marine testbed allowing prototypes testing at sea under a meticulous monitoring network provided by the integral observatory, generating valuable information to developers. Reducing costs throughout an integral project management is an essential objective to be reach, providing services such as transportation, customs and administrative permits. Ocean surface for testing activities is around 8 km2 with a depth going from 50 to 100 meters, 4km off the coast. Selected areas for testing have off-shore wind power conditions around 500-600 W/m2 and wave power conditions around 6 kW/m in the East coast and 10 kW/m in the North coast. Marine currents in the Canary Islands are
Directory of Open Access Journals (Sweden)
Alvaro Semedo
2018-03-01
Full Text Available A climatology of wind sea and swell waves along the Canary eastern boundary current area, from west Iberia to Mauritania, is presented. The study is based on the European Centre for Medium-Range Weather Forecasts (ECMWF reanalysis ERA-Interim. The wind regime along the Canary Current, along west Iberia and north-west Africa, varies significantly from winter to summer. High summer wind speeds generate high wind sea waves, particularly along the coasts of Morocco and Western Sahara. Lower winter wind speeds, along with stronger extratropical storms crossing the North Atlantic sub-basin up north lead to a predominance of swell waves in the area during from December to February. In summer, the coast parallel wind interacts with the coastal headlands, increasing the wind speed and the locally generated waves. The spatial patterns of the wind sea or swell regional wave fields are shown to be different from the open ocean, due to coastal geometry, fetch dimensions, and island sheltering.
Native and introduced gastropods in laurel forests on Tenerife, Canary Islands
Kappes, Heike; Delgado, Juan D.; Alonso, María R.; Ibáñez, Miguel
2009-09-01
The introduction of non-native gastropods on islands has repetitively been related to a decline of the endemic fauna. So far, no quantitative information is available even for the native gastropod fauna from the laurel forests (the so-called Laurisilva) of the Canary Islands. Much of the original laurel forest has been logged in recent centuries. Based on vegetation studies, we hypothesized that densities and the number of introduced species decline with the age of the regrowth forests. We sampled 27 sites from which we collected thirty native and seven introduced species. Two introduced species, Milax nigricans and Oxychilus alliarius, were previously not reported from the Canary Islands. Assemblage composition was mainly structured by disturbance history and altitude. Overall species richness was correlated with slope inclination, prevalence of rocky outcrops, amounts of woody debris and leaf litter depth. Densities were correlated with the depth of the litter layer and the extent of herb layer cover and laurel canopy cover. Introduced species occurred in 22 sites but were neither related to native species richness nor to the time that elapsed since forest regrowth. One introduced slug, Lehmannia valentiana, is already wide-spread, with densities strongly related to herb cover. Overall species richness seemed to be the outcome of invasibility, thus factors enhancing species richness likely also enhance invasibility. Although at present introduced species contribute to diversity, the potential competition between introduced slugs and the rich native semi-slug fauna, and the effects of introduced predatory snails ( Oxychilus spp. and Testacella maugei) warrant further monitoring.
Hepatic lesions in cetaceans stranded in the Canary Islands.
Jaber, J R; Pérez, J; Arbelo, M; Andrada, M; Hidalgo, M; Gómez-Villamandos, J C; Van Den Ingh, T; Fernández, A
2004-03-01
This article describes the gross, histopathologic, and ultrastructural findings of the livers of cetaceans stranded on the coast of the Canary Islands between 1992 and 2000. A total of 135 cetaceans were included in the study, among which 25 were common dolphins (Delphinus delphis), 23 Atlantic spotted dolphins (Stenella frontalis), 19 striped dolphins (Stenella coeruleoalba), and 15 other species of dolphins and whales. The most common lesion observed in these animals was a nonspecific chronic reactive hepatitis (47/135), followed by hyaline intracytoplasmic inclusions in hepatocytes (33/135). Parasitic cholangitis was detected in 8/135 animals, whereas hepatic lipidosis was presented in 7/135 animals. The ultrastructure of hyaline hepatocytic cytoplasmic inclusions is described, and possible causes of these inclusions are discussed.
Three new records of Desmodorids (Nematoda, Desmodoridae) from sandy seabeds of the Canary islands
Riera, Rodrigo; Núñez, Jorge; Brito, María del Carmen
2012-01-01
In an ecological study of meiofaunal assemblages in two locations (Los Abrigos and Los Cristianos) of Tenerife (Canary Islands, NE Atlantic Ocean), several desmodorid species were found throughout the study period. Three species belonging to the family Desmodoridae were collected in intertidal and shallow subtidal sandy seabeds. These species were Desmodorella aff. tenuispiculum Allgen, 1928, Metachromadora sp. and Spirinia parasitifera Bastian, 1865. Descriptions, figures and tables with mer...
Directory of Open Access Journals (Sweden)
Davy Ung
Full Text Available Many animals live in a communication network, an environment where individuals can obtain information about competitors or potential mates by observing interactions between conspecifics. In such an environment, interactants might benefit by changing their signalling behaviour in the presence of an audience. This audience effect seems widespread among species, has been observed during various types of interaction (e.g. intra-sexual vs. inter-sexual interaction and varies according to the social context (e.g. gender, hierarchical or mating status of the audience. However, the way individuals might adapt their signalling behaviour to a combination of these factors remains poorly understood. To address this question, we studied how the presence of an audience affects the behaviour of male domestic canaries Serinus canaria during two types of interactions: (i an extra-pair interaction and (ii a male-male competition for food. Males were observed under three conditions: (a in the absence of audience, (b in the presence of their mate or (c of a familiar female. Our results show that male domestic canaries minutely adapt their courting and agonistic behaviours to a combination of: (i the type of interaction (extra-pair interaction/male-male competition, (ii the social context (mate, familiar female or nobody in audience and (iii the behaviours of both the audience and the interactant. These results highlight the ability of animals to subtly adapt their behaviour to the social environment. This also raises questions about the cognitive foundations and evolution of these processes especially considering that canaries are known neither for having high cognitive abilities nor for being a typical example for the social intelligence hypothesis.
Dicty_cDB: Contig-U04933-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available scauevk mixed_tissue Sebastes... 44 7.6 1 ( GE817117 ) EST_scau_evk_970879 scauevk mixed_tissue Sebastes... ...44 7.6 1 ( GE813196 ) EST_scau_evk_963850 scauevk mixed_tissue Sebastes... 44 7.6... 1 ( EW983400 ) EST_sras_evg_775142 srasevg mixed_tissue Sebastes... 44 7.6 1 ( CP001287 ) Cyanothece sp. PC...( BM514186 ) kx97c10.y1 Parastrongyloides trichosuri PA SL1 TO... 44 7.6 1 ( GE819488 ) EST_scau_evk_964044
International Nuclear Information System (INIS)
Sipilae, K.
1998-01-01
The target of the project was to investigate if rape seed based fuel oil and diesel fuel component, agrofiber and solid fuel from other annual crops could be produced effectively as an alternative to existing non-economical biodiesel-RME and ethanol production. Without heavy tax incentives the biodiesel and grain ethanol can not compete with conventional liquid fuels, the present EU fuel tax legislation will not permit any permanent tax incentives for commercial scale operations. Based on several studies by VTT the rape seed oil will be 30 % cheaper than RME and the utilization as a component 10-30 % blended to heating oil or diesel fuel might the most flexible solution. Neste Oy has carried out the combustion tests with 20 kW boiler and VTT the diesel engine tests with 20 % unprocessed rape seed oil mixtures, the oil was delivered by Mildola Oy. For the co-utilization of annual crops and straw, several laboratory scale combustion and flash pyrolysis tests have been carried out by VTT with straw, reed canary grass etc. In fluid bed combustion 10-30 % addition of rape seed straw and reed canary grass, which have high ash melting point, seems to be less problematic compared to other straw species, which are used for example in Denmark. In a flash pyrolysis process, the alkalies will remain in the char and a low alkali level bio oils can be produced. As a final step in order to reach the zero subsidy target, an extensive laboratory work is carried out to produce agro fibre from flax, reed canary grass and wheat straw. The laboratory results show that a good quality pulp can be produced to be mixed with conventional wood fibres, the quality of flax pulp is even better compared to conventional pulp. During the next months an overall economic calculations will be carried out in Finnish, Danish and Italian conditions as an EU-Apas project in order to see the competitiveness of such integrated concepts to conventional RME and reed canary grass combustion. (orig.)
Hospitalizations realted to herpes zoster infection in the Canary Islands, Spain (2005-2014).
García-Rojas, Amós; Gil-Prieto, Ruth; Núñez-Gallo, Domingo Ángel; Matute-Cruz, Petra; Gil-de-Miguel, Angel
2017-08-24
Herpes zoster is an important problem of public health especially among the elderly in Spain. A population-based retrospective epidemiological study to estimate the burden of herpes zoster requiring hospitalization in the Canary Islands, Spain was conducted by using data from the national surveillance system for hospital data, Conjunto Mínimo Básico de Datos. Records of all patients admitted to hospital with a diagnosis of herpes zoster in any position and cases of primary diagnosis (ICD-9-MC codes 053.0-053.9) during a 10-year period (2005-2014), were selected. A total of 1088 hospitalizations with a primary or secondary diagnosis of herpes zoster were identified during the study period. Annually there were 6.99 hospitalizations by herpes zoster per 100,000 population. It increases with age reaching a maximum in persons ≥85 years of age (43.98 admissions per 100,000). Average length of hospitalization was 16 days and 73 patients died, with a case-fatality rate of 4.03%. In 22% of the cases hospitalized, herpes zoster was the primary diagnosis. The hospitalization burden of herpes zoster in adults in the Canary Islands was still important during the last decade and justify the implementation of preventive measures, like vaccination in the elderly or other high risk groups to reduce the most severe cases of the disease.
Survey of diseases caused by Fusarium spp. on palm trees in the Canary Islands
Directory of Open Access Journals (Sweden)
Julio Hernández-Hernández
2010-05-01
Full Text Available Between 2006 and 2007, palm trees growing in both gardens and public parks and natural palm groves in the Canary Islands (Spain, and showing symptoms of wilt and dieback, were surveyed. Isolates were recovered from affected tissues of the crowns, leaves and vascular fragments on potato dextrose agar (PDA. After incubation, the Fusarium spp. colonies recovered were single-spored. They were transferred to PDA and Spezieller Nahrstoffarmer Agar (SNA for morphological identification. Identification of Fusarium oxysporum f. sp. Canariensis was confirmed by PCR with the specific primers HK66 and HK67, which amplified a fragment of 567 bp. Fusarium wilt caused by F. oxysporum f. sp. canariensis was found on 54 Phoenix canariensis trees growing on four islands: Gran Canaria, Fuerteventura, La Palma and Tenerife. F. proliferatum occurred on fifteen palms (10 P. canariensis, 1 P. dactylifera, 3 Roystonea regia and 1 Veitchia joannis located in Gran Canaria, Fuerteventura and Tenerife. Both these Fusarium species were found only in diseased palms from gardens and public parks, but not in natural palm groves. The results show that Fusarium wilt of P. canariensis is common in the Canary Islands and for the first time report F. proliferatum affecting different palm species in those islands.
Petrological and geochemical studies of mantle xenoliths from La Palma, Canary Islands
Janisch, Astrid; Ntaflos, Theodoros
2015-04-01
La Palma is the second youngest island, after El Hierro, of the Canary archipelago. The archipelago consists of seven large islands, forming an east-west-trending island chain, and several seamounts. All together they form a volcanic belt of around 800 km length and 450 km width, which presumably comprises roughly the Canary hotspot. The islands are located off the western coast of Morocco, Africa. The distance ranges from 100 km to 500 km. Concurrently with the distance, subaerial volcanism age progresses from the oldest lava in the east to the youngest in the west of the archipelago. Presently, La Palma is in the shield building stage of growth (alongside with El Hierro and Tenerife) and is furthermore the fastest growing island of the Canary archipelago. Historical volcanic eruptions are restricted on the younger islands, La Palma and El Hierro, with the last eruption at the south end of La Palma in 1971. Mantle xenoliths described in this work were collected at the slopes of San Antonio Volcano, Fuencaliente, brought to the surface during the 1677/1678 eruption. The mantle xenolith collection comprises sp-lherzolites, sp-harzburgites and pyroxenites. The texture can be distinguished between coarse-grained matrix and fine-grained veins in various thicknesses, mostly with olivine and pyroxene but also with amphibole, phlogopite as well as apatite. Mineral analyses reveal the existence of primary and secondary ol, cpx and opx. Primary ol has Fo contents of 89.2 to 91.7 and NiO ranging from 0.3 to 0.45 wt.%, whereas secondary ol show Fo values of 78.4 to 91.9 but with NiO below 0.3 wt.%. Primary cpx are predominantly Cr-Diopsides with En48.7-51.9-Wo43.5-44.3-Fs4.1-4.9 and Mg# of 91.5 to 92.4. Secondary cpx, primarily Ti-Augit, display En36.7-44.4-Wo47.7-49.6-Fs6.7-13.0 and Mg# of 75.3 to 90.8. Primary opx compositions are in range of En89.3-90.6-Wo1.3-1.5-Fs8.1-9.3 with Mg# between 90.7 and 92.0. Secondary opx exhibit En88.7-89.2-Wo1.7-1.9-Fs9.1-9.5 and Mg# of 90
Czech Academy of Sciences Publication Activity Database
Fernández-Alvarez, A.; Modrý, David; Foronda, P.
2016-01-01
Roč. 115, č. 5 (2016), s. 1817-1825 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : Coccidia * Eimeria barbarae n. sp * Alectoris barbara * Canary Island Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.329, year: 2016
Dicty_cDB: Contig-U04429-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available BP230009B10H9 Soares normalized bovine placenta B... 46 2.4 1 ( EW982243 ) EST_sras_evg_774543 srasevg mixed_tissue Sebaste...s... 46 2.4 1 ( EW982242 ) EST_sras_evg_774159 srasevg mixed_tissue Sebastes... 46 2.4 1 ( C
Radon concentration in dwellings of Lanzarote (Canary Islands)
Energy Technology Data Exchange (ETDEWEB)
Pinza, C.; Armas, J.H. [La Laguna Univ., Tenerife (Spain). Faculty of Medicine; Poffijn, A. [Ghent Rijksuniversiteit (Belgium). Lab. voor Kernfysica
1997-07-01
A total of 126 radon passive dosemeters were distributed in 63 dwellings on the island of Lanzarote (Canary Islands) to measure the indoor radon concentration in the period April-June 1994. The mean overall indoor concentration was 50 Bq.m{sup -3} with a standard deviation of 17 Bq.m{sup -3}. Applying the conversion factor for the effective dose, recommended by ICRP 65, this results in a mean effective dose of 0.75 mSv.y{sup -1}. The mean radon concentration in single-family houses proves to be higher at the ground floor than in upper levels. The mean radon concentration obtained in bedrooms is higher than in living-rooms, independently of the floor they are located at. Statistically significant differences in the mean radon concentration have been found depending on the soil permeability (P = 0.001) and building materials used (P 0.0006). (author).
Radon concentration in dwellings of Lanzarote (Canary Islands)
International Nuclear Information System (INIS)
Pinza, C.; Armas, J.H.; Poffijn, A.
1997-01-01
A total of 126 radon passive dosemeters were distributed in 63 dwellings on the island of Lanzarote (Canary Islands) to measure the indoor radon concentration in the period April-June 1994. The mean overall indoor concentration was 50 Bq.m -3 with a standard deviation of 17 Bq.m -3 . Applying the conversion factor for the effective dose, recommended by ICRP 65, this results in a mean effective dose of 0.75 mSv.y -1 . The mean radon concentration in single-family houses proves to be higher at the ground floor than in upper levels. The mean radon concentration obtained in bedrooms is higher than in living-rooms, independently of the floor they are located at. Statistically significant differences in the mean radon concentration have been found depending on the soil permeability (P = 0.001) and building materials used (P 0.0006). (author)
Czech Academy of Sciences Publication Activity Database
Šrůtek, Miroslav; Doležal, J.; Hara, T.
2002-01-01
Roč. 34, č. 2 (2002), s. 201-210 ISSN 1523-0430 R&D Projects: GA ČR(CZ) GA206/00/1445; GA AV ČR(CZ) KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : Pinus canariensis * Canary Islands Subject RIV: EF - Botanics Impact factor: 0.964, year: 2002
Directory of Open Access Journals (Sweden)
Mario Fernández-Mazuecos
Full Text Available BACKGROUND: Population genetic theory holds that oceanic island populations are expected to have lower levels of genetic variation than their mainland counterparts, due to founder effect after island colonization from the continent. Cistus monspeliensis (Cistaceae is distributed in both the Canary Islands and the Mediterranean region. Numerous phylogenetic results obtained in the last years allow performing further phylogeographic analyses in Cistus. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed sequences from multiple plastid DNA regions in 47 populations of Cistus monspeliensis from the Canary Islands (21 populations and the Mediterranean basin (26 populations. The time-calibrated phylogeny and phylogeographic analyses yielded the following results: (1 a single, ancestral haplotype is distributed across the Mediterranean, whereas 10 haplotypes in the Canary Islands; (2 four haplotype lineages are present in the Canarian Islands; (3 multiple colonization events across the archipelago are inferred; (4 the earliest split of intraspecific lineages occurred in the Early to Middle Pleistocene (<930,000 years BP. CONCLUSIONS/SIGNIFICANCE: The contrasting pattern of cpDNA variation is best explained by genetic bottlenecks in the Mediterranean during Quaternary glaciations, while the Canarian archipelago acted as a refugium of high levels of genetic diversity. Active colonization across the Canarian islands is supported not only by the distribution of C. monspeliensis in five of the seven islands, but also by our phylogeographic reconstruction in which unrelated haplotypes are present on the same island. Widespread distribution of thermophilous habitats on every island, as those found throughout the Mediterranean, has likely been responsible for the successful colonization of C. monspeliensis, despite the absence of a long-distance dispersal mechanism. This is the first example of a plant species with higher genetic variation among oceanic island
Changes in infiltration rate into Andisols for change of use (Tenerife, Canary I.)
International Nuclear Information System (INIS)
Neris, J.; Fuentes, J.; Dorta, M. A.; Jimenez, C.; Tejedor, M.
2009-01-01
The volcanic island of Tenerife (Canary Islands) has a wide variety of Andisols which have formed on recent pyroclast materials (Udands, Ustands, Xerands and Vitrands. The Udands are situated on the nor then side of the island, at heights where condensation of the trade winds occurs (900-1600m), while the Ustands are also located mostly on this side, albeit at a lower attitudinal strip. Under natural conditions, these soils present favourable physical properties, with high structural stability and resistance to water erosion. (Author) 11 refs.
Maite, Vázquez-Luis; José M, Guerra-García; Susana, Carvalho; Lydia Png-Gonzalez
2013-01-01
Mantacaprella macaronensis new genus, new species, is described based on specimens collected from Canary Islands and Cape Verde. Mantacaprella is close to the genera Parambus, Pseudolirius, Propodalirius and Paracaprella, but can be distinguished by the combination of the following characteristics: pereopods 3, 4 and 5 two-articulate; pereopods 6 and 7 six-articulate; mandibular molar present and palp absent; male abdomen with a pair of well-developed appendages. The new species has been found living in Cymodocea nodosa meadows and Caulerpa prolifera beds from 8.8 to 14.6 m depth in Gran Canaria (Canary Islands), and in natural rocky and artificial habitats (shipwrecks) at 25 m in Sal Island (Cape Verde). Even though the new species is one of the dominant amphipods inhabiting meadows of Cymodocea nodosa in Gran Canaria and in Cape Verde, it had not been described so far. This reflects the lack of knowledge on Macaronesian invertebrates, such as amphipods, and the need of further taxonomical studies to better characterise the whole biodiversity of this region and to design adequate programmes of management and conservation.
Energy Technology Data Exchange (ETDEWEB)
Marrero, Gustavo A. [Facultad de Ciencias Economicas, Campus de Guajara, Universidad de La Laguna, 38071 Santa Cruz de Tenerife (Canary Islands) (Spain); Fundacion de Estudios de Economia Aplicada (FEDEA), C/Jorge Juan 46, 28001 Madrid (Spain); Ramos-Real, Francisco Javier [Facultad de Ciencias Economicas, Campus de Guajara, Universidad de La Laguna, 38071 Santa Cruz de Tenerife (Canary Islands) (Spain); Instituto Universitario de Desarrollo Regional, Facultad de Ciencias Economicas, Campus de Guajara, Universidad de La Laguna, 38071 Santa Cruz de Tenerife (Canary Islands) (Spain)
2010-12-15
The Canary Islands offer an example of an isolated electric grid of relative important size within the EU. Due to its peculiarities, the role of renewable energies and their complementarity with fossil fuels offers a solid path to achieving the main energy policy goals of the Islands. The purpose of this paper is to assess the current situation and the energy objectives proposed in the Energy Plan of the Canaries (PECAN, 2006) for the electricity industry, taking into account the average cost and the risk associated with the different alternatives for generating electricity by means of the Mean-Variance Portfolio Theory. Our analysis highlights the inefficiency of the current electricity generating mix in terms of cost, risk and lack of diversification. Shifting toward an efficient system would involve optimizing the use of endogenous energy sources and introducing natural gas to generate electricity. This scenario would mean reducing both cost and risk by almost 30% each, as well as atmospheric CO{sub 2} emissions. Our results agree with the PECAN philosophy. (author)
Carle, Ryan D.; Beck, Jessie N.; Calleri, David M.; Hester, Michelle M.
2015-06-01
We used stable isotopes (δ15N and δ13C) and compared prey provided to chicks by each sex to evaluate seasonal and sex-specific diets in Rhinoceros Auklets (Cerorhinca monocerata) in the central California Current system during 2012-2013. Mixing models indicated northern anchovy (Engraulis mordax) were important prey for adults during fall/winter and juvenile rockfishes (Sebastes spp.) were important prey during incubation both years. Adult trophic level increased between incubation and chick-rearing periods in both years. During 2012, δ15N and δ13C of chick-rearing males and females differed significantly; mixing models indicated that females ate more Pacific saury (Cololabis saira) and less market squid (Doryteuthis opalescens) than males. Likewise, females delivered significantly more Pacific saury and less market squid to chicks than males during 2012. Chick growth (g d- 1) and chick survival to fledging were significantly lower during 2012 than 2013, likely because chicks were fed lesser quality prey or fed less frequently in 2012. Lesser body mass of females during incubation in 2012 indicated sex-specific diet differences may have been related to female energetic constraints. The observed variability in Rhinoceros Auklet diet underscores the importance of managing multiple prey populations in this system so that generalist predators have sufficient resources through changing conditions.
Multi-event behavior of El Golfo landslide (El Hierro Island, Canary Archipelago)
León, Ricardo; Biain, Ander; Urgeles, Roger; Somoza, Luis; Ferrer, Mercedes; García-Crespo, Jesús; Francisco Mediato, José; Galindo, Inés; Yepes, Jorge; Gimenez-Moreno, Julia
2017-04-01
Based on the re-interpretation of a vast onshore-offshore data set, a new morpho-structural characterization of the El Golfo giant landslide in the island of El Hierro (Canary Archipelago, Spain) is presented. Offshore multibeam echosounder data, chirp sub-bottom profiles, multichannel seismic reflection data and onshore information from water wells and galleries have been analyzed to determine the nature of the event. The subaerial headscarp shows a non-continuous arcuate profile formed by two nested semi-circular amphitheaters that extend offshore along a smooth chute, suggesting the occurrence of at least two large retrogressive events. Channels/gullies and escarpments developed along the submarine sector of the scar also indicate smaller-scale events and predominance of sediment bypass. At the base of submerged island, two subunits within the related submarine mass transport deposit (MTD) are identified on multichannel seismic reflection profiles confirming the multi-event nature of the landslide. The MTD, identified as a debris avalanche, has a total estimated volume of 318 km3: 84 km3 and 234 km3, for the lower and upper subunits respectively. Data from wells and galleries show abrasion platforms with beach deposits at sea-level (0 masl) formed after the landslide scar and buried by the El Golfo post-collapse infill lavas, suggesting an age at least older than 23.5-82.5 ka for the landslide. This work has been supported by the projects IGCP-640 S4SLIDE, High resolution seabed mapping EASME/EMFF/2016/005 and CTM2010-09496-E. Keywords: Submarine landslides, volcanic islands, debris avalanche, Canary Islands
A Lagrangian study tracing water parcel origins in the Canary Upwelling System
Directory of Open Access Journals (Sweden)
Evan Mason
2012-08-01
Full Text Available The regional ocean circulation within the Canary Upwelling System between 31°N and 35°N is studied using numerical tools. Seasonal mean and near-instantaneous velocity fields from a previously-generated climatological Regional Ocean Modelling System (ROMS solution of the Canary Basin are used to force a series of offline Lagrangian particle-tracking experiments. The primary objective is to identify the pathways through which water parcels arrive at the upwelling region north of Cape Ghir. Examining year-long pathways, the Azores Current contributes over 80% of particles annually, of which a large proportion arrive directly from offshore (from the northwest, while others travel along the shelf and slope from the Gulf of Cadiz. The remaining ~20% originate within the Gulf of Cadiz or come from the south, although the southern contribution is only significant in autumn and winter. When season-long pathways are considered, the alongshore contributions become increasingly important: northern contributions reach 40% in spring and summer, while southern values exceed 35% in winter. This study also shows that coastal upwelling changes both spatially and temporally. Upwelling becomes intensified near Cape Beddouza, with most upwelling occurring within ~40 km from shore although significant values may reach as far as 120 km offshore north of Cape Beddouza; at these locations the offshore integrated upwelling reaches as much as 4 times the offshore Ekman transport. In the Cape Beddouza area (32°N to 33°N, upwelling is negligible in February but intensifies in autumn, reaching as much as 3 times the offshore Ekman transport.
Development and recent activity of the San Andrés landslide on El Hierro, Canary Islands, Spain
Czech Academy of Sciences Publication Activity Database
Klimeš, Jan; Yepes, J.; Becerril, L.; Kusák, Michal; Galindo, I.; Blahůt, Jan
2016-01-01
Roč. 261, MAY 15 (2016), s. 119-131 ISSN 0169-555X R&D Projects: GA MŠk LM2010008 Grant - others: National Geographic Society W244-12 Institutional support: RVO:67985891 Keywords : Deep-seated gravitational slope deformations (DSGSDs) * Landslide monitoring * Creep movements * Canary Islands Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.958, year: 2016
DEFF Research Database (Denmark)
Ade, P. A. R.; Aghanim, N.; Arnaud, M.
2016-01-01
We present the results of approximately three years of observations of Planck Sunyaev-Zeldovich (SZ) sources with telescopes at the Canary Islands observatories as part of the general optical follow-up programme undertaken by the Planck Collaboration. In total, 78 SZ sources are discussed. Deep-i...
Foronda, Pilar; Plata-Luis, Josué; del Castillo-Figueruelo, Borja; Fernández-Álvarez, Ángela; Martín-Alonso, Aarón; Feliu, Carlos; Cabral, Marilena D; Valladares, Basilio
2015-05-29
Coxiella burnetii and Toxoplasma gondii are intracellular parasites that cause important reproductive disorders in animals and humans worldwide, resulting in high economic losses. The aim of the present study was to analyse the possible role of peridomestic small mammals in the maintenance and transmission of C. burnetii and T. gondii in the north-western African archipelagos of the Canary Islands and Cape Verde, where these species are commonly found affecting humans and farm animals. Between 2009 and 2013, 108 black rats (Rattus rattus) and 77 mice (Mus musculus) were analysed for the presence of Coxiella and Toxoplasma antibodies by enzyme-linked immunosorbent assay (ELISA) and indirect immunofluorescence (IFA), respectively. Our results showed a wide distribution of C. burnetii and T. gondii, except for T. gondii in Cape Verde, in both rodent species. The overall seroprevalence of C. burnetii antibodies was 12.4%; 21.1% for Cape Verde and 10.2% for the Canary Islands. With respect to T. gondii, seropositive rodents were only observed in the Canary Islands, with an overall seroprevalence of 15%. Considering the fact that both pathogens can infect a large range of hosts, including livestock and humans, the results are of public health and veterinary importance and could be used by governmental entities to manage risk factors and to prevent future cases of Q fever and toxoplasmosis.
GonzÁlez, JosÉ A
2018-04-23
The complete list of Canarian marine decapods (last update by González Quiles 2003, popular book) currently comprises 374 species/subspecies, grouped in 198 genera and 82 families; whereas the Cape Verdean marine decapods (now fully listed for the first time) are represented by 343 species/subspecies with 201 genera and 80 families. Due to changing environmental conditions, in the last decades many subtropical/tropical taxa have reached the coasts of the Canary Islands. Comparing the carcinofaunal composition and their biogeographic components between the Canary and Cape Verde archipelagos would aid in: validating the appropriateness in separating both archipelagos into different ecoregions (Spalding et al. 2007), and understanding faunal movements between areas of benthic habitat. The consistency of both ecoregions is here compared and validated by assembling their decapod crustacean checklists, analysing their taxa composition, gathering their bathymetric data, and comparing their biogeographic patterns. Four main evidences (i.e. different taxa; divergent taxa composition; different composition of biogeographic patterns; different endemicity rates) support that separation, especially in coastal benthic decapods; and these parametres combined would be used as a valuable tool at comparing biotas from oceanic archipelagos. To understand/predict south-north faunal movements in a scenario of regional tropicalization, special attention is paid to species having at the Canaries their southernmost occurrence, and also to tropical African warm-affinity species.
Mantle to surface degassing of carbon- and sulphur-rich alkaline magma at El Hierro, Canary Islands
Longpré, Marc-Antoine; Stix, John; Klügel, Andreas; Shimizu, Nobumichi
2017-02-01
Basaltic volcanoes transfer volatiles from the mantle to the surface of the Earth. The quantification of deep volatile fluxes relies heavily on estimates of the volatile content of primitive magmas, the best archive of which is provided by melt inclusions. Available data from volcanoes producing mafic alkaline lavas in a range of tectonic settings suggest high volatile fluxes, but information remains sparse, particularly for intraplate ocean islands. Here we present measurements of volatile and trace element concentrations, as well as sulphur speciation, in olivine-hosted melt inclusions and matrix glasses from quenched basanite lava balloon samples from the 2011-2012 submarine eruption at El Hierro, Canary Islands. The results reveal remarkably high concentrations of dissolved volatiles and incompatible trace elements in this magma, with ∼80 ppm Nb and up to 3420 ppm CO2, 3.0 wt.% H2O and 5080 ppm S. Reconstructed primitive CO2 contents, considering CO2/Nb systematics and possible CO2 sequestration in shrinkage bubbles, reach weight percent levels, indicating that carbon is a major constituent of Canary Island magmas at depth and that exsolution of a CO2-rich fluid begins in the mantle at pressures in excess of 1 GPa. Correlations between sulphur concentration, sulphur speciation and water content suggest strong reduction of an initially oxidised mantle magma, likely controlled by coupled H2O and S degassing. This late-stage redox change may have triggered sulphide saturation, recorded by globular sulphide inclusions in clinopyroxene and ulvöspinel. The El Hierro basanite thus had a particularly high volatile-carrying capacity and released a minimum of 1.3-2.1 Tg CO2 and 1.8-2.9 Tg S to the environment, causing substantial stress on the local submarine ecosystem. These results highlight the important contribution of alkaline ocean island volcanoes, such as the Canary Islands, to volatile fluxes from the mantle.
Directory of Open Access Journals (Sweden)
Alejandro Escanez
2012-09-01
Full Text Available Data on opportunistic sightings of diamond-shaped squid Thysanoteuthis rhombus egg masses in the Canary Islands (Atlantic Ocean are presented. A total of 16 egg masses of this species were recorded and photographed from 2000 to 2010 around the western islands of the archipelago (El Hierro, Tenerife and La Gomera. These data reveal the existence of an important spawning area for diamond-shaped squid around the Canary Islands, in subtropical east Atlantic waters. We provide preliminary data for the potential development of an artisanal fishery focused on this species, and a discussion on its potential impacts on the marine ecosystem.
2013-08-06
...) dredging and disposal of dredged material; (3) pollution and runoff; (4) underwater construction and..., at the northern tip of Whidbey Island. Pollution and runoff are also concerns in this basin, mostly... areas deeper than 98 ft (30 m) along Possession Point, Admiralty Inlet and the rims of Puget Sound...
Gale, Robert W.; Tanner, Michael J.; Love, Milton S.; Nishimoto, Mary M.; Schroeder, Donna M.
2012-01-01
To determine the environmental consequences of decommissioning offshore oil platforms on local and regional fish populations, contaminant loads in reproducing adults were investigated at seven platform sites and adjacent, natural sites. Specimens of three species (Pacific sanddab, Citharichthys sordidus; kelp rockfish, Sebastes atrovirens; and kelp bass, Paralabrax clathratus) residing at platforms and representing the regional background within the Santa Barbara Channel and within the San Pedro Basin were collected. Some of the most important contaminant classes related to oil operations are polycyclic aromatic hydrocarbons (PAHs) because of their potential toxicity and carcinogenicity. However, acute exposure cannot be related directly to PAH tissue concentrations because of rapid metabolism of the parent chemicals in fish; therefore, PAH metabolites in bile were measured, targeting free hydroxylated PAHs (OH-PAHs) liberated by enzymatic hydrolysis of the bound PAH glucuronides and sulfates. An ion-pairing method was developed for confirmatory analysis that targeted PAH glucuronides and sulfates. Concentrations of hydroxylated PAHs in all samples (76 fish from platforms and 64 fish from natural sites) were low, ranging from less than the limits of detection (5 to 120 nanograms per milliliter bile; 0.03 to 42 nanograms per milligram protein) to a maximum of 320 nanograms per milliliter bile (32 nanograms per milligram protein). A previously proposed dosimeter of PAH exposure in fish, 1-hydroxypyrene, was not detected at any platform site. Low concentrations of 1-hydroxypyrene were detected in 3 of 12 kelp rockfish collected from a natural reef site off Santa Barbara. The most prevalent OH-PAH, 2-hydroxyfluorene, was detected at low concentrations in seven fish of various species; of these, four were from two of the seven platform sites. The greatest concentrations of 2-hydroxyfluorene were found in three fish of various species from Platform Holly and were only
Directory of Open Access Journals (Sweden)
Judit Gutiérrez de Armas
2017-12-01
Full Text Available This paper follows recent discussions about the role of gastronomy in the construction of culinary national identities in the nineteenth and twentieth centuries, focusing on the construction of late gastronomic Canary nationalism. It examines national and regional cookbooks —aimed mainly at a female audience— and extends the study to the kitchen, analysing the effects of cookery bestsellers on the diet of the social elites of the Canary Islands and gauging the impact of other influences like British gastronomy, through research on handwritten recipes in family archives. Finally, the transmission cycle of this domestic knowledge within the female socialisation universe will also be analysed.
Erséus, Christer
1992-01-01
Seven species of Tubificidae are recorded from the Canary Islands, viz. Heterodrilus amplus n. sp., Coralliodrilus leviatriatus Erséus, 1979, Limnodriloides agnes Hrabĕ, 1967, L. janstocki n. sp., Aktedrilus cuneus Erséus, 1984, A. parvithecatus (Erséus, 1978), and Tubifex tubifex (Müller, 1774);
Predatory fishes affect trophic cascades and apparent competition in temperate reefs.
Frid, Alejandro; Marliave, Jeff
2010-08-23
We provide evidence for a trophic cascade involving apex predators and mesopredators of marine temperate reefs, lingcod and rockfish, respectively. We measured spatio-temporal variation in the relative abundance of lingcod, subadult rockfish and two shrimp groups eaten by rockfish (Pandalus sp. and three smaller-bodied genera aggregated). Lingcod had an indirect positive effect on shrimps, as mediated by the direct negative effects of lingcod on rockfish and of rockfish on shrimps. These top-down effects on shrimps, however, were stronger for Pandalus than for small-bodied shrimps. Further, abundances of Pandalus and small-bodied shrimps were negatively correlated and the latter had a stronger positive effect on rockfish, suggesting that rockfish mediated asymmetrical apparent competition between shrimps. Our results indicate mechanisms by which predatory fishes may influence the structure of marine communities.
DEFF Research Database (Denmark)
Kristiansen, Aase; Pedersen, Poul Møller
2003-01-01
Comparative culture studies on isolates from Lanzarote (Canary Islands) and from Danish waters of Giraudia sphacelarioides show that temperature plays the key role to determine its geographical distribution. Experiments show that the upper lethal temperature is the same for both isolates 26.5--31...
From 3D to 4D seismic tomography at El Hierro Island (Canary Islands, Spain)
Garcia-Yeguas, A.; Koulakov, I.; Jakovlev, A.; Ibáñez, J. M.
2012-04-01
In this work we are going to show the advantages of a dynamic tomography 4D, versus a static image 3D related with a volcanic reactivation and eruption at El Hierro island (Canary Islands, Spain). In this process a high number of earthquakes before and during the eruptive processes have been registered. We are going to show a 3D image as an average of the velocity structure and then the characteristics and physical properties on the medium, including the presence or not of magma. This image will be complemented with its evolution along the time, observing its volcanic dynamic and its influence over the medium properties, including its power as an important element on early warnings protocols. After more than forty years of quiet at Canary Islands, since 1971 with Teneguía eruption at La Palma Island, and more than 200 years on El Hierro Island (The last eruption known at El Hierro took place in 1793, volcán de Lomo Negro), on 19th July on 2011 the Spanish seismic national network, administered by IGN (Instituto Geográfico Nacional), detected an increase of local seismic activity below El Hierro island (Canary Islands, Spain). Since this moment an intense swarm took place, with more than 11000 events, until 11th December, with magnitudes (MLg) from 0.2 to 4.4. In this period two eruptive processes have been declared in front of the South coast of El Hierro island, and they have not finished yet. This seismic swarm has allowed carrying out a 3D seismic tomography, using P and S waves traveltimes. It has showed a low velocity from the North to the South. On the other hand, we have performed a 4D seismic tomography, taking the events occurred at different intervals of time. We can observe the evolution of the negative anomaly along the time, from the North to the South, where has taken place La Restinga submarine eruption. 4D seismic tomography is an innovative and powerful tool able to show the evolution in time of a volcanic process.
Directory of Open Access Journals (Sweden)
Regina Klapper
Full Text Available The use of parasites as biological tags for discrimination of fish stocks has become a commonly used approach in fisheries management. Metazoan parasite community analysis and anisakid nematode population genetics based on a mitochondrial cytochrome marker were applied in order to assess the usefulness of the two parasitological methods for stock discrimination of beaked redfish Sebastes mentella of three fishing grounds in the North East Atlantic. Multivariate, model-based approaches demonstrated that the metazoan parasite fauna of beaked redfish from East Greenland differed from Tampen, northern North Sea, and Bear Island, Barents Sea. A joint model (latent variable model was used to estimate the effects of covariates on parasite species and identified four parasite species as main source of differences among fishing grounds; namely Chondracanthus nodosus, Anisakis simplex s.s., Hysterothylacium aduncum, and Bothriocephalus scorpii. Due to its high abundance and differences between fishing grounds, Anisakis simplex s.s. was considered as a major biological tag for host stock differentiation. Whilst the sole examination of Anisakis simplex s.s. on a population genetic level is only of limited use, anisakid nematodes (in particular, A. simplex s.s. can serve as biological tags on a parasite community level. This study confirmed the use of multivariate analyses as a tool to evaluate parasite infra-communities and to identify parasite species that might serve as biological tags. The present study suggests that S. mentella in the northern North Sea and Barents Sea is not sub-structured.
Henríquez-Hernández, Luis Alberto; Luzardo, Octavio P; Arellano, José Luis Pérez; Carranza, Cristina; Sánchez, Nieves Jaén; Almeida-González, Maira; Ruiz-Suárez, Norberto; Valerón, Pilar F; Camacho, María; Zumbado, Manuel; Boada, Luis D
2016-01-15
The archipelago of the Canary Islands is one of the so-called ultra-peripheral territories of the European Union due to its geographical location away from the continent. Although the level of socioeconomic development and lifestyle of this region is comparable to that of any other of the European Union, it is just 100 km off the coast of Morocco, in the African continent. The population of the Canaries has been extensively studied with respect to their levels of POPs, and it has been described that their levels are relatively high compared to other European regions. It has been speculated with that the proximity to Africa may be associated with this level of contamination, but so far this theory has not been verified. This paper describes for the first time the levels of organochlorine pesticides (OCPs) and polychlorinated biphenyls (PCBs) in a sample of the population of Morocco (n = 131), which were compared with those of a similar sample of the population of permanent residents in the Canary Islands (n = 100) in order to check this hypothesis. Our results showed that Moroccans have higher median values of OCPs than the residents in the Canaries (∑ OCP = 150.2 ng/g lw vs. 83.4 ng/g lw, p = 0.0001). Regarding the PCBs, although recent studies have reported that new environmental sources of PCBs exist in several African countries (including Morocco), the plasma levels of most congeners were significantly higher in Canarians than in Moroccans, especially for the dioxin-like PCBs (median = 7.3 ng/g lw vs. 0.0 ng/g lw, p = 0.0001). The detailed analysis of our results suggests that the levels of these pollutants in the Canarian people are more influenced by their lifestyle and the previous use of these chemicals in the archipelago than by its geographical vicinity with Morocco.
Directory of Open Access Journals (Sweden)
Dirk Godenau
2012-05-01
Full Text Available Islands play a significant role in international irregular maritime migration. Frequently they are part of maritime interstitial spaces between states, and their location, combined with institutional membership, makes them part of international migration routes and subject to border management strategies. In this paper borders are analysed as social institutions used for regulating relative permeability through rules of entry and exit for persons, goods and capital. Borders institutionalize territoriality and are politically implemented by states. They are selective, also in migration, and irregular border transit is not always indicative of an inability to control. The Canary Islands are used as an illustrative example of how border management at the southern edge of the European Union has evolved towards more coercive deterrence and tighter surveillance. The Canary Islands experienced irregular maritime immigration from the west African coasts during the first decade of the 21st century and most of these migrants intended to use the islands as transit space towards the European continent. Increasing surveillance in countries of origin, enforcement of border controls and stricter return policies were used to stop flows. The so-called “cayuco crisis” in 2006 induced institutional change in border management and forced the active involvement of the EU through FRONTEX.
Mass wasting and subaerial weathering in guyot formation: the Hawaiian and Canary Ridges as examples
Christian Smoot, N.
1995-10-01
By using a combination of bathymetry and topography in the computerized GRASS 3D package, guyot evolution has been determined on the fast-moving Pacific plate for the subaerial, low sloped Hawaiian Island chain. On the slow-moving African plate, the timing of guyot formation has been determined for the subaerial, steeper sloped Canary Islands chain. In the Hawaiian chain, the Niihau Island platform was already essentially formed, although there is a platform at the 180 m elevation on Kauai Island if the remaining peaks are discounted. By Fuerteventura Island in the Canary chain the seamount/island has already been flattened. Both of these platforms are far above the influence of wave cutting. The causal agent of flattening is primarily mass wasting by landsliding, caused in part by earthquake activity on the moving plates. This disproves the subsidence and wavecut theory of guyot formational processes in that the guyot is already formed before it subsides. The islands lie in the tropical coral zone, yet coral formation has little effect on the flattening process. This may be because the turbidity from slumps kills the coral. This exercise also gives a time limit for the reduction of pristine volcanic slopes to the typical guyot surface, that time being between one and four million years. It is apparent that wave cutting merely polishes the stone, applying the finishing patina.
International Nuclear Information System (INIS)
Sipilae, K.
1995-01-01
The target of this project is to investigate if rape seed based fuel oil and diesel fuel component, agrofiber and solid fuel from other annual crops could be produced effectively as an alternative to existing non economical biodiesel-RME and ethanol production. Without heavy tax incentives the biodiesel and grain ethanol can not compete with conventional liquid fuels, the present EU fuel tax legislation will not permit any permanent tax incentives for commercial scale operations. Based on several studies by VTT the rape seed oil will be 30 % cheaper than RME and the utilization as a component 10-30 % blended to heating oil or diesel fuel might the most flexible solution. Neste Oy has carried out the combustion tests with 20 kW boiler and VTT the diesel engine tests with 20 % unprocessed rape seed oil mixtures, the oil was delivered by Mildola Oy. For the co-utilization of annual crops and straw, several laboratory scale combustion and flash pyrolysis tests have been carried out by VTT with straw, reed canary grass etc. In a flash pyrolysis process, the alkalies will remain in the char and a low alkali level bio oils can be produced. As a final step in order to reach the zero subsidy target, an extensive laboratory work is carried out to produce agrofibre from flax, reed canary grass and wheat straw. During the next months an overall economic calculations will be carried out in Finnish, Danish and Italian conditions as an EU-Apas project in order to see the competitiveness of such integrated concepts to conventional RME and reed canary grass combustion
Common bean and Medicago rhizobia isolated from five locations on the island of Lanzarote, the Canary Islands, by partial analysis of 10 chromosomal genes were shown to exhibit close similarity to Sinorhizobium meliloti. Several bean isolates from Lanzarote, mainland Spain and Tunisia nodulated Leu...
Rondé-Broekhuizen, Brigitte L.M.; Stock, Jan H.
1987-01-01
Liagoceradocus acutus Andres, 1978, has been found in different localities on Lanzarote, Canary Islands. A redescription is provided and the taxonomic status of the genus Liagoceradocus is discussed. The species shows sexual dimorphism mainly in the morphology of the propodus of gnathopods 1 and 2,
2012-01-18
.... Rockfish cooperatives formed under the Rockfish Program are subject to existing antitrust laws. Collective price negotiation by a rockfish cooperative must be conducted in accordance with existing antitrust laws...
Directory of Open Access Journals (Sweden)
Jorge Tuñón
2008-06-01
Full Text Available Wallonia and the Canary Islands are both regions with legislative capacities within the European Union (EU. They have traditionally shared serious socio-economic deficits. Therefore, while a new European Regional policy was being designed, they both built regional strategies in order to extract as much as they can from the EU. How far are these Sub-State activations towards Brussels linked to regional gains (outputs from the EU? How different are both mobilisations? How can the higher degree of success of the Canary Islands be explained, taking into account that the Archipelago is far away from the heart of Europe and Wallonia is within it? The research, based on a qualitative analysis method, will be carried out through findings about the regional mechanisms developed to influence the European institutions: the participation (direct and non direct within the Council of Ministers, the Committee of the Regions, the regional interaction with the European Commission, the establishment of representative bodies in Brussels and the participation within interregional associations.
Spatial vent opening probability map of El Hierro Island (Canary Islands, Spain)
Becerril, Laura; Cappello, Annalisa; Galindo, Inés; Neri, Marco; Del Negro, Ciro
2013-04-01
The assessment of the probable spatial distribution of new eruptions is useful to manage and reduce the volcanic risk. It can be achieved in different ways, but it becomes especially hard when dealing with volcanic areas less studied, poorly monitored and characterized by a low frequent activity, as El Hierro. Even though it is the youngest of the Canary Islands, before the 2011 eruption in the "Las Calmas Sea", El Hierro had been the least studied volcanic Island of the Canaries, with more historically devoted attention to La Palma, Tenerife and Lanzarote. We propose a probabilistic method to build the susceptibility map of El Hierro, i.e. the spatial distribution of vent opening for future eruptions, based on the mathematical analysis of the volcano-structural data collected mostly on the Island and, secondly, on the submerged part of the volcano, up to a distance of ~10-20 km from the coast. The volcano-structural data were collected through new fieldwork measurements, bathymetric information, and analysis of geological maps, orthophotos and aerial photographs. They have been divided in different datasets and converted into separate and weighted probability density functions, which were then included in a non-homogeneous Poisson process to produce the volcanic susceptibility map. Future eruptive events on El Hierro is mainly concentrated on the rifts zones, extending also beyond the shoreline. The major probabilities to host new eruptions are located on the distal parts of the South and West rifts, with the highest probability reached in the south-western area of the West rift. High probabilities are also observed in the Northeast and South rifts, and the submarine parts of the rifts. This map represents the first effort to deal with the volcanic hazard at El Hierro and can be a support tool for decision makers in land planning, emergency plans and civil defence actions.
Riera, Rodrigo; Nunez, Jorge; Brito, Maria del Carmen
2014-01-01
A subtidal meiofaunal assemblage in Los Cristianos Bay, Tenerife, Canary Islands was sampled from May 2000 to April 2001, at 3 m depth. Nematodes dominated overwhelmingly during the study period, ranging from 84.52% in May 2000 to 95.93% in October 2000. Copepods and polychaetes were the second and the third most abundant groups, respectively. Meiofaunal densities showed significant differences throughout the study period, with minimum abundances during the spring-summer months (May-July) and...
Energy Technology Data Exchange (ETDEWEB)
Palmborg, Cecilia; Lindvall, Eva (Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Agricultural Research for Northern Sweden)
2010-05-15
Reed Canary Grass is a promising crop for biofuel production. For reed canary grass the first year is an establishment year when the small biomass is not harvested. The second year the biomass is usually cut in late autumn but the harvest (removal of the biomass from the field) is delayed until spring. This technique has resulted in lower costs and increases in fuel quality through lower ash contents, including lower contents of chlorine, sodium and potassium. However costs for production are still high, especially establishment costs, fertilization costs and harvesting costs. The aim of this project was to test ways to cut costs per MWh by increased yields, and decreased establishment costs. The methods used have been variety trials to develop more productive plant material, intercropping with nitrogen fixing legumes to reduce the nitrogen demand of the crop, fertilization with waste material (sewage sludge, reed canary grass ash or poultry manure) and harvest at frozen ground as a strategy to reduce soil compaction and harvest damages on the crop. Reed canary grass grown as a fuel has so far been grown as a mono culture. However, when it is been grown for forage, or as a biogas crop, intercropping with legumes has been successful in some studies. In addition to NPK-fertilizers sewage sludge, ash from combustion of reed canary grass and poultry manure was used. An economic calculation showed that the establishment costs (the first two growing seasons) can be lowered by intercropping with red clover. However it is also involves more risks, related to weeds, and cannot be recommended on fallow soil with a large seed bank of weeds. A ten year old reed canary grass ley was used for the experiment. Two 25 m wide strips were harvested with a mower on November 19 2008 when the top soil was frozen. The harvested material was chopped and removed from the field the following day. The following spring, May 19 2009, the remaining reed canary grass on the field was cut with a
The helminth community of the skink Chalcides sexlineatus from Gran Canaria (Canary Islands).
Roca, V; Carretero, M A; Jorge, F; Perera, A; Ferrero, A; Rodríguez-Reina, S
2012-06-01
A survey of the gastrointestinal helminth communities of a population of Chalcides sexlineatus Steindachner, a small skink endemic to Gran Canaria island (Canary Archipelago, Spain), was conducted to determine the prevalence, abundance and species diversity of intestinal parasites in these reptiles. Only three parasite species were found, one cestode, Oochoristica agamae Baylis, 1919 and two nematodes, Parapharyngodon micipsae (Seurat, 1917) and Pharyngodonidae gen. sp. Helminth infracommunities of C. sexlineatus showed low values of abundance and species richness and diversity, being more similar to the helminth community of Tarentola boettgeri boettgeri (Steindachner) rather than those of Gallotia stehlini (Schenkel), both syntopic with the sampled host.
Bocherens, Herve; Michaux, Jacques; Talavera, Francisco Garcia; Van der Plicht, Johannes
2006-01-01
Fossil bone collagen (14)C dating and delta(13)C and delta(15)N isotopic measurements of the rodent Canariomys bravoi from Tenerife (Canary Islands.. Spain) were used to test two different hypotheses about the causes of extinctions of endemic vertebrates on islands. climate versus humans. For the
González-Weller, Dailos; Rubio, Carmen; Gutiérrez, Ángel José; González, Gara Luis; Caballero Mesa, José María; Revert Gironés, Consuelo; Burgos Ojeda, Antonio; Hardisson, Arturo
2013-12-01
The aim of this study was to analyze barium, bismuth, chromium, lithium, and strontium contents in food and beverages consumed by the population of the Canary Islands (Spain) as well as determine dietary intake of these metals in the archipelago as a whole and in its individual islands. To this end, 440 samples were analyzed by ICP-OES and GFAAS. Barium concentrations ranged from 5.210 ± 2.117 mg/kg in nuts to 0.035 ± 0.043 mg/L in water. Viscera exhibited the highest levels of bismuth (38.07 ± 36.80 mg/kg). The cold meat and sausages group stood out for its high chromium concentrations (0.494 ± 0.257 mg/kg). The highest concentration of lithium and strontium came out in nuts (8.761 ± 5.368 mg/kg and 9.759 ± 5.181 mg/kg, respectively). The total intakes of barium, bismuth, chromium, lithium, and strontium were 0.685, 1.274, 0.087, 3.674, and 1.923 mg/day, respectively. Cereals turned out to contribute most to the dietary intake of barium, bismuth, chromium, and lithium in the Canary Islands, while fruit contributes most to the strontium intake. We also performed a metal intake study by age and sex of the population and compared the outcome with data from other regions, both national and international.
DEFF Research Database (Denmark)
He, Peng; Aldahan, Ala; Hou, Xiaolin
2016-01-01
A complete transect of surface water samples from the North Sea to the Canary Islands was collected during a continuous period in 2010. The samples were analyzed for total 129I and 127I isotopes and their iodide and iodate species. The results indicate a large variability in the total 129I and its...
Directory of Open Access Journals (Sweden)
J. M. Baldasano
2008-05-01
Full Text Available On 28–29 November 2005 an extratropical storm affected the Canary Islands causing significant damage related to high average wind speeds and intense gusts over some islands of the archipelago. Delta was the twenty-sixth tropical or subtropical storm of the 2005 Atlantic hurricane season. It represents an unusual meteorological phenomenon for that region, and its impacts were underestimated by the different operational meteorological forecasts during the previous days of the arrival of the low near Canary Islands. The aim of this study is to reproduce the local effects of the flow that were observed over the Canary Islands during the travel of the Delta storm near the region using high-resolution mesoscale meteorological simulations. The Advanced Research Weather Research & Forecasting Model (WRF-ARW is applied at 9, 3 and 1 km horizontal resolution using ECMWF forecasts as initial and boundary conditions. The high-resolution simulation will outline the main features that contributed to the high wind speeds observed in the archipelago. Variations in vertical static stability, vertical windshear and the intense synoptic winds of the southwestern part of Delta with a warm core at 850 hPa were the main characteristics that contributed to the development and amplification of intense gravity waves while the large-scale flow interacted with the complex topography of the islands.
Applicability of T-S algorithms to the Canary Islands region
Directory of Open Access Journals (Sweden)
A. Marrero-Díaz
2001-07-01
Full Text Available The high cost of oceanographic cruises often makes it advisable to use opportunity vessels for simple measurements, such as determining the temperature of the water column with expandable bathythermographs (XBT. In this work we examine the goodness and reliability of a method aimed at obtaining the maximum possible information from XBT data, and we apply it to the Canary Islands region. It consists in calculating analytic relations between temperature and salinity from historical conductivity-temperature-depth (CTD data for the region, which are then used to hindcast/forecast the salinity and density distribution, as well as the distribution of other inferred quantities such as velocity. A hindcasting is carried out using direct independent temperature measurements obtained from a hydrographic cruise south of the island of Gran Canaria. At depths greater than 100-150 m the results show good agreement with the calculations obtained from CTD in situ data.
Arnoso, J.; Vélez, E. J.; Soler, V.; Montesinos, F. G.; Benavent, M.
2012-04-01
The volcanic island of Lanzarote is located at the northeastern end of the Canary Islands. Together with Fuerteventura Island, Lanzarote constitutes the emergent part of the East Canary Ridge, which presents a NNE-SSW volcanic alignment. Last eruptive events took place in 1824 and during the period 1730-1736, which is the largest to occur in the archipelago and throw out about 1.3 km3 of volcanic materials. The Lanzarote Geodynamic Laboratory (LGL) was created in 1986 with the idea of making Lanzarote as a natural laboratory to carry out studies in order to acquire more knowledge about its origin, present status and evolution (Vieira et al., 1991; 2006). The LGL has a multidisciplinary scientific purpose and, among others, various objectives are devoted to investigate mass distribution in the Earth system and surface displacements associated to volcanic and/or seismic activity in the island. The influence of LGL is extended throughout the whole geographical area of Lanzarote, including small islands located at the north. The laboratory has 3 observing modules distributed along the island according to its infrastructure and scientific objectives, where more than 70 sensors are recording continuously gravity variations, ground deformations, sea level, seismic activity, meteorological parameters, etc. All these observations are supplemented by periodic measurement of geodetic and geophysical networks that allow us to make studies at local, insular and regional scales. The application of geodetic and geophysical techniques to identify geodynamic signals related to volcanic processes is then a permanent research activity of the laboratory. Nowadays, this fact becomes more interesting due to the ongoing volcanic eruption that is taking place in other island of the Canary Archipelago, El Hierro, since past July 2011. That is, the multidisciplinary research carry on up to now at the LGL allow us to apply multiparameter observations of different kinds of volcanic
Zhan, Wenbin; Li, Yongqin; Sheng, Xiuzhen; Xing, Jing; Tang, Xiaoqian
2010-11-01
We isolated a strain of lymphocystis disease virus (LCDV) from Japanese flounder ( Paralichthys olivaceus) cultured in northern China. Based on published sequences of major capsid protein (MCP) gene of LCDV-cn (GenBank: AF126405), we designed two primer sets P1/P2 and P3/P4. We then used one-step or nested PCR and in-situ hybridization (ISH) to detect LCDV and identify the target tissues or cells in infected Japanese flounder. The PCR products were positive in purified viral supernatant, skin nodules, gut, gill, kidney, spleen, stomach, heart, and liver of Japanese flounder. We compared the DNA sequence with 14 MCP nucleotide sequences from GenBank, including Megalocytivirus (OFIV and RSIV), Iridovirus (CzIV and WIV), Ranavirus (TFV and FV3), and Lymphocystivirus (8 LCDV). Based on the alignment, we confirmed the PCR product was from Lymphocystivirus (GenBank accession number DQ279090 (LCDV-HD)). Using ISH, we noted the presence of LCDV in the skin nodules, gut, gill, spleen, stomach, and heart of spontaneously infected Japanese flounders. We successfully amplified LCDV fragments from Schlegel’s black rockfish ( Sebastes schlegeli Higendorf), redwing sea robin ( Lepidotrigla microptera Günther) and turbot ( Scophthalmus maximus) using the one-step and nested PCR, suggesting the target genes can be widely detected in fish using this method.
García-Portela, María; Riobó, Pilar; Rodríguez, Francisco
2017-04-01
The presence of the benthic dinophysoid dinoflagellate Sinophysis canaliculata has been reported in the Canary Islands (eastern central Atlantic) in live field observations and on fixed macroalgal samples from intertidal ponds (26 sampling sites from El Hierro, Tenerife, Gran Canaria, Fuerteventura and Lanzarote islands). In vivo Sinophysis cells were typically pale pink colored. Light microscopy and scanning electron microscopy micrographs showed a small characteristic narrow hypothecal cut that matched the original description of S. canaliculata. SSU rRNA gene (rDNA) nuclear phylogeny showed that S. canaliculata is closely related to S. microcephalus. Sinophysis specimens displayed cyanobacterial endosymbionts with orange autofluorescence from phycoerythrins. SSU rDNA analyses of the cyanobionts nearly matched a former sequence obtained from S. canaliculata in the Pacific Ocean (Japan). S. canaliculata survived up to 5 months in the original seawater samples. During that period cyanobionts were always present and maintained their orange autofluorescence, although the pink color gradually vanished (<1 month) in most individuals. Molecular similarity of Sinophysis cyanobionts from the Canary Islands and Japanese waters suggest a deterministic relationship, likely a temporary maintenance inside their host via some specific grazing system. © 2016 Phycological Society of America.
After Timanfaya: overpopulation and soil erosion in the north of Lanzarote (Canary Islands)
International Nuclear Information System (INIS)
Criado, C.; Romero, C.; Solar, V.
2009-01-01
The eruption of Timanfaya (1730-1736) has been the most important volcanic activity on Canary Islands during historical times (after XV Century). The lave flows and piroclastic layers buried at least 1/4 of Lanzarote surface. Overall the island we can see artificial cross-sections showing ash layers, overlapping paleargids soils or interbedded between alluvial sediment on the bottom of in filled valleys. Sedimentological analysis has been applied on four cross-section located along the island. These data, together with historical information and pottery remains, allow conclude a very recent age for many of this layers, produced by a strong erosion input started by the overgrazing produced by the concentration of livestock during the volcanic crisis. (Author) 6 refs.
[Lifestyle and treatment adherence of type 2 diabetes mellitus people in the Canary Islands].
de León, Antonio Cabrera; Rodríguez, José Carlos del Castillo; Coello, Santiago Domínguez; Pérez, María Del Cristo Rodríguez; Díaz, Buenaventura Brito; Alamo, Carlos Borges; Fernández, Lourdes Carrillo; González, Delia Almeida; Sánchez, José Juan Alemán; Hernández, Ana González; Aguirre-Jaime, Armando
2009-01-01
The Canary Islands population experiences the highest type 2 diabetes (DM2) mortality in Spain. We studied lifestyle, unknown DM2 and treatment adherence in diabetics of these islands. Cross-sectional study of 6729 subjects from the general population (age 18-75) that participate in the cohort study "CDC of the Canary Islands". We found out their medical problems, diet, physical activity, medications, smoking, etc. Prevalence of DM2 was 12% in men and 10% in women (p=0.005). The disease was unknown in 22% of men and 9% of women (p DM2, lack of treatment and lack of adherence, 48% of men and 28% of women did not follow a regular treatment. Diabetics' men prevalences of smoking (28%; CI(95%)=23-33) and sedentariness (62%; CI(95%)=56-68) were similar to non diabetic men, but obesity was more frequent in diabetics (45 versus 25%; p women showed a higher obesity (54 versus 27%; p < 0.001) and a lower smoking prevalence (11 versus 22%; p < 0,001) than non diabetics, but they presented a similar sedentariness (75%; CI(95%)=70-79). In both sexes, energy intake was lower in diabetics (p < 0.001), but 93% of them (CI(95%)=91-95) showed a high consumption of calories from saturated fat and 69% (CI(95%)=65-72) presented metabolic syndrome. The Canarian diabetics are a sedentary and obese population that show a high consumption of saturated fats and high prevalence of metabolic syndrome. The proportion of them following regular treatment is low, specially in diabetic men that, in addition, still smoke.
Rodríguez-Álvaro, Martín; García-Hernández, Alfonso Miguel; Brito-Brito, Pedro Ruymán; Aguirre-Jaime, Armando; Fernández-Gutiérrez, Domingo Ángel
2018-02-19
Nursing care in bereavement is complex. Primary health care is the ideal setting to support the bereaved, but we do not know much about the care plans designed by primary health care nurses in the treatment of grief. To identify the outcomes criteria and interventions planned by nurses for mourners with and without complications in the Canary Islands. Retrospective longitudinal study, using the electronic health records of the Canary Islands health service of people with a diagnosis of grieving, risk of complicated grieving and complicated grieving, in the period 2009-2014. NOC outcomes criteria were recorded in 67% of the mourners, and up to 24 different outcomes were identified. The main outcomes measures were Grief resolution; Psychosocial adjustment, Life change; Coping; Family coping; Family social climate and Caregiver emotional health. The remaining outcomes were present in less than 1% of the mourners. Although the outcomes criteria proposed by nurses in the mourners with and without complications were quite homogeneous, differences in interventions were found. In 67% of the cases, NIC interventions were reported. Ninety-nine different interventions were identified in the mourners; the most frequent were Emotional support; Grief work facilitation; Active listening; Coping enhancement and counselling. The remaining identified interventions were present in less than 5% of patients. The main interventions in the mourners with complications were Grief work facilitation; Coping enhancement; Active listening; Counselling and Family integrity promotion. Nurses state that there are more interventions and outcomes in mourners with complications. Given the few methodologically reliable studies that prove their effectiveness, continued research in this area is recommended. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.
Cosmic Magnetic Fields : XXV Canary Islands Winter School of Astrophysics
Martinez Gonzalez, Maria Jesus
2018-01-01
Magnetic fields pervade the universe and play an important role in many astrophysical processes. However, they require specialised observational tools, and are challenging to model and understand. This volume provides a unified view of magnetic fields across astrophysical and cosmological contexts, drawing together disparate topics that are rarely covered together. Written by the lecturers of the XXV Canary Islands Winter School, it offers a self-contained introduction to cosmic magnetic fields on a range of scales. The connections between the behaviours of magnetic fields in these varying contexts are particularly emphasised, from the relatively small and close ranges of the Sun, planets and stars, to galaxies and clusters of galaxies, as well as on cosmological scales. Aimed at young researchers and graduate students, this up-to-date review uniquely brings together a subject often tackled by disconnected communities, conveying the latest advances as well as highlighting the limits of our current understandi...
Geochronological constraints on the evolution of El Hierro (Canary Islands)
Becerril, Laura; Ubide, Teresa; Sudo, Masafumi; Martí, Joan; Galindo, Inés; Galé, Carlos; Morales, Jose María; Yepes, Jorge; Lago, Marceliano
2016-01-01
New age data have been obtained to time constrain the recent Quaternary volcanism of El Hierro (Canary Islands) and to estimate its recurrence rate. We have carried out 40Ar/39Ar geochronology on samples spanning the entire volcanostratigraphic sequence of the island and 14C geochronology on the most recent eruption on the northeast rift of the island: 2280 ± 30 yr BP. We combine the new absolute data with a revision of published ages onshore, some of which were identified through geomorphological criteria (relative data). We present a revised and updated chronology of volcanism for the last 33 ka that we use to estimate the maximum eruptive recurrence of the island. The number of events per year determined is 9.7 × 10-4 for the emerged part of the island, which means that, as a minimum, one eruption has occurred approximately every 1000 years. This highlights the need of more geochronological data to better constrain the eruptive recurrence of El Hierro.
Directory of Open Access Journals (Sweden)
T. ROMEO
2009-06-01
Full Text Available This study provides information on bathymetric and longitudinal distribution heterogeneity of the rockfish Helicolenus dactylopterus in the southern Tyrrhenian Sea. Data were drawn from experimental bottom trawl (1996-2002 plus bottom trap (2001-02 surveys. The frequency of occurrence and mean relative density (N/km2 and biomass (kg/km2 indexes were calculated for two survey seasons (spring and autumn, four geographic sectors and three depth strata. MANOVA was used to test fish abundance among years, sectors and strata. Analysis of the length-frequency distributions was carried out by two-way (gears and depths ANOVA, post hoc multiple comparisons for testing differences among depths and Student’s t test for testing differences between gears. Length-weight relationship was also estimated and the allometric coefficient was tested with the Student’s t test. The results showed a significant positive bathymetric gradient of sizes both for trawl and trap surveys; at same depths, fish caught by traps were significantly longer than those caught by trawl. In spring surveys, significant differences were found among strata for both abundance indexes; in autumn surveys, significant differences between depth strata were found only for density indices. The distribution and abundance patterns of H. dactylopterus along the southern Tyrrhenian Sea was homogeneous among sectors. Length-weight relationship showed a significant positive allometric growth.
García-Santos, G.; Bruijnzeel, L.A.
2011-01-01
Mixed tree-heath/beech forest is a type of subtropical montane cloud forest found on wind- and fog-exposed ridges in the Canary Islands. With a dry season of 5 months and an annual precipitation of 600-700 mm, the extra water inputs through fog interception assume particular importance in this
Many missing rings in old Canary pines can be related with age, fires and traditional uses
Energy Technology Data Exchange (ETDEWEB)
Génova, M.; Santana, C.; Martínez, B.
2017-11-01
Aim and area of study: In the present paper we estimated the age of four monumental Pinus canariensis of Gran Canaria (Canary Islands, Spain) by means of tree-ring analysis. Many tree-ring series have been accurately studied and many missing rings have been determined. Material and methods: The trees were dead and the samples analysed were big disks. We measured numerous radii and crossdated the individual tree-ring series, paying particular attention to the existence and location of missing rings. We have distinguished between missing outer rings (MORs) and missing inner rings (MIRs) and analysed the possible causes of both. Main results: We determined an average of 8.8% total missing rings (MRs) for these long-lived trees, with a maximum of 96 MRs in a series of over 500. We have tried to establish a tree-ring chronology on Gran Canaria Island, also having the tree-ring series from Inagua site, but the long individual tree-ring series analysed do not crossdate between them. Research highlights: We consider the Canary pine a species hard to conducting dendroecological studies, especially if the samples come from managed old trees, in which a large amount of known and potentially unknown missing rings can hampered dating. Even knowing the difficulties involved in dendrochronological analyses of P. canariensis, we can confirm that it is a long-lived species, which can grow to over 500 years, and some of whose growth changes could be associated with certain historical and ecological events.
Many missing rings in old Canary pines can be related with age, fires and traditional uses
International Nuclear Information System (INIS)
Génova, M.; Santana, C.; Martínez, B.
2017-01-01
Aim and area of study: In the present paper we estimated the age of four monumental Pinus canariensis of Gran Canaria (Canary Islands, Spain) by means of tree-ring analysis. Many tree-ring series have been accurately studied and many missing rings have been determined. Material and methods: The trees were dead and the samples analysed were big disks. We measured numerous radii and crossdated the individual tree-ring series, paying particular attention to the existence and location of missing rings. We have distinguished between missing outer rings (MORs) and missing inner rings (MIRs) and analysed the possible causes of both. Main results: We determined an average of 8.8% total missing rings (MRs) for these long-lived trees, with a maximum of 96 MRs in a series of over 500. We have tried to establish a tree-ring chronology on Gran Canaria Island, also having the tree-ring series from Inagua site, but the long individual tree-ring series analysed do not crossdate between them. Research highlights: We consider the Canary pine a species hard to conducting dendroecological studies, especially if the samples come from managed old trees, in which a large amount of known and potentially unknown missing rings can hampered dating. Even knowing the difficulties involved in dendrochronological analyses of P. canariensis, we can confirm that it is a long-lived species, which can grow to over 500 years, and some of whose growth changes could be associated with certain historical and ecological events
Experience of the Canary Islands in the development of insular 100% RES systems and micro-grids
Energy Technology Data Exchange (ETDEWEB)
Piernavieja, Gonzalo; Suarez, Salvador; Henriquez, Daniel [Instituto Tecnologico de Canarias (Canary Islands Institute of Technology - ITC), Las Palmas, Gran Canaria (Spain). RandD Div.
2010-07-01
Given the mentioned circumstances, conventional energy planning in the Canary Islands is a very complex task. The Regional Energy Plan PECAN (2007-2015) tries to correct the existing critical situation setting, among others, the ambitious goal of >25% electricity from RES (mostly wind) for 2015. In parallel to this conventional energy planning, outstanding initiatives in the distributed generation field are underway. ITC vision is that the Canarian Archipelago, given its particular characteristics (insular systems of different sizes, abundant RES potential -different sources-, important natural and biodiversity heritage, etc.), are a laboratory for testing and demonstrating new energy technologies in real conditions, as well as their commercial implementation. These new technologies include energy storage (particularly for excess RES that cannot be absorbed by the grids), development of 100% energy self- sufficiency models (with exclusive use of RES) and micro-/minigrids with high RES penetration and RES forecasting, including advanced ICTs and sustainable mobility concepts (e.g. V2G technologies). Given the high conventional generation costs and the relatively low RES costs (wind electricity production cost is less than 0.03 Euro/kWh), the Canary Islands could in the short term achieve grid parity, and in this sense pioneer the change to a RES based energy system. Models tested on the islands could be exported or extrapolated to our islands, regions of developing countries and even other regions in continental Europe. (orig.)
Lodge, A.; Nippress, S. E. J.; Rietbrock, A.; García-Yeguas, A.; Ibáñez, J. M.
2012-12-01
In recent years, an increasing number of studies have focussed on resolving the internal structure of ocean island volcanoes. Traditionally, active source seismic experiments have been used to image the volcano edifice. Here we present results using the analysis of compressional to shear (P to S) converted seismic phases from teleseismic events, recorded by stations involved in an active source experiment "TOM-TEIDEVS" (Ibáñez et al., 2008), on the island of Tenerife, Canary Islands. We supplement this data with receiver function (RF) analysis of seismograms from the Canary Islands of Lanzarote and La Palma, applying the extended-time multitaper frequency domain cross-correlation estimation method (Helffrich, 2006). We use the neighbourhood inversion approach of Sambridge (1999a,b) to model the RFs and our results indicate magmatic underplating exists beneath all three islands, ranging from 2 to 8 km, but showing no clear correlation with the age of the island. Beneath both La Palma and Tenerife, we find localized low velocity zones (LVZs), which we interpret as due to partial melt, supported by their correlation with the location of historical earthquakes (La Palma) and recent earthquakes (Tenerife). For Lanzarote, we do not sample the most recently volcanically active region and find no evidence for a LVZ. Instead, we find a simple gradational velocity structure, with discontinuities at ˜4, 10 and 18 km depth, in line with previous studies.
Dicty_cDB: Contig-U16210-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available omic DNA, comple... 38 7.6 3 ( EW976837 ) EST_sras_evg_784027 srasevg mixed_tissue Sebaste... ) EST_sras_evg_783643 srasevg mixed_tissue Sebastes... 32 8.7 2 ( CR382400 ) Plasmodium falciparum chromoso
Dicty_cDB: Contig-U00298-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available OK001788... 44 3.8 1 ( GE818144 ) EST_scau_evk_967951 scauevk mixed_tissue Sebaste...ras_evg_778912 srasevg mixed_tissue Sebastes... 44 3.8 1 ( BA000032 ) Vibrio parahaemolyticus RIMD 2210633 D
Ciguatera fish poisoning on the West Africa Coast: An emerging risk in the Canary Islands (Spain).
Boada, Luis D; Zumbado, Manuel; Luzardo, Octavio P; Almeida-González, Maira; Plakas, Steven M; Granade, Hudson R; Abraham, Ann; Jester, Edward L E; Dickey, Robert W
2010-12-01
Ciguatera fish poisoning (CFP) is endemic in certain tropical and subtropical regions of the world. CFP had not been described on the West Africa Coast until a 2004 outbreak in the Canary Islands. In 2008-2009, two additional outbreaks of ciguatera occurred. Individuals afflicted had consumed lesser amberjack (Seriola rivoliana) captured from nearby waters. Caribbean ciguatoxin-1 (C-CTX-1) was confirmed in fish samples by LC-MS/MS. Ciguatoxic fish in this region may pose a new health risk for the seafood consumer. Copyright © 2010 Elsevier Ltd. All rights reserved.
Additions to the flora of Tenerife (Canary Islands, Spain
Directory of Open Access Journals (Sweden)
Verloove, F.
2011-12-01
Full Text Available Additions to the flora of Tenerife (Canary Islands, Spain.- Recent fieldwork in Tenerife, especially in September 2010, yielded several interesting new records of non-native vascular plants. Bothriochloa ischaemum var. songarica, “Asian” Cardamine flexuosa, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla and Solanum abutiloides are reported for the first time from the Canary Islands, while Eragrostis barrelieri var. pygmaea, Ficus microcarpa, Ipomoea purpurea, Leucaena leucocephala subsp. glabrata, Sechium edule, Tradescantia zebrina and Turnera ulmifolia are new to the flora of the island of Tenerife. New records of Acacia cyclops, Atriplex suberecta, Heliotropium curassavicum, Paspalum dilatatum, P. notatum, Pluchea ovalis, Pulicaria paludosa, Sclerophylax spinescens and Solanum villosum subsp. miniatum confirm their recent expansion on the island of Tenerife. New records are provided for the recently described Sporobolus copei . Finally, Paspalum vaginatum (hitherto possibly confused with P. distichum and Potentilla indica are confirmed from the island of Tenerife.
Adiciones para la flora de Tenerife (Islas Canarias, España.- Algunos recientes trabajos de campo en Tenerife, especialmente en Septiembre de 2010, trajeron consigo varias nuevas e interesantes adiciones de plantas vasculares no autóctonas. Bothriochloa ischaemum var. songarica, Cardamine flexuosa “Asiática”, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla y
Assessing qualitative long-term volcanic hazards at Lanzarote Island (Canary Islands)
Becerril, Laura; Martí, Joan; Bartolini, Stefania; Geyer, Adelina
2017-07-01
Conducting long-term hazard assessment in active volcanic areas is of primary importance for land-use planning and defining emergency plans able to be applied in case of a crisis. A definition of scenario hazard maps helps to mitigate the consequences of future eruptions by anticipating the events that may occur. Lanzarote is an active volcanic island that has hosted the largest (> 1.5 km3 DRE) and longest (6 years) eruption, the Timanfaya eruption (1730-1736), on the Canary Islands in historical times (last 600 years). This eruption brought severe economic losses and forced local people to migrate. In spite of all these facts, no comprehensive hazard assessment or hazard maps have been developed for the island. In this work, we present an integrated long-term volcanic hazard evaluation using a systematic methodology that includes spatial analysis and simulations of the most probable eruptive scenarios.
Opatova, Vera; Arnedo, Miquel A.
2014-01-01
Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In
Directory of Open Access Journals (Sweden)
Vera Opatova
Full Text Available Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source
Opatova, Vera; Arnedo, Miquel A
2014-01-01
Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In
Bolaños-Rivero, Margarita; Carranza-Rodríguez, Cristina; Rodríguez, Noe F; Gutiérrez, Carlos; Pérez-Arellano, José-Luis
2017-09-01
Coxiella burnetii, the etiological agent of human Q fever, can infect mammals, birds, and arthropods. The Canary Islands (Spain) are considered an endemic territory, with a high prevalence in both humans and livestock. Nonetheless, there is no epidemiological information about the wild and peridomestic cycles of C. burnetii. Tissue samples from rodents on farms (100) and wild rabbits (129) were collected and assessed by PCR to detect C. burnetii DNA. In parallel, ticks were also collected from vegetation (1169), livestock (335), domestic dogs (169), and wild animals (65). Globally, eight rodents (8%) and two rabbits (1.5%) were found to be positive, with the spleen being the most affected organ. Tick species identified were Hyalomma lusitanicum, Rhipicephalus turanicus, Rhipicephalus sanguineus, and Rhipicephalus pusillus. Hyalomma lusitanicum (80%) was the main species identified in vegetation, livestock, and wild animals, whereas Rhipicephalus sanguineus was the most prevalent in domestic dogs. Overall, C. burnetii DNA was detected in 6.1% of the processed ticks, distributed between those removed from livestock (11.3%), domestic dogs (6.9%), and from wild animals (6%). Ticks from vegetation were all negative. Results suggest that, in the Canary Islands, C. burnetii develops in a peridomestic rather than a wild cycle.
Directory of Open Access Journals (Sweden)
Florencia Thul Charbonnier
2017-06-01
Full Text Available This article analyzes the experiences of colonization from the Canary Islands driven by private entrepreneurs and backed by the Uruguayan State during the 1830s. This was a special type of immigration, close to indenture servitude, where individuals moving across the continents signed a contract that forced them to keep working in Uruguay until the debt they had incurred (the cost of their maritime passage was repaid. The Uruguayan State, through the police, was both the guarantor and enforcer of these contracts.
Ariza, A.
2016-01-21
Diel vertical migration (DVM) facilitates biogeochemical exchanges between shallow waters and the deep ocean. An effective way of monitoring the migrant biota is by acoustic observations although the interpretation of the scattering layers poses challenges. Here we combine results from acoustic observations at 18 and 38 kHz with limited net sampling in order to unveil the origin of acoustic phenomena around the Canary Islands, subtropical northeast Atlantic Ocean. Trawling data revealed a high diversity of fishes, decapods and cephalopods (152 species), although few dominant species likely were responsible for most of the sound scattering in the region. We identified four different acoustic scattering layers in the mesopelagic realm: (1) at 400–500 m depth, a swimbladder resonance phenomenon at 18 kHz produced by gas-bearing migrant fish such as Vinciguerria spp. and Lobianchia dofleini, (2) at 500–600 m depth, a dense 38 kHz layer resulting primarily from the gas-bearing and non-migrant fish Cyclothone braueri, and to a lesser extent, from fluid-like migrant fauna also inhabiting these depths, (3) between 600 and 800 m depth, a weak signal at both 18 and 38 kHz ascribed either to migrant fish or decapods, and (4) below 800 m depth, a weak non-migrant layer at 18 kHz which was not sampled. All the dielly migrating layers reached the epipelagic zone at night, with the shorter-range migrations moving at 4.6 ± 2.6 cm s − 1 and the long-range ones at 11.5 ± 3.8 cm s − 1. This work reduces uncertainties interpreting standard frequencies in mesopelagic studies, while enhances the potential of acoustics for future research and monitoring of the deep pelagic fauna in the Canary Islands.
Ariza, A.; Landeira, J.M.; Escá nez, A.; Wienerroither, R.; Aguilar de Soto, N.; Rø stad, Anders; Kaartvedt, S.; Herná ndez-Leó n, S.
2016-01-01
Diel vertical migration (DVM) facilitates biogeochemical exchanges between shallow waters and the deep ocean. An effective way of monitoring the migrant biota is by acoustic observations although the interpretation of the scattering layers poses challenges. Here we combine results from acoustic observations at 18 and 38 kHz with limited net sampling in order to unveil the origin of acoustic phenomena around the Canary Islands, subtropical northeast Atlantic Ocean. Trawling data revealed a high diversity of fishes, decapods and cephalopods (152 species), although few dominant species likely were responsible for most of the sound scattering in the region. We identified four different acoustic scattering layers in the mesopelagic realm: (1) at 400–500 m depth, a swimbladder resonance phenomenon at 18 kHz produced by gas-bearing migrant fish such as Vinciguerria spp. and Lobianchia dofleini, (2) at 500–600 m depth, a dense 38 kHz layer resulting primarily from the gas-bearing and non-migrant fish Cyclothone braueri, and to a lesser extent, from fluid-like migrant fauna also inhabiting these depths, (3) between 600 and 800 m depth, a weak signal at both 18 and 38 kHz ascribed either to migrant fish or decapods, and (4) below 800 m depth, a weak non-migrant layer at 18 kHz which was not sampled. All the dielly migrating layers reached the epipelagic zone at night, with the shorter-range migrations moving at 4.6 ± 2.6 cm s − 1 and the long-range ones at 11.5 ± 3.8 cm s − 1. This work reduces uncertainties interpreting standard frequencies in mesopelagic studies, while enhances the potential of acoustics for future research and monitoring of the deep pelagic fauna in the Canary Islands.
Antonkiewicz, Jacek; Kołodziej, Barbara; Bielińska, Elżbieta Jolanta
2016-05-01
The application of municipal sewage sludge on energy crops is an alternative form of recycling nutrients, food materials, and organic matter from waste. Municipal sewage sludge constitutes a potential source of heavy metals in soil, which can be partially removed by the cultivation of energy crops. The aim of the research was to assess the effect of municipal sewage sludge on the uptake of heavy metals by monocotyledonous energy crops. Sewage sludge was applied at doses of 0, 10, 20, 40, and 60 Mg DM · ha(-1) once, before the sowing of plants. In a 6-year field experiment, the effect of four levels of fertilisation with sewage sludge on the uptake of heavy metals by two species of energy crops, reed canary grass (Phalaris arundinacea L.) of 'Bamse' cultivar and giant miscanthus (Miscanthus × giganteus GREEF et DEU), was analysed. It was established that the increasing doses of sewage sludge had a considerable effect on the increase in biomass yield from the tested plants. Due to the increasing doses of sewage sludge, a significant increase in heavy metals content in the energy crops was recorded. The heavy metal uptake with the miscanthus yield was the highest at a dose of 20 Mg DM · ha(-1), and at a dose of 40 Mg DM · ha(-1) in the case of reed canary grass. Research results indicate that on account of higher yields, higher bioaccumulation, and higher heavy metal uptake, miscanthus can be selected for the remediation of sewage sludge.
Radon Exposures in the Caves of Tenerife (Canary Islands)
International Nuclear Information System (INIS)
Pinza-Molina, C.; Alcaide, J.M.; Rodriques-Bethencourt, R.; Hernandez-Armas, J.
1999-01-01
There are more than a hundred volcanic caves and pits of various lengths on the island of Tenerife (Canary Islands, Spain). The results are presented of atmospheric radon measurements performed in three of these caves and in three pits. One of the caves selected, El Viento Cave, is nearly 20 km in length and is the longest volcanic tube in the Canarian archipelago and the second longest in the world. The measurements were performed over two distinct periods during the year using passive polycarbonate detectors. The mean radon concentrations range between 0.3 and 8 kBq.m -3 , the maximum value corresponds to a site located at 1850 m from the mouth of El Viento Cave. Possible touristic development of these caves has been taken into account in estimating the effective doses for visitors and guides (considered separately). The values obtained range from 0.3 to 100 μSv per visit for visitors. The largest effective dose would correspond to that for guides at 41 mSv.y -1 in the Viento Cave. This result would make protection against radiological hazards obligatory if the cave were to be developed as a site for tourism. (author)
Recirculation of the Canary Current in Fall
Hernandez-Guerra, A.; Espino-Falcón, E.; Vélez-Belchí, P.; Pérez-Hernández, M. D.; Martínez, A.; Cana, L.
2015-12-01
CTD and LADCP data measured in October 2014 are used to describe water masses, geostrophic circulation and mass transport in the Eastern Boundary of the North Atlantic Subtropical Gyre. Initial geostrophic velocities are adjusted to velocities from the LADCP data to estimate an initial velocity at the reference layer. Final reference velocities and consequently circulation is estimated from an inverse box model applied to an ocean divided into 12 neutral density layers. This allows us to evaluate mass fluxes consistent with the thermal wind equation and mass conservation. Ekman transport derived from the Weather Research and Forecasting (WRF) model is added to the first layer and adjusted with the inverse model. The Canary Current (CC) transports southward a net mass of 3.8±0.7 Sv (1 Sv=106 m3/s≈109 kg/s) of North Atlantic Central Water (NACW) at the thermocline layers (~0-700 m) and 1.9±0.6 Sv of a mixture of Mediterranean Water (MW) and Antarctic Intermediate Water (AAIW) at intermediate layers (~800-1400 m). The CC recirculates northward at a rate of 4.8±0.8 Sv at the thermocline layers between the Lanzarote Island and the African coast (Lanzarote Passage) on this occasion. Separately, at intermediate layers, AAIW flows northward at a rate of 2.4±0.6 Sv through the Lanzarote Passage transported by the Intermediate Poleward Undercurrent (IPUC).
Longpré, Marc-Antoine; Troll, Valentin R.; Walter, Thomas R.; Hansteen, Thor H.
2009-01-01
Large-scale, catastrophic mass wasting is a major process contributing to the dismantling of oceanic intraplate volcanoes. Recent studies, however, have highlighted a possible feedback relationship between flank collapse, or incipient instability, and subsequent episodes of structural rearrangement and/or renewed volcano growth. The Teno massif, located in northwestern Tenerife (Canary Islands), is a deeply eroded Miocene shield volcano that was built in four major eruptive phases punctuated ...
Marrero, C.; Jorba, O.; Cuevas, E.; Baldasano, J. M.
2009-01-01
In November 2005 an extratropical storm named Delta affected the Canary Islands (Spain). The high sustained wind and intense gusts experienced caused significant damage. A numerical sensitivity study of Delta was conducted using the Weather Research & Forecasting Model (WRF-ARW). A total of 27 simulations were performed. Non-hydrostatic and hydrostatic experiments were designed taking into account physical parameterizations and geometrical factors (size and position of the outer domain, d...
Upgraded fuel from reed canary grass
Energy Technology Data Exchange (ETDEWEB)
Heiskanen, V.P.
1995-12-31
The feasibility of RCG for commercial utilization depends primarily on its applicability for pulp production and its use in energy production will be based on the residue that will be available after extracting the pulp fraction of the RCG. Roughly 20 ..30% of the material will be available for energy production purposes. However, the percentage may be higher/lower depending on the quality standards of the pulp fiber material. The harvesting period has a significant effect on the fuel characteristics of RCG. For instance the contents of N, S, Cl, K are clearly lower if the RCG is harvested in the spring (delayed) instead of summer/autumn. These elements affect significantly overall emission formation and ash behaviour and its melting temperature. The combustion related research in this project has been focused on the spring-harvested RCG. The project aims to evaluate the feasibility of delayed harvested RCG for energy production. In order to reach this goal, the following combustion methods will be tested and studied: combustion of pelletized RCG; gasification; combustion of pulverized RCG. In addition, pelletizing, reactivity and NO conversion of pulverized RCG will be studied. The research described here is a part of `Reed Canary Grass` project (in AIR programme). The contractors of the project are Swedish University of Agricultural Sciences (coordinator), United Milling Systems from Denmark, Jaakko Poeyry Oy and VTT Energy. In addition, there are partners from several countries participating in the project. The project has been divided in five tasks, VTT Energy being responsible for combustion related task `Upgraded fuel` that includes the research topics discussed in this paper
Upgraded fuel from reed canary grass
Energy Technology Data Exchange (ETDEWEB)
Heiskanen, V P
1996-12-31
The feasibility of RCG for commercial utilization depends primarily on its applicability for pulp production and its use in energy production will be based on the residue that will be available after extracting the pulp fraction of the RCG. Roughly 20 ..30% of the material will be available for energy production purposes. However, the percentage may be higher/lower depending on the quality standards of the pulp fiber material. The harvesting period has a significant effect on the fuel characteristics of RCG. For instance the contents of N, S, Cl, K are clearly lower if the RCG is harvested in the spring (delayed) instead of summer/autumn. These elements affect significantly overall emission formation and ash behaviour and its melting temperature. The combustion related research in this project has been focused on the spring-harvested RCG. The project aims to evaluate the feasibility of delayed harvested RCG for energy production. In order to reach this goal, the following combustion methods will be tested and studied: combustion of pelletized RCG; gasification; combustion of pulverized RCG. In addition, pelletizing, reactivity and NO conversion of pulverized RCG will be studied. The research described here is a part of `Reed Canary Grass` project (in AIR programme). The contractors of the project are Swedish University of Agricultural Sciences (coordinator), United Milling Systems from Denmark, Jaakko Poeyry Oy and VTT Energy. In addition, there are partners from several countries participating in the project. The project has been divided in five tasks, VTT Energy being responsible for combustion related task `Upgraded fuel` that includes the research topics discussed in this paper
Aridity, desalination plants and tourism in the eastern Canary Islands
Directory of Open Access Journals (Sweden)
José-León García-Rodríguez
2016-05-01
Full Text Available The islands of Lanzarote and Fuerteventura are the easternmost of the Canary Islands, and are located on the southern edge of the temperate zone, in the subtropical anticyclone belt. With less than 150 mm of rainfall a year, they are classified as an arid zone. Their inhabitants have devised original agricultural systems to combat the aridity, although low yields have historically limited socio-economic development and population growth. These systems were used until the introduction of seawater desalination plants and the arrival of tourism in the last third of the twentieth century, which improved living standards for the local population but also led to a cultural transition. Nevertheless, these farming systems have left behind an important regional heritage, with an environmental and scenic value that has played an integral role in the latest phase of development. The systems have become a tourist attraction and have been central to the two islands being designated biosphere reserves by UNESCO. This article aims to analyse the main socioeconomic and land-use changes that have come about as a result of desalination technology.
Assessing qualitative long-term volcanic hazards at Lanzarote Island (Canary Islands
Directory of Open Access Journals (Sweden)
L. Becerril
2017-07-01
Full Text Available Conducting long-term hazard assessment in active volcanic areas is of primary importance for land-use planning and defining emergency plans able to be applied in case of a crisis. A definition of scenario hazard maps helps to mitigate the consequences of future eruptions by anticipating the events that may occur. Lanzarote is an active volcanic island that has hosted the largest (> 1.5 km3 DRE and longest (6 years eruption, the Timanfaya eruption (1730–1736, on the Canary Islands in historical times (last 600 years. This eruption brought severe economic losses and forced local people to migrate. In spite of all these facts, no comprehensive hazard assessment or hazard maps have been developed for the island. In this work, we present an integrated long-term volcanic hazard evaluation using a systematic methodology that includes spatial analysis and simulations of the most probable eruptive scenarios.
Dicty_cDB: Contig-U14691-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available eus mitochondrial gene for 16S... 34 0.077 3 ( EW986758 ) EST_sras_evg_779179 srasevg mixed_tissue Sebastes...... 38 0.079 2 ( EW986759 ) EST_sras_evg_779563 srasevg mixed_tissue Sebastes... 38 0.079 2 ( CP001078 ) Clos
National Oceanic and Atmospheric Administration, Department of Commerce — The focus of this cruise leg was physical oceanography of the area between the Canaries and the Azores within the program of the SFB 133 'Warm water sphere of the...
Dicty_cDB: Contig-U12374-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 372F20, 5'... 48 0.38 1 ( EW983915 ) EST_sras_evg_776173 srasevg mixed_tissue Sebastes... 48 0.38 1 ( EW9839...14 ) EST_sras_evg_775789 srasevg mixed_tissue Sebastes... 48 0.38 1 ( CP000382 ) Clostridium novyi NT, compl
Santana, Jonathan; Fregel, Rosa; Lightfoot, Emma; Morales, Jacob; Alamón, Martha; Guillén, José; Moreno, Marco; Rodríguez, Amelia
2016-02-01
The Canary Islands are considered one of the first places where Atlantic slave plantations with labourers of African origin were established, during the 15th century AD. In Gran Canaria (Canary Islands, Spain), a unique cemetery dated to the 15th and 17th centuries was discovered adjacent to an ancient sugar plantation with funerary practices that could be related to enslaved people. In this article, we investigate the origin and possible birthplace of each individual buried in this cemetery, as well as the identity and social status of these people. The sample consists of 14 individuals radiocarbon dated to the 15th and 17th centuries AD. We have employed several methods, including the analysis of ancient human DNA, stable isotopes, and skeletal markers of physical activity. 1) the funerary practices indicate a set of rituals not previously recorded in the Canary Islands; 2) genetic data show that some people buried in the cemetery could have North-African and sub-Saharan African lineages; 3) isotopic results suggest that some individuals were born outside Gran Canaria; and 4) markers of physical activity show a pattern of labour involving high levels of effort. This set of evidence, along with information from historical sources, suggests that Finca Clavijo was a cemetery for a multiethnic marginalized population that had being likely enslaved. Results also indicate that this population kept practicing non-Christian rituals well into the 17th century. We propose that this was possible because the location of the Canaries, far from mainland Spain and the control of the Spanish Crown, allowed the emergence of a new society with multicultural origins that was more tolerant to foreign rituals and syncretism. © 2015 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Kramer, Sharon H. [H. T. Harvey & Associates, Honolulu, HI (United States); Hamilton, Christine D. [H. T. Harvey & Associates, Honolulu, HI (United States); Spencer, Gregory C. [H. T. Harvey & Associates, Honolulu, HI (United States); Ogston, Heather O. [H. T. Harvey & Associates, Honolulu, HI (United States)
2015-05-12
Wave energy converters (WECs) and tidal energy converters (TECs) are only beginning to be deployed along the U.S. West Coast and in Hawai‘i, and a better understanding of their ecological effects on fish, particularly on special-status fish (e.g., threatened and endangered) is needed to facilitate project design and environmental permitting. The structures of WECs and TECs placed on to the seabed, such as anchors and foundations, may function as artificial reefs that attract reef-associated fishes, while the midwater and surface structures, such as mooring lines, buoys, and wave or tidal power devices, may function as fish aggregating devices (FADs), forming the nuclei for groups of fishes. Little is known about the potential for WECs and TECs to function as artificial reefs and FADs in coastal waters of the U.S. West Coast and Hawai‘i. We evaluated these potential ecological interactions by reviewing relevant information about fish associations with surrogate structures, such as artificial reefs, natural reefs, kelps, floating debris, oil and gas platforms, marine debris, anchored FADs deployed to enhance fishing opportunities, net-cages used for mariculture, and piers and docks. Based on our review, we postulate that the structures of WECs and TECs placed on or near the seabed in coastal waters of the U.S. West Coast and Hawai‘i likely will function as small-scale artificial reefs and attract potentially high densities of reef-associated fishes (including special-status rockfish species [Sebastes spp.] along the mainland), and that the midwater and surface structures of WECs placed in the tropical waters of Hawai‘i likely will function as de facto FADs with species assemblages varying by distance from shore and deployment depth. Along the U.S. West Coast, frequent associations with midwater and surface structures may be less likely: juvenile, semipelagic, kelp-associated rockfishes may occur at midwater and surface structures of WECs in coastal waters of
Low permeability volcanics in the Canary Islands (Spain)
International Nuclear Information System (INIS)
Custodio, E.
1985-01-01
The Canary Islands, about 2000 km to the SW of continental Spain, are fully volcanic, from mid Miocene to recent. The permeability of the formations depends very much on the age and lithology. In most instances young, pervious basalts are devoid of water due to their altitude and most water abstraction works must go into the underlaying, much less pervious, older formations. Long water galleries or large diameter wells fitted with a crown of horizontal bores are able to catch significant quantities of water from formations which permeability is less than 0.1 m/day. The anisotropic behavior of the formations, specially due to the injection of subvertical dykes parallel to the coast, explains the high hydraulic gradient found, up to 0.15, and the relative high yield of the wells and galleries. The specific yield of the volcanics is fairly high, about 0.02 to 0.05, thus allowing the use of reserves to supply the demand. Conventional finite-difference models give a sound picture of the groundwater behavior but preliminary adjustments of the hydraulic parameters need the study of simplified cross-sections. The study of the chemical characteristics of groundwater is a key factor in the understanding of groundwater flow. The discussion refers mainly to Lanzarote, Tenerife and Gran Canaria Islands, but some comment will use information from other islands. 23 references, 10 figures, 2 tables
Minchin, Dan
2012-10-01
A rapid assessment, using the abundance and distribution range method, was used to evaluate the status of a large branching bryozoan, Zoobotryon verticillatum attached to the immersed part of marina pontoons in the Canary Islands. Colonies were also found attached to the hulls of leisure craft berthed alongside pontoons at three marinas in Lanzarote during 2012. Low levels of abundance and distribution of the bryozoan occurred in marinas with a freshwater influence whereas in a sheltered marina lacking direct freshwater inputs colonies occurred at ∼2 per metre of combined pontoon length. While the occurrence of this bryozoan is recent it may be expected to occur elsewhere in Macaronesia most probably spread by leisure craft. Copyright © 2012 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Sipilae, K. [VTT Energy, Espoo (Finland). Energy Production Technologies
1995-12-31
The target of this project is to investigate if rape seed based fuel oil and diesel fuel component, agrofiber and solid fuel from other annual crops could be produced effectively as an alternative to existing non economical biodiesel-RME and ethanol production. Without heavy tax incentives the biodiesel and grain ethanol can not compete with conventional liquid fuels, the present EU fuel tax legislation will not permit any permanent tax incentives for commercial scale operations. Based on several studies by VTT the rape seed oil will be 30 % cheaper than RME and the utilization as a component 10-30 % blended to heating oil or diesel fuel might the most flexible solution. Neste Oy has carried out the combustion tests with 20 kW boiler and VTT the diesel engine tests with 20 % unprocessed rape seed oil mixtures, the oil was delivered by Mildola Oy. For the co-utilization of annual crops and straw, several laboratory scale combustion and flash pyrolysis tests have been carried out by VTT with straw, reed canary grass etc. In a flash pyrolysis process, the alkalies will remain in the char and a low alkali level bio oils can be produced. As a final step in order to reach the zero subsidy target, an extensive laboratory work is carried out to produce agrofibre from flax, reed canary grass and wheat straw. During the next months an overall economic calculations will be carried out in Finnish, Danish and Italian conditions as an EU-Apas project in order to see the competitiveness of such integrated concepts to conventional RME and reed canary grass combustion
Energy Technology Data Exchange (ETDEWEB)
Sipilae, K [VTT Energy, Espoo (Finland). Energy Production Technologies
1996-12-31
The target of this project is to investigate if rape seed based fuel oil and diesel fuel component, agrofiber and solid fuel from other annual crops could be produced effectively as an alternative to existing non economical biodiesel-RME and ethanol production. Without heavy tax incentives the biodiesel and grain ethanol can not compete with conventional liquid fuels, the present EU fuel tax legislation will not permit any permanent tax incentives for commercial scale operations. Based on several studies by VTT the rape seed oil will be 30 % cheaper than RME and the utilization as a component 10-30 % blended to heating oil or diesel fuel might the most flexible solution. Neste Oy has carried out the combustion tests with 20 kW boiler and VTT the diesel engine tests with 20 % unprocessed rape seed oil mixtures, the oil was delivered by Mildola Oy. For the co-utilization of annual crops and straw, several laboratory scale combustion and flash pyrolysis tests have been carried out by VTT with straw, reed canary grass etc. In a flash pyrolysis process, the alkalies will remain in the char and a low alkali level bio oils can be produced. As a final step in order to reach the zero subsidy target, an extensive laboratory work is carried out to produce agrofibre from flax, reed canary grass and wheat straw. During the next months an overall economic calculations will be carried out in Finnish, Danish and Italian conditions as an EU-Apas project in order to see the competitiveness of such integrated concepts to conventional RME and reed canary grass combustion
Figueira Gonçalves, Juan Marco; Dorta Sánchez, Rafael; Rodri Guez Pérez, María Del Cristo; Viña Manrique, Pedro; Díaz Pérez, David; Guzmán Saenz, Cristina; Palmero Tejera, Juan Manuel; Pérez Rodríguez, Alicia; Pérez Negrín, Lorenzo
Numerous studies have shown a high prevalence of cardiovascular disease in patients with chronic obstructive pulmonary disease (COPD). The aim of this study was to analyse the prevalence of cardiovascular risk factors and comorbidity in a Canary Islands population diagnosed with COPD, and compared it with data from the general population. A cross-sectional study was carried out in 300 patients with COPD and 524 subjects without respiratory disease (control group). The two groups were compared using standard bivariate methods. Logistic regression models were used to estimate the cardiovascular risks in COPD patients compared to control group. Patients with COPD showed a high prevalence of hypertension (72%), dyslipidaemia (73%), obesity (41%), diabetes type 2 (39%), and sleep apnoea syndrome (30%) from mild stages of the disease (GOLD 2009). There was a 22% prevalence of cardiac arrhythmia, 16% of ischaemic heart disease, 16% heart failure, 12% peripheral vascular disease, and 8% cerebrovascular disease. Compared to the control group, patients with COPD had a higher risk of dyslipidaemia (OR 3.24, 95% CI; 2.21-4.75), diabetes type 2 (OR 1.52, 95% CI; 1.01-2,28), and ischaemic heart disease (OR 2.34, 95% CI; 1.22-4.49). In the case of dyslipidaemia, an increased risk was obtained when adjusted for age, gender, and consumption of tobacco (OR 5.04, 95% CI; 2.36-10.74). Patients with COPD resident in the Canary Islands have a high prevalence of hypertension, dyslipidaemia, ischaemic heart disease, and cardiac arrhythmia. Compared to general population, patients with COPD have a significant increase in the risk of dyslipidaemia. Copyright © 2017 Sociedad Española de Arteriosclerosis. Publicado por Elsevier España, S.L.U. All rights reserved.
Pedrazzi, Dario; Martí, Joan; Geyer, Adelina
2013-07-01
The tuff cone of El Golfo on the western coast of Lanzarote (Canary Islands) is a typical hydrovolcanic edifice. Along with other edifices of the same age, it was constructed along a fracture oriented NEE-SWW that coincides with the main structural trend of recent volcanism in this part of the island. We conducted a detailed stratigraphic study of the succession of deposits present in this tuff cone and here interpret them in light of the depositional processes and eruptive dynamics that we were able to infer. The eruptive sequence is represented by a succession of pyroclastic deposits, most of which were emplaced by flow, plus a number of air-fall deposits and ballistic blocks and bombs. We distinguished five different eruptive/depositional stages on the basis of differences in inferred current flow regimes and fragmentation efficiencies represented by the resulting deposits; the different stages may be related to variations in the explosive energy. Eight lithofacies were identified based on sedimentary discontinuities, grain size, components, variations in primary laminations and bedforms. The volcanic edifice was constructed very rapidly around the vent, and this is inferred to have controlled the amount of water that was able to enter the eruption conduit. The sedimentological characteristics of the deposits and the nature and distribution of palagonitic alteration suggest that most of the pyroclastic succession in El Golfo was deposited in a subaerial environment. This type of hydrovolcanic explosive activity is common in the coastal zones of Lanzarote and the other Canary Islands and is one of the main potential hazards that could threaten the human population of this archipelago. Detailed studies of these hydrovolcanic eruptions such as the one we present here can help volcanologists understand the hazards that this type of eruption can generate and provide essential information for undertaking risk assessment in similar volcanic environments.
Dicty_cDB: Contig-U01337-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available sophila willi... 34 5.4 2 ( GE797277 ) EST_scau_evk_889972 scauevk mixed_tissue Sebastes... 34 5.4 2 ( AC123...888797 ) CeleSEQ6116 Cunninghamella elegans pBluescript (E... 38 5.5 2 ( GE797278 ) EST_scau_evk_888052 scauevk mixed_tissue Sebaste
Dicty_cDB: Contig-U14789-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available srasevg mixed_tissue Sebastes... 58 2e-04 1 ( EW978379 ) EST_sras_evg_773311 srasevg mixed_tissue Sebaste...FC752071 ) CBBI6157.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 58 2e-04 1 ( EW978380 ) EST_sras_evg_777535
von Suchodoletz, H.; Zöller, L.; Hilgers, A.; Radtke, U.; Faust, D.
2012-04-01
The Canary Islands are located at the transition between the Mediterranean and the Saharan climate off NW-Africa. Thus, they are a key area for the investigation of palaeoenvironmental changes. Several terrestrial studies investigated the palaeoenvironmental development of that region during the later part of the last glacial cycle. However, apart from recent investigations of "vega" sediments on Lanzarote Island (Suchodoletz et al. 2010) the palaeoenvironmental evolution during the Middle Pleistocene is hardly studied yet, basically due to the lack of reliable geochronological data. The Mála dune-palaeosol-sequence is located in the north of Lanzarote. It consists of marine shell detritus originally blown out from the insular shelf during periods of low global sea level, and to a small part of Saharan dust and fine quartz sand. The aeolian layers are intercalated with up to eight silty-clayey palaeosol horizons. Unlike the dune sands, the soils indicate stable landscape conditions with trapping of Saharan dust. Using a combination of ESR and luminescence dating techniques, we are able to place this sequence into the Middle Pleistocene, in contrast to former investigations based on 14C datings postulating a Late Pleistocene age (Ortiz et al. 2006). As a consequence, clayey-silty palaeosols represent periods of stable landscape conditions in the Canarian region during the Middle Pleistocene, which we compare with marine palaeoclimatic studies from the area.
Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.
Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V
2012-01-01
Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.
Fais, Andrea; Lewis, Tim P.; Zitterbart, Daniel P.; Álvarez, Omar; Tejedor, Ana; Aguilar Soto, Natacha
2016-01-01
Sperm whales are present in the Canary Islands year-round, suggesting that the archipelago is an important area for this species in the North Atlantic. However, the area experiences one of the highest reported rates of sperm whale ship-strike in the world. Here we investigate if the number of sperm whales found in the archipelago can sustain the current rate of ship-strike mortality. The results of this study may also have implications for offshore areas where concentrations of sperm whales may coincide with high densities of ship traffic, but where ship-strikes may be undocumented. The absolute abundance of sperm whales in an area of 52933 km2, covering the territorial waters of the Canary Islands, was estimated from 2668 km of acoustic line-transect survey using Distance sampling analysis. Data on sperm whale diving and acoustic behaviour, obtained from bio-logging, were used to calculate g(0) = 0.92, this is less than one because of occasional extended periods when whales do not echolocate. This resulted in an absolute abundance estimate of 224 sperm whales (95% log-normal CI 120–418) within the survey area. The recruitment capability of this number of whales, some 2.5 whales per year, is likely to be exceeded by the current ship-strike mortality rate. Furthermore, we found areas of higher whale density within the archipelago, many coincident with those previously described, suggesting that these are important habitats for females and immature animals inhabiting the archipelago. Some of these areas are crossed by active shipping lanes increasing the risk of ship-strikes. Given the philopatry in female sperm whales, replacement of impacted whales might be limited. Therefore, the application of mitigation measures to reduce the ship-strike mortality rate seems essential for the conservation of sperm whales in the Canary Islands. PMID:26999791
Directory of Open Access Journals (Sweden)
Andrea Fais
Full Text Available Sperm whales are present in the Canary Islands year-round, suggesting that the archipelago is an important area for this species in the North Atlantic. However, the area experiences one of the highest reported rates of sperm whale ship-strike in the world. Here we investigate if the number of sperm whales found in the archipelago can sustain the current rate of ship-strike mortality. The results of this study may also have implications for offshore areas where concentrations of sperm whales may coincide with high densities of ship traffic, but where ship-strikes may be undocumented. The absolute abundance of sperm whales in an area of 52933 km2, covering the territorial waters of the Canary Islands, was estimated from 2668 km of acoustic line-transect survey using Distance sampling analysis. Data on sperm whale diving and acoustic behaviour, obtained from bio-logging, were used to calculate g(0 = 0.92, this is less than one because of occasional extended periods when whales do not echolocate. This resulted in an absolute abundance estimate of 224 sperm whales (95% log-normal CI 120-418 within the survey area. The recruitment capability of this number of whales, some 2.5 whales per year, is likely to be exceeded by the current ship-strike mortality rate. Furthermore, we found areas of higher whale density within the archipelago, many coincident with those previously described, suggesting that these are important habitats for females and immature animals inhabiting the archipelago. Some of these areas are crossed by active shipping lanes increasing the risk of ship-strikes. Given the philopatry in female sperm whales, replacement of impacted whales might be limited. Therefore, the application of mitigation measures to reduce the ship-strike mortality rate seems essential for the conservation of sperm whales in the Canary Islands.
Fais, Andrea; Lewis, Tim P; Zitterbart, Daniel P; Álvarez, Omar; Tejedor, Ana; Aguilar Soto, Natacha
2016-01-01
Sperm whales are present in the Canary Islands year-round, suggesting that the archipelago is an important area for this species in the North Atlantic. However, the area experiences one of the highest reported rates of sperm whale ship-strike in the world. Here we investigate if the number of sperm whales found in the archipelago can sustain the current rate of ship-strike mortality. The results of this study may also have implications for offshore areas where concentrations of sperm whales may coincide with high densities of ship traffic, but where ship-strikes may be undocumented. The absolute abundance of sperm whales in an area of 52933 km2, covering the territorial waters of the Canary Islands, was estimated from 2668 km of acoustic line-transect survey using Distance sampling analysis. Data on sperm whale diving and acoustic behaviour, obtained from bio-logging, were used to calculate g(0) = 0.92, this is less than one because of occasional extended periods when whales do not echolocate. This resulted in an absolute abundance estimate of 224 sperm whales (95% log-normal CI 120-418) within the survey area. The recruitment capability of this number of whales, some 2.5 whales per year, is likely to be exceeded by the current ship-strike mortality rate. Furthermore, we found areas of higher whale density within the archipelago, many coincident with those previously described, suggesting that these are important habitats for females and immature animals inhabiting the archipelago. Some of these areas are crossed by active shipping lanes increasing the risk of ship-strikes. Given the philopatry in female sperm whales, replacement of impacted whales might be limited. Therefore, the application of mitigation measures to reduce the ship-strike mortality rate seems essential for the conservation of sperm whales in the Canary Islands.
Rybak, Fanny; Gahr, Manfred
2004-06-01
The respective influence of testosterone and estradiol on the structure of the Common Canary Serinus canaria song was studied by experimentally controlling blood levels of steroid hormones in males and analyzing the consequent effects on acoustic parameters. A detailed acoustic analysis of the songs produced before and after hormonal manipulation revealed that testosterone and estradiol seem to control distinct song parameters independently. The presence of receptors for testosterone and estradiol in the brain neural pathway controlling song production strongly suggests that the observed effects are mediated by a steroid action at the neuronal level.
Madison, Farrah N.; Rouse, Melvin L.; Balthazart, Jacques; Ball, Gregory F
2014-01-01
In songbirds, such as canaries (Serinus canaria), the song control circuit has been shown to undergo a remarkable change in morphology in response to exogenous testosterone (T). It is also well established that HVC, a telencephalic nucleus involved in song production, is significantly larger in males than in females. T regulates seasonal changes in HVC volume in males and exposure to exogenous T in adult females increases HVC volume and singing activity such that their song becomes more male-like in frequency and structure. However, whether there are sex differences in the ability of T to modulate changes in the song system and song behavior has not been investigated in canaries. In this study, we compared the effects of increasing doses of T on singing and song control nuclei volumes in adult male and female American Singer canaries exposed to identical environmental conditions. Males were castrated and all birds were placed on short days (8L:16D) for 8 weeks. Males and females were implanted either with a 2, 6 or 12 mm long Silastic™ implant filled with crystalline T or an empty 12 mm implant as control. Birds were then housed individually in sound attenuated chambers. Brains were collected from six birds from each group after 1 week or 3 weeks of treatment. Testosterone was not equally effective in increasing singing activity in both males and females. Changes in song quality and occurrence rate took place after a shorter latency in males than in females however, females did undergo marked changes in a number of measures of song behavior if given sufficient time. Males responded with an increase in HVC volume at all three doses. In females, T-induced changes in HVC volume only had limited amplitude and these volumes never reached male-typical levels a suggesting that there are sex differences in the neural substrate that responds to T. PMID:25260250
Dicty_cDB: Contig-U04374-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 Anolis sagre... 46 1.6 1 ( GE801267 ) EST_scau_evk_891626 scauevk mixed_tissue Sebastes... 46 1.6 1 ( GE80...1266 ) EST_scau_evk_892010 scauevk mixed_tissue Sebastes... 46 1.6 1 ( FG735927 ) G1145P337RE22.T0 Anolis ca
Directory of Open Access Journals (Sweden)
Mascha Stroobant
2014-10-01
Full Text Available Objective: To record the reproductive pattern of a natural population of Pterocladiella capillacea from G áldar (Canary Islands, Spain from February to August in relation to temperature, irradiance and photoperiod environmental conditions. Methods: Field observation of reproductive thalli was used at different seasons in the year. Results: Tetrasporophytes and vegetative thalli were observed during all the period of study, while female gametophytes bearing cystocarps have been found from May to August in correspondence with the highest water temperature and irradiance values. Conclusions: Our data suggest that the temperature may be the determining factor which regulates the presence of tetrasporophytes in the field. The constant presence of tetrasporophytes could depend on the low excursion range of water temperature (4-5 °C throughout the period of study, with the highest abundance in February at 20 °C.
Canary tomato export prices: comparison and relationships between daily seasonal patterns
Directory of Open Access Journals (Sweden)
G. Martin-Rodriguez
2013-10-01
Full Text Available Statistical procedures are proposed to describe, compare and forecast the behaviour of seasonal variations in two daily price series of Canary tomato exported to German and British markets, respectively, over the last decade. These seasonal patterns are pseudo-periodic as the length of the seasonal period changes frequently in dependence of market conditions. Seasonal effect at a day in the harvesting period is defined as a spline function of the proportion of the length of such a period elapsed up to such a day. Then, seasonal patterns for the two series are compared in terms of the area between the corresponding spline functions. The ability of these models to capture the dynamic process of change in the seasonal pattern is useful to forecasting purpose. Furthermore, an analytical tool is also proposed to obtain forecasts of the seasonal pattern in one of these two series from the forecasts of the seasonal pattern in the other one. These procedures are useful for farmers in developing strategies related to the seasonal distribution of tomato production exported to each market.
Rodríguez, Francisco; Fraga, Santiago; Ramilo, Isabel; Rial, Pilar; Figueroa, Rosa Isabel; Riobó, Pilar; Bravo, Isabel
2017-07-01
In the present study the geographical distribution, abundance and composition of Gambierdiscus was described over a 600km longitudinal scale in the Canary Islands. Samples for cell counts, isolation and identification of Gambierdiscus were obtained from five islands (El Hierro, Tenerife, Gran Canaria, Fuerteventura and Lanzarote). Average densities of Gambierdiscus spp. between 0 and 2200cellsg -1 blot dry weight of macrophyte were recorded. Morphological (light microscopy and SEM techniques) and molecular analyses (LSU and SSU rDNA sequencing of cultures and single cells from the field) of Gambierdiscus was performed. Five Gambierdiscus species (G. australes, G. caribaeus, G. carolinianus, G. excentricus and G. silvae), together with a new putative species (Gambierdiscus ribotype 3) were identified. These results suggest that some cases of CFP in the region could be associated with the accumulation of ciguatoxins in the marine food web acquired from local populations of Gambierdiscus. This unexpected high diversity of Gambierdiscus species in an area which a priori is not under risk of ciguatera, hints at an ancient settlement of Gambierdiscus populations, likely favored by warmer climate conditions in the Miocene Epoch (when oldest current Canary Islands were created), in contrast with cooler present ones. Currently, warming trends associated with climate change could contribute to extend favorable environmental conditions in the area for Gambierdiscus growth especially during winter months. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.
Troll, V. R.; Klügel, A.; Longpré, M.-A.; Burchardt, S.; Deegan, F. M.; Carracedo, J. C.; Wiesmaier, S.; Kueppers, U.; Dahren, B.; Blythe, L. S.; Hansteen, T.; Freda, C.; Budd, D. A.; Jolis, E. M.; Jonsson, E.; Meade, F.; Berg, S.; Mancini, L.; Polacci, M.
2011-12-01
The eruption that started off the south coast of El Hierro, Canary Islands, in October 2011 has emitted intriguing eruption products found floating in the sea. These specimens appeared as floating volcanic "bombs" that have in the meantime been termed "restingolites" (after the close-by village of La Restinga) and exhibit cores of white and porous pumice-like material. Currently the nature and origin of these "floating stones" is vigorously debated among researchers, with important implications for the interpretation of the hazard potential of the ongoing eruption. The "restingolites" have been proposed to be either (i) juvenile high-silica magma (e.g. rhyolite), (ii) remelted magmatic material (trachyte), (iii) altered volcanic rock, or (iv) reheated hyaloclastites or zeolite from the submarine slopes of El Hierro. Here, we provide evidence that supports yet a different conclusion. We have collected and analysed the structure and composition of samples and compared the results to previous work on similar rocks found in the archipelago. Based on their high silica content, the lack of igneous trace element signatures, and the presence of remnant quartz crystals, jasper fragments and carbonate relicts, we conclude that "restingolites" are in fact xenoliths from pre-island sedimentary rocks that were picked up and heated by the ascending magma causing them to partially melt and vesiculate. They hence represent messengers from depth that help us to understand the interaction between ascending magma and crustal lithologies in the Canary Islands as well as in similar Atlantic islands that rest on sediment/covered ocean crust (e.g. Cape Verdes, Azores). The occurrence of these "restingolites" does therefore not indicate the presence of an explosive high-silica magma that is involved in the ongoing eruption.
Monitoring serum PCB levels in the adult population of the Canary Islands (Spain
Directory of Open Access Journals (Sweden)
Guillermo Burillo-Putze
2015-07-01
Full Text Available Polychlorinated biphenyls (PCBs are persistent organic chemicals that have been detected in human serum or tissues all over the world. These pollutants could exert a number of deleterious effects on humans and wildlife, including carcinogenic processes. The Spanish population of the Canary Islands was evaluated with respect to PCB levels more than ten years ago showing lower levels than other Western populations. The objective of our study was to assess the current level of contamination by PCBs showed by this population. We measured serum PCBs in a sample of healthy adult subjects (206 serum samples from subjects with an average age of 66 years old to evaluate the potential modification of PCB serum levels in this population during the last decade. PCB congeners (28, 52, 77, 81, 101, 105, 114, 118, 123, 126, 138, 153, 156, 157, 167, 169, 180, and 189 were measured by gas chromatography-mass spectrometry (GC/MS. Our results showed that PCB residues were found in 84% of serum samples analyzed, the congeners 28, 153 and 180 being the most frequently detected and at the highest median values (0.1 ng/mL. In addition, the median concentration of the sum of those PCBs considered as markers of environmental contamination by these chemicals (Marker-PCBs was 0.6 ng/mL, reaching values as high as as 2.6 ng/mL in the 95th percentile. Levels of the sum of PCBs with toxic effects similar to dioxins (dioxin-like PCBs reached median values of 0.4 ng/mL in the 95th percentile. The reported levels are similar to those described previously in this population more than ten years ago, in the sense that the inhabitants of the Canary Archipelago show levels of PCB contamination lower than the majority of populations from developed countries. These findings suggest that currently there is not any active source of these chemicals in this archipelago. Nevertheless, as foods seem to be a relevant source for these compounds, Public Health authorities should monitor the
Lifescience Database Archive (English)
Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =
Lifescience Database Archive (English)
Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste
Directory of Open Access Journals (Sweden)
Esther Torrado Martín-Palomino
2015-07-01
Full Text Available The migration of unaccompanied foreign minors (menores extranjeros no acompañados, MENA represents a new model for international mobility in Spain, one with its own particularities compared with other migratory flows. The dual nature of being unaccompanied and unauthorized leads to conflicts in the care and integration of these new migrants. However, this dual nature is one of the main prerequisites for the development of this mobility model (but not the only one and for developing strategies specific to this group. The Canary Islands, because of their position on the southern intercontinental border and their insularity, offer particular models of individual migration flows of primarily highly vulnerable African children and a close relationship with human smuggling and trafficking networks.
Meddy trajectories in the Canary Basin measured during the SEMAPHORE experiment, 1993-1995
Richardson, Philip L.; Tychensky, Aude
1998-10-01
As part of the Structures des Echanges Mer-Atmosphere, Proprietes des Heterogeneites Oceaniques: Recherche Experimentale (SEMAPHORE) experiment, four Mediterranean water eddies (Meddies) were identified in the Canary Basin and tracked with freely drifting RAFOS floats. One large and energetic Meddy, discovered 1700 km west of Cape Saint Vincent, Portugal, set a distance and speed record as it translated another 1700 km southwestward at 3.9 cm/s during 1.5 years. This Meddy traveled 57% of the distance from Cape Saint Vincent toward the spot McDowell and Rossby [1978] found a possible Meddy north of the Dominican Republic. Two Meddies were observed to interact with the Azores Current as they passed underneath or through it. Three Meddies collided with tall seamounts, which seemed to disrupt the normal swirl velocity, perhaps fatally in two cases. One Meddy appeared to bifurcate when it collided with seamounts.
Geldmacher, Jörg; Hoernle, Kaj; van den Bogaard, Paul; Zankl, Goor; Garbe-Schönberg, Dieter
2001-11-01
Major element, trace element and Sr-Nd-Pb isotope data, combined with 40Ar/39Ar age determinations, of volcanic rocks from the Selvagen Islands and neighboring seamounts in the eastern North Atlantic reveal the earlier history of the ≥70 Ma old Canary hotspot. A basanitic to phonolitic late shield stage intrusive complex (29 Ma) is exposed on Selvagem Pequena. The evolution of Selvagem Grande can be divided into three magmatic phases: a tephritic to phonolitic late shield stage intrusive complex (24-26 Ma) and two rejuvenated or post-erosional stages (8-12 and 3.4 Ma) consisting of alkali basalt, basanite and rare phonolite. During the early to mid-Miocene volcanic hiatus (12-24 Ma), the top of the volcano was beneath sea level as evidenced by marine carbonate sediments (13-24 Ma, dated through correlation of 87Sr/86Sr with the seawater Sr isotope curve). The geochemistry of the shield stage lavas indicates that they derive from plume sources, whereas the post-erosional lavas are derived from metasomatized lithospheric sources. Five sampled seamounts to the east and northeast of the islands range in composition from alkali basalt and basanite to phonolite. Samples from Dacia, Conception Bank and Lars were dated at 9, 17 and 68 Ma, respectively. Geochemical data suggest that the dredged samples come from the post-erosional stage of volcanism, and therefore, the dates represent minimum ages for the seamount volcanoes. The elevation of erosional platforms formed at wave base decrease from Selvagen Grande (∼100 m above sea level) to Lars seamount (∼900 m below sea level), suggesting a southwest to northwest age progression and that all of these seamounts are older than the Selvagen Islands. Trace element and Sr-Nd-Pb isotopic composition of the Selvagen Islands and neighboring seamounts are consistent with their origin from the Canary plume. Interaction of the weak Canary mantle plume with a slow moving plate appears to be responsible for generating a 450-km
Directory of Open Access Journals (Sweden)
Rybak Fanny
2004-01-01
Full Text Available The respective influence of testosterone and estradiol on the structure of the Common Canary Serinus canaria song was studied by experimentally controlling blood levels of steroid hormones in males and analyzing the consequent effects on acoustic parameters. A detailed acoustic analysis of the songs produced before and after hormonal manipulation revealed that testosterone and estradiol seem to control distinct song parameters independently. The presence of receptors for testosterone and estradiol in the brain neural pathway controlling song production strongly suggests that the observed effects are mediated by a steroid action at the neuronal level.
Divergence times and colonization of the Canary Islands by Gallotia lizards.
Cox, Siobhan C; Carranza, Salvador; Brown, Richard P
2010-08-01
The Canary Islands have become a model region for evolutionary studies. We obtained 1.8 Kbp of mtDNA sequence from all known island forms of the endemic lizard genus Gallotia and from its sister taxon Psammodromus in order to reanalyze phylogenetic relationships within the archipelago, estimate lineage divergence times, and reconstruct the colonization history of this group. Well-supported phylogenies were obtained using maximum parsimony and Bayesian inference. Previous studies have been unable to establish the branching pattern at the base of the tree. We found evidence that G. stehlini (Gran Canaria) originated from the most basal Gallotia node and G. atlantica from the subsequent node. Divergence times were estimated under a global clock using Bayesian Markov Chain Monte Carlo methods implemented by three different programs: BEAST, MCMCTREE, MULTIDIVTIME. Node constraints were derived from subaerial island appearance data and were incorporated into the analyses as soft or hard maximal bounds. Posterior node ages differed slightly between programs, possibly due to different priors on divergence times. The most eastern Canary Islands first emerged just over 20 mya and their colonization appears to have taken place relatively quickly, around 17-20 mya. The subsequent node is consistent with cladogenesis due to colonization of Gran Canaria from the eastern islands about 11-13 mya. The western islands appear to have been colonized by a dispersal event from Lanzarote/Fuerteventura in the east to either La Gomera or one of the ancient edifices that subsequently formed Tenerife in the west, about 9-10 mya. Within the western islands, the most recent node that is ancestral to both the G. intermedia/G. gomerana/G. simonyi and the G.galloti/G. caesaris clades is dated at about 5-6 mya. Subsequent dispersal events between ancient Tenerife islands and La Gomera are dated at around 3 mya in both clades, although the direction of dispersal cannot be determined. Finally, we
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-01-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote. PMID:19218416
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-04-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote.
Maldonado, Fabien; Boland, Jennifer M.; Raghunath, Sushravya; Aubry, Marie Christine; Bartholmai, Brian J.; deAndrade, Mariza; Hartman, Thomas E.; Karwoski, Ronald A.; Rajagopalan, Srinivasan; Sykes, Anne-Marie; Yang, Ping; Yi, Eunhee S.; Robb, Richard A.; Peikert, Tobias
2013-01-01
Introduction Pulmonary nodules of the adenocarcinoma spectrum are characterized by distinctive morphological and radiological features and variable prognosis. Non-invasive high-resolution computed-tomography (HRCT)-based risk stratification tools are needed to individualize their management. Methods Radiological measurements of histopathologic tissue invasion were developed in a training set of 54 pulmonary nodules of the adenocarcinoma spectrum and validated in 86 consecutively resected nodules. Nodules were isolated and characterized by computer-aided analysis and data were analyzed by Spearman correlation, sensitivity, specificity as well as the positive and negative predictive values. Results Computer Aided Nodule Assessment and Risk Yield (CANARY) can non-invasively characterize pulmonary nodules of the adenocarcinoma spectrum. Unsupervised clustering analysis of HRCT data identified 9 unique exemplars representing the basic radiologic building blocks of these lesions. The exemplar distribution within each nodule correlated well with the proportion of histologic tissue invasion, Spearman R=0.87,p < 0.0001 and 0.89,p < 0.0001 for the training and the validation set, respectively. Clustering of the exemplars in three-dimensional space corresponding to tissue invasion and lepidic growth was used to develop a CANARY decision algorithm, which successfully categorized these pulmonary nodules as “aggressive” (invasive adenocarcinoma) or “indolent” (adenocarcinoma in situ and minimally invasive adenocarcinoma). Sensitivity, specificity, positive predictive value and negative predictive value of this approach for the detection of “aggressive” lesions were 95.4%, 96.8%, 95.4% and 96.8%, respectively in the training set and 98.7%, 63.6%, 94.9% and 87.5%, respectively in the validation set. Conclusion CANARY represents a promising tool to non-invasively risk stratify pulmonary nodules of the adenocarcinoma spectrum. PMID:23486265
Troll, V. R.; Klügel, A.; Longpré, M.-A.; Burchardt, S.; Deegan, F. M.; Carracedo, J. C.; Wiesmaier, S.; Kueppers, U.; Dahren, B.; Blythe, L. S.; Hansteen, T. H.; Freda, C.; Budd, D. A.; Jolis, E. M.; Jonsson, E.; Meade, F. C.; Harris, C.; Berg, S. E.; Mancini, L.; Polacci, M.; Pedroza, K.
2012-03-01
A submarine eruption started off the south coast of El Hierro, Canary Islands, on 10 October 2011 and continues at the time of this writing (February 2012). In the first days of the event, peculiar eruption products were found floating on the sea surface, drifting for long distances from the eruption site. These specimens, which have in the meantime been termed "restingolites" (after the close-by village of La Restinga), appeared as black volcanic "bombs" that exhibit cores of white and porous pumice-like material. Since their brief appearance, the nature and origin of these "floating stones" has been vigorously debated among researchers, with important implications for the interpretation of the hazard potential of the ongoing eruption. The "restingolites" have been proposed to be either (i) juvenile high-silica magma (e.g. rhyolite), (ii) remelted magmatic material (trachyte), (iii) altered volcanic rock, or (iv) reheated hyaloclastites or zeolite from the submarine slopes of El Hierro. Here, we provide evidence that supports yet a different conclusion. We have analysed the textures and compositions of representative "restingolites" and compared the results to previous work on similar rocks found in the Canary Islands. Based on their high-silica content, the lack of igneous trace element signatures, the presence of remnant quartz crystals, jasper fragments and carbonate as well as wollastonite (derived from thermal overprint of carbonate) and their relatively high oxygen isotope values, we conclude that "restingolites" are in fact xenoliths from pre-island sedimentary layers that were picked up and heated by the ascending magma, causing them to partially melt and vesiculate. As they are closely resembling pumice in appearance, but are xenolithic in origin, we refer to these rocks as "xeno-pumice". The El Hierro xeno-pumices hence represent messengers from depth that help us to understand the interaction between ascending magma and crustal lithologies beneath the
Directory of Open Access Journals (Sweden)
V. R. Troll
2012-03-01
Full Text Available A submarine eruption started off the south coast of El Hierro, Canary Islands, on 10 October 2011 and continues at the time of this writing (February 2012. In the first days of the event, peculiar eruption products were found floating on the sea surface, drifting for long distances from the eruption site. These specimens, which have in the meantime been termed "restingolites" (after the close-by village of La Restinga, appeared as black volcanic "bombs" that exhibit cores of white and porous pumice-like material. Since their brief appearance, the nature and origin of these "floating stones" has been vigorously debated among researchers, with important implications for the interpretation of the hazard potential of the ongoing eruption. The "restingolites" have been proposed to be either (i juvenile high-silica magma (e.g. rhyolite, (ii remelted magmatic material (trachyte, (iii altered volcanic rock, or (iv reheated hyaloclastites or zeolite from the submarine slopes of El Hierro. Here, we provide evidence that supports yet a different conclusion. We have analysed the textures and compositions of representative "restingolites" and compared the results to previous work on similar rocks found in the Canary Islands. Based on their high-silica content, the lack of igneous trace element signatures, the presence of remnant quartz crystals, jasper fragments and carbonate as well as wollastonite (derived from thermal overprint of carbonate and their relatively high oxygen isotope values, we conclude that "restingolites" are in fact xenoliths from pre-island sedimentary layers that were picked up and heated by the ascending magma, causing them to partially melt and vesiculate. As they are closely resembling pumice in appearance, but are xenolithic in origin, we refer to these rocks as "xeno-pumice". The El Hierro xeno-pumices hence represent messengers from depth that help us to understand the interaction between ascending magma and crustal lithologies
Energy Technology Data Exchange (ETDEWEB)
Riche, A.B.
2004-04-01
This report summarises the results of the Topgrass project growing miscanthus, switchgrass and reed canary grass at nine UK sites and covers a one year period between the winter harvesting of the plots in 2002/3 and 2003/4. Details are given of the rainfall, air temperature and solar radiation; crop monitoring for pests, diseases and weeds; crop measurements; and a comparison of all sites. Appendices present individual site diaries and individual site operations and costs.
Cas pratique : État de la retenue d’El Golfo dans l’île d’El Hierro (îles Canaries
Directory of Open Access Journals (Sweden)
BLANCO, Manuel
2012-08-01
Full Text Available La pérennité des matériaux géosynthétiques garantit la mise en place d'un système de protection efficace et durable pour l'environnement. Cet article présente le comportement sur douze ans d’une géomembrane en caoutchouc synthétique installée dans la retenue d'eau d’El Golfo aux îles Canaries : des résultats encourageants qui montrent un bon état de conservation de la géomembrane face aux aléas climatiques.
Salva-Catarineu, Montserrat; Salvador-Franch, Ferran; López-Bustins, Joan Albert; Padrón-Padrón, Perdro A.; Cortés-Lucas, Amparo
2015-04-01
The biggest population of Juniperus turbinata throughout the Canary Islands is located in the island of El Hierro. The current extent of juniper woodlands is very small compared with the potential distribution due to heavy exploitation for centuries. Nowadays, the recovery of its natural habitat has such a high environmental and scenic interest since this is a protected species in Europe; however, an improved understanding of the environmental factors that help or limit its recovery is indispensable. Under the JUNITUR project the populations of juniper woodlands in El Hierro are being studied, which are subjected to highly different environments. These environments are mainly determined by their altitude and exposure to NE trade winds. The main objective of this study is to compare the thermohygrometric conditions of three juniper woodlands, located at different altitude and orientation in El Hierro, which present different recovery rates. We are currently using air sensor data loggers fixed to tree branches for recording hourly temperature and humidity data in the three study areas. For this preliminary approach, we analyse daily data of two annual cycles (from September 2012 to August 2014). Our first results show similar thermohygrometric annual cycles among the three study areas. The largest differences are detected in winter temperature and summer humidity between the north (to windward) and south (to leeward) faces of the island. The juniper woodland with a highest recovery rate shows the most extreme temperature conditions in both winter and summer seasons. This last juniper woodland is located leeward to trade winds at 996 m a.s.l. In general terms, the results of this research project might contribute to the knowledge of the juniper bioclimatology in the westernmost of the Canary Islands. Key words: bioclimatology, El Hierro, habitat, Juniperus turbinata, protected species
When canary primes yellow: effects of semantic memory on overt attention.
Léger, Laure; Chauvet, Elodie
2015-02-01
This study explored how overt attention is influenced by the colour that is primed when a target word is read during a lexical visual search task. Prior studies have shown that attention can be influenced by conceptual or perceptual overlap between a target word and distractor pictures: attention is attracted to pictures that have the same form (rope--snake) or colour (green--frog) as the spoken target word or is drawn to an object from the same category as the spoken target word (trumpet--piano). The hypothesis for this study was that attention should be attracted to words displayed in the colour that is primed by reading a target word (for example, yellow for canary). An experiment was conducted in which participants' eye movements were recorded whilst they completed a lexical visual search task. The primary finding was that participants' eye movements were mainly directed towards words displayed in the colour primed by reading the target word, even though this colour was not relevant to completing the visual search task. This result is discussed in terms of top-down guidance of overt attention in visual search for words.
García-Santos, G.; Marzol, M. V.; Aschan, G.
Field measurements from February 2003 to January 2004 in a humid (but dry in summer) crest heath wood-land (degraded laurel forest) in the National Park of Garajonay, Canary Islands (Spain), were combined to calculate water balance components. The water balance domain is at the surface of the catchment and is controlled by atmospheric processes and vegetation. This study found that annual water income (rainfall plus fog water) was 1440 mm year-1, half of which was occult (or fog) precipitation, while stand transpiration estimated from measurements of sap flow amounted, annually, to 40% of potential evapotranspiration calculated from measurements of meteorological variables. The positive role of crest laurel forests, which transpire less water than is incoming from rain and fog is emphasised.
DEFF Research Database (Denmark)
Otto, Rüdiger; Whittaker, Robert J.; von Gaisberg, Markus
2016-01-01
ontogenies, featuring surfaces of varying age. Here, we extend the GDM to apply at a local scale within islands, and test the predictions analytically within individual islands. Location El Hierro, La Palma and Tenerife (Canary Islands). Methods Following the GDM logic, we derive predictions...
2010-07-08
..., cowcod, and yelloweye rockfish. Order on Remedy, Dkt. No. 342 (April 29, 2010) (Opinion). The Court held... Order on Remedy, Dkt. No. 342 (April 29, 2010). For darkblotched rockfish, NMFS notes that modifying the...
Mass fluxes in the Canary Basin (eastern boundary of the North Atlantic subtropical gyre)
Burgoa, N.; Machin, F.; Marrero-Díaz, Á.; Rodríguez-Santana, Á.; Martínez-Marrero, A.
2017-12-01
The circulation patterns in the Canary Basin are examined with hydrographic data from two cruises carried out in 2002 and 2003 in the eastern boundary of the North Atlantic subtropical gyre (21-27.5ºN, 17.5-26ºW). These cruises were part of the COCA Project (Coastal-Ocean Carbon Exchange in the Canary Region). First we estimate the geostrophic flow within a closed box divided into 12 layers of neutral density surfaces using the thermal wind equation. The geostrophic velocities are initially referenced to a selected neutral surface previously analyzed in deep. Then, the divergence and the convergence of the flow are analyzed in the closed water volume considering the Ekman transport in the surface of this whole region. The accumulated mass transport along the perimeter of the box is estimated with the aim to study transport imbalances in the different water masses. In addition, variables like the anomalies in the transport of the salt and heat are also considered. In general, mass transport results show that more than 50% of this transport takes place in central waters and around 25% in intermediate waters. In the first cruise carried out in late summer, the circulation of the shallowest layers goes into the box along the north and south transects with values which can arrive to 2 Sv and 1 Sv respectively and it flows westward with a maximum value of 2 Sv. At intermediate levels the mass transport changes its direction going out to the north with 0.5 Sv. On the other hand, in the second cruise carried out in late spring, the transport in the shallowest layers also gets in the box through the north transect, but it goes out along the west and south transects with values which can arrive to 1 Sv and 2 Sv, respectively. At intermediate levels the transports are similar to those already described for the summer cruise. Finally, an inverse box model is applied to both datasets to obtain a solution consistent with both the thermal wind equation and with the mass and
Energy Technology Data Exchange (ETDEWEB)
Bullard, M.; Metcalfe, P.
2001-07-01
The perennial grasses miscanthus, reed canary and swithchgrass have attractions as energy crops in the United Kingdom: all have low demand for fertilizer and pesticide, and are harvested annually. Research on energy ratios and carbon ratios of the grasses is reported. A Microsoft Excel-based model was developed (from an ADAS database) and the input calculations and assumptions are explained. The study demonstrated the attractions of theses grasses as a source of fuel. The results agreed with those from a model developed for the SRC.
Reproductive data for groundfish
National Oceanic and Atmospheric Administration, Department of Commerce — The ROCKFISH database houses data from rockfish species collected by the SWFSC FED along the California coast as part of a reproductive study originating in the...
Acoustic Tomography in the Canary Basin: Meddies and Tides
Dushaw, Brian D.; Gaillard, Fabienne; Terre, Thierry
2017-11-01
An acoustic propagation experiment over 308 km range conducted in the Canary Basin in 1997-1998 was used to assess the ability of ocean acoustic tomography to measure the flux of Mediterranean water and Meddies. Instruments on a mooring adjacent to the acoustic path measured the southwestward passage of a strong Meddy in temperature, salinity, and current. Over 9 months of transmissions, the acoustic arrival pattern was an initial broad stochastic pulse varying in duration by 250-500 ms, followed eight stable, identified-ray arrivals. Small-scale sound speed fluctuations from Mediterranean water parcels littered around the sound channel axis caused acoustic scattering. Internal waves contributed more modest acoustic scattering. Based on simulations, the main effect of a Meddy passing across the acoustic path is the formation of many early-arriving, near-axis rays, but these rays are thoroughly scattered by the small-scale Mediterranean-water fluctuations. A Meddy decreases the deep-turning ray travel times by 10-30 ms. The dominant acoustic signature of a Meddy is therefore the expansion of the width of the initial stochastic pulse. While this signature appears inseparable from the other effects of Mediterranean water in this region, the acoustic time series indicates the steady passage of Mediterranean water across the acoustic path. Tidal variations caused by the mode-1 internal tides were measured by the acoustic travel times. The observed internal tides were partly predicted using a recent global model for such tides derived from satellite altimetry.
The 2011 submarine volcanic eruption of El Hierro Island (Canary Islands, Spain)
López, C.; Blanco, M. J.
2012-04-01
On 10 October 2011 a submarine volcanic eruption began 2 km SW of La Restinga village in the South coast of El Hierro Island (Spain). It became the first submarine eruption reported in 500 years of historical record in the Canary Islands. The eruption took place after three months of intensive seismic activity and ground deformation. The first signal evidencing the eruption was a harmonic tremor signal, located somewhere in the South sector of El Hierro Island and registered in every seismic station on the island. On the following day, the tremoŕs amplitude increased up enough to be felt by the residents of La Restinga. The first visual evidence of the eruption was observed during the afternoon of 12 October, a large light-green coloured area on the sea surface, 2 km to the SW of La Restinga. Three days later, steaming lava fragments were observed floating on the sea, in the area where the vent was supposed to be located. These fragments had a bomb-like shape and their sizes ranged between 10 and 40 cm long. They were bicoloured, a black outer part with a basaltic composition, and a white inner part, highly vesiculated and rich in silica content (>60%). This type of fragments was only observed during the first days of the eruption. Within the next two months further emission episodes have been observed with turbulent water, foam rings and large bubbles on the sea surface. On the 27th of November new lava fragments were observed while floating and degassing on the sea surface. Most of them were "lava balloons" or hollow fragments of lavas, with sizes between 30 and 200 cm, and highly vesiculated outer crust of basaltic-basanitic and sideromelane composition. The emission of these products continues intermitently up to date (January 2012) During the eruption, the GPS monitoring network detected episodes of inflation-deflation and a maximum vertical deformation of 4 cm. The horizontal deformation, which had reached up to 5 cm before the eruption, remains stable. The
Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.
Directory of Open Access Journals (Sweden)
Robert J Miller
Full Text Available Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.
Directory of Open Access Journals (Sweden)
Reiji Masuda
Full Text Available Massive tsunamis induce catastrophic disturbance in marine ecosystems, yet they can provide unique opportunities to observe the process of regeneration. Here, we report the recovery of fauna after the 2011 tsunami in northeast Japan based on underwater visual censuses performed every two months over five years. Both total fish abundance and species richness increased from the first to the second year after the tsunami followed by stabilization in the following years. Short-lived fish, such as the banded goby Pterogobius elapoides, were relatively abundant in the first two years, whereas long-lived species, such as the black rockfish Sebastes cheni, increased in the latter half of the survey period. Tropical fish species were recorded only in the second and third years after the tsunami. The body size of long-lived fish increased during the survey period resulting in a gradual increase of total fish biomass. The recovery of fish assemblages was slow at one site located in the inner bay, where the impact of the tsunami was the strongest. Apart from fish, blooms of the moon jellyfish Aurelia sp. occurred only in the first two years after the tsunami, whereas the abundances of sea cucumber Apostichopus japonicus and abalone Haliotis discus hannai increased after the second year. Although we lack quantitative data prior to the tsunami, we conclude that it takes approximately three years for coastal reef fish assemblages to recover from a heavy disturbance such as a tsunami and that the recovery is dependent on species-specific life span and habitat.
Directory of Open Access Journals (Sweden)
Oromí Pedro
2008-01-01
Full Text Available Abstract Background The amphipod crustacean Palmorchestia hypogaea occurs only in La Palma (Canary Islands and is one of the few terrestrial amphipods in the world that have adapted to a strictly troglobitic life in volcanic cave habitats. A surface-dwelling closely related species (Palmorchestia epigaea lives in the humid laurel forest on the same island. Previous studies have suggested that an ancestral littoral Orchestia species colonized the humid forests of La Palma and that subsequent drought episodes in the Canaries reduced the distribution of P. epigaea favouring the colonization of lava tubes through an adaptive shift. This was followed by dispersal via the hypogean crevicular system. Results P. hypogaea and P. epigaea did not form reciprocally monophyletic mitochondrial DNA clades. They showed geographically highly structured and genetically divergent populations with current gene flow limited to geographically close surface locations. Coalescence times using Bayesian estimations assuming a non-correlated relaxed clock with a normal prior distribution of the age of La Palma, together with the lack of association of habitat type with ancestral and recent haplotypes, suggest that their adaptation to cave life is relatively ancient. Conclusion The data gathered here provide evidence for multiple invasions of the volcanic cave systems that have acted as refuges. A re-evaluation of the taxonomic status of the extant species of Palmorchestia is needed, as the division of the two species by habitat and ecology is unnatural. The information obtained here, and that from previous studies on hypogean fauna, shows the importance of factors such as the uncoupling of morphological and genetic evolution, the role of climatic change and regressive evolution as key processes in leading to subterranean biodiversity.
Directory of Open Access Journals (Sweden)
Polifrone, Milena
2012-12-01
Full Text Available The reproductive phenology of three species of Gelidiales, Gelidium canariense, Gelidium arbuscula and Pterocladiella capillacea, was analysed seasonally for a period of one year in two localities on the West coast of Tenerife (Atlantic Ocean, Canary Islands, Spain. Considerations are provided on sex ratio, maximum length and branch order of uprights and on the length of the thalli for each sexual and asexual phase of the Canary Islands populations. The three species were characterized by a high percentage of tetrasporophytes, while female and male gametophytes have been observed only in little proportion. Only G. canariense showed gametophytes in all seasons while the occurrence of gametophytes in G. arbuscula and Pterocladiella capillacea demonstrated a clear seasonality.
La fenología reproductiva de tres especies de Gelidiales, Gelidium canariense, Gelidium arbuscula y Pterocladiella capillacea, ha sido analizada estacionalmente por un periodo de un año en dos localidades de la costa este de Tenerife (Oceano Atlántico, Islas Canarias, España. Se realizan consideraciones sobre sex ratio, longitud máxima y orden de ramificación de los ramets y se aporta información sobre la longitud del talo por cada fase sexual y asexual de las poblaciones canarias. Las tres especies se caracterizan por presentar un elevado porcentaje de tetrasporofitos, mientras que los gametofitos masculinos y femeninos han sido observados en proporciones reducidas. Sólo G. canariense presenta gametofitos en todas las estaciones, mientras que en G. arbuscula y Pterocladiella capillacea demostraban una clara estacionalidad.
von Suchodoletz, H.; Blanchard, H.; Rittner, S.; Radtke, U.; Fuchs, M.; Dietze, M.; Zöller, L.
2009-04-01
On Lanzarote (Canary Islands) soils were baked by Quaternary lava flows. This offers the possibility to date phases of eruptive activity by red thermoluminescence (RTL). We dated soil material baked by two different lava flows originating from the "Las Calderetas de Guatiza" volcanic chain in the northeast of the island by RTL. Furthermore, three samples of Helicidae-mollusk shells overlying one of the lava flows (site Mála) were dated using electron spin resonance (ESR). RTL datings were carried out using quartz grains 63-200 µm from baked material that were originally brought by eolian transport from the nearby Saharan desert. It appears that in spite of a baking temperature Lanzarote by RTL thus offers the possibility to further investigate the yet fragmentary Middle and Late Quaternary eruptive history of these islands.
International Nuclear Information System (INIS)
Peng He; Ala Aldahan; Uppsala University, Uppsala; Xiaolin Hou; Chinese Academy of Sciences, Xi'an; Possnert, Goran
2016-01-01
A complete transect of surface water samples from the North Sea to the Canary Islands was collected during a continuous period in 2010. The samples were analyzed for total 129 I and 127 I isotopes and their iodide and iodate species. The results indicate a large variability in the total 129 I and its species along the transect, whereas less change and variation are observed for the total 127 I and its species. Transport of 129 I from the western English Channel via Biscay Bay is the main source of 129 I in the northeastern Atlantic Ocean. (author)
Several isolates from nodules of Phaseolus vulgaris grown in soil of Lanzarote, an island of the Canaries, had electrophoretic LMW RNA patterns identical with a less common pattern within S. meliloti (assigned as group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northe...
Carracedo, Juan-Carlos; Meco, Joaquín.; Lomoschitz, Alejandro; Antonia Perera, María.; Ballester, Javier; Betancort, Juan-Francisco
2004-10-01
In a recent paper Zöller et al. (2003) present their results of the stratigraphic, sedimentologic, soil mineralogy and IRSL dating of several soil beds filling a basin located near the village of Guatiza, at the eastern flank of the Famara shield, in the island of Lanzarote (Canary Islands). According to these authors, the soils correspond to a desert loess-palaeosol sequence with many coarse alluvial fan deposits, accumulated as scoria cones encircled the open ancient valley extending from SW to NE near Guatiza and their lava flowed to form the Vega de Guatiza endoreic basin. According to these authors, this depression served as a sediment trap from its formation.
Energy Technology Data Exchange (ETDEWEB)
Gustavsson, Lennart; Paulrud, Susanne
2011-07-01
The feasibility of commercially available boilers in the interval 50 kW to 1 MW for use with reed canary grass (RCG) as fuel has been preliminary evaluated. The capacity to handle the large ash volumes generated by RCG both in terms of ash withdrawal and combustion quality was used as the main criteria. Nine boilers and two burners were identified and classified in a three-step scale from verified functioning on RCG to possible functioning with some design changes
Agrotourism, sustainable tourism and Ultraperipheral areas: The Case of Canary Islands
Directory of Open Access Journals (Sweden)
Parra López, Eduardo
2006-01-01
Full Text Available Ultraperipheral regions share certain common characteristics, such as their remoteness from the major supplying centres, their scanty resources, their island status or isolated location and consequent fragmentation of markets. Over the past decades, there has been an increasing awareness of the impact of ultraperiphericity on the development of a number of regions and islands. The concept of “ultraperiphericity” includes specific geographic circumstances that influence the development and specialisation of economies, competitiveness and business strategies. Agrotourism is playing an ever increasingly important role in the diversification of the agriculture, farming and tourism sectors into the Ultraperipheral Regions. Therefore, particular attention should be paid to the economic development of rural areas in Ultraperipheral Areas and to the reappraisal of agriculture, which is closely connected with tourism. Agrotourism is essential to diversify, transform and improve the competitiveness and quality of farms. This paper examines the impact of Agrotourism as an alternative to sun and sand tourism, resulting in the growth of family income, in rural development and, in short, in new approaches to the tourism industry. A further goal of the paper is to develop a strategic analysis of Agrotourism, studying both supply and demand in the Canary Islands
Origin of three-armed rifts in volcanic islands: the case of El Hierro (Canary Islands)
Galindo Jiménez, Inés; Becerril Carretero, Laura; Martí Molist, Joan; Gudmundsson, Agust
2015-04-01
Rifts zones in volcanic oceanic islands are common structures that have been explained through several theories/models. However, despite all these models it is as yet unclear whether it is the intense intrusive activity or the sector collapses that actually control the structural evolution and geometry of oceanic-island rift zones. Here we provide a new hypothesis to explain the origin and characteristics of the feeding system of oceanic-island rift zones based on the analysis of more than 1700 surface, subsurface (water galleries), and submarine structural data from El Hierro (Canary Islands). El Hierro's geological structure is primarily controlled by a three-armed rift-zone, the arms striking NE, WSW and S. Between the rift axes there are three valleys formed during huge landslides: El Golfo, El Julan, and Las Playas. Our results show: (1) a predominant NE-SW strike of structural elements, which coincides with the main regional trend of the Canary Archipelago as a whole; (2) a clear radial strike distribution of structural elements for the whole volcanic edifice (including submarine flanks) with respect to the centre of the island; (3) that the rift zones are mainly subaerial structures and do not propagate through the submarine edifice; (4) that it is only in the NE rift that structures have a general strike similar to that of the rift as a whole, and; (5) that in the W and S rifts there is not clear main direction, showing the structural elements in the W rift a fan distribution coinciding with the general radial pattern in the island as a whole. Based on these data, we suggest that the radial-striking structures reflect comparatively uniform stress fields that operated during the constructive episodes, mainly conditioned by the combination of overburden pressure, gravitational spreading, and magma-induced stresses. By contrast, in the shallower parts of the edifice, that is, the NE-SW, N-S and WNW-ESE-striking structures, reflect local stress fields related
Energy Technology Data Exchange (ETDEWEB)
Betancort, J.F.; Lomoschitz, A.; Meco, J.
2016-07-01
Fossil fish teeth are contained in marine deposits dated at ca 4.8 Ma found on the islands of Gran Canaria and Fuerteventura (Canary Islands, Spain). These islands, situated in the North Atlantic Subtropical Gyre, can be considered a mid-way stopover point between the Caribbean Sea, with the Central American Seaway about to close in this epoch, and the Mediterranean, in the first stage of its post-Messinian Gibraltar Seaway period. Accordingly, there existed extensive pantropical communication, particularly for nektonic animals capable of travelling large distances. In this paper, we present a number of fossil fishes, most of which are identified for the first time on the basis of their teeth: the Chondrichthyes species Carcharocles megalodon, Parotodus benedeni, Cosmopolitodus hastalis, Isurus oxyrinchus, Carcharias cf. acutissima, Carcharhinus cf. leucas, Carcharhinus cf. priscus, Galeocerdo cf. aduncus, and the Osteichthyes species Archosargus cinctus, Labrodon pavimentatum, and Diodon scillae. Coincidences are observed between these ichthyofauna and specimens found in the Azores Islands, the Pacific coast of America and the Mediterranean Sea. (Author)
Directory of Open Access Journals (Sweden)
J. F. Betancort
2016-11-01
Full Text Available Fossil fish teeth are contained in marine deposits dated at ca 4.8 Ma found on the islands of Gran Canaria and Fuerteventura (Canary Islands, Spain. These islands, situated in the North Atlantic Subtropical Gyre, can be considered a mid-way stopover point between the Caribbean Sea, with the Central American Seaway about to close in this epoch, and the Mediterranean, in the first stage of its post-Messinian Gibraltar Seaway period. Accordingly, there existed extensive pantropical communication, particularly for nektonic animals capable of travelling large distances. In this paper, we present a number of fossil fishes, most of which are identified for the first time on the basis of their teeth: the Chondrichthyes species Carcharocles megalodon, Parotodus benedeni, Cosmopolitodus hastalis, Isurus oxyrinchus, Carcharias cf. acutissima, Carcharhinus cf. leucas, Carcharhinus cf. priscus, Galeocerdo cf. aduncus, and the Osteichthyes species Archosargus cinctus, Labrodon pavimentatum, and Diodon scillae. Coincidences are observed between these ichthyofauna and specimens found in the Azores Islands, the Pacific coast of America and the Mediterranean Sea.
Reed canary grass on marginal land. Industrial applications, economics and environmental impacts
International Nuclear Information System (INIS)
Pedersen, S.M.
1997-01-01
The objective of this study concerns the industrial applications and economic viability of using RCG (Reed Canary Grass). The study is based on a systems and costs analysis where the cost structure in the whole production chain is assessed. This includes cultivation, harvest, transportation, fractionation, pelletizing, combustion and pump production. Moreover the study assess the environmental impact by comparing the use of pesticides and fertilizers with conventional crops. A few scenarios are selected in order to conduct further sensitivity analysis regarding price fluctuations, set aside premiums, energy taxation and variation in cost of land. In addition, the study describes the market possibilities for RCG end products in Europe. The market for short fibre pump is stable in Finland and Sweden and calculations indicate potential possibilities of using upgraded RCG on existing sulphate pulp and paper mills. The upgraded leave fraction should be used for either district heating, small scale heating or process energy at the pump mill. Furthermore, the calculations show that it is economic viable to grow RCG on marginal land with a minimum environmental impact compared with conventional crops. (au) 18 refs
Verifying the body tide at the Canary Islands using tidal gravimetry observations
Arnoso, J.; Benavent, M.; Bos, M. S.; Montesinos, F. G.; Vieira, R.
2011-05-01
Gravity tide records from El Hierro, Tenerife and Lanzarote Islands (Canarian Archipelago) have been analyzed and compared to the theoretical body tide model (DDW) of Dehant el al. (1999). The use of more stringent criterion of tidal analysis using VAV program allowed us to reduce the error bars by a factor of two of the gravimetric factors at Tenerife and Lanzarote compared with previous published values. Also, the calibration values have been revisited at those sites. Precise ocean tide loading (OTL) corrections based on up-to-date global ocean models and improved regional ocean model have been obtained for the main tidal harmonics O 1, K 1, M 2, S 2. We also point out the importance of using the most accurate coastline definition for OTL calculations in the Canaries. The remaining observational errors depend on the accuracy of the calibration of the gravimeters and/or on the length of the observed data series. Finally, the comparison of the tidal observations with the theoretical body tide models has been done with an accuracy level of 0.1% at El Hierro, 0.4% at Tenerife and 0.5% at Lanzarote.
Geldmacher, Jörg; Hoernle, Kaj; van den Bogaard, Paul; Duggen, Svend; Werner, Reinhard
2005-01-01
The role of mantleplumes in the formation of intraplate volcanic islands and seamount chains is being increasingly questioned. Particular examples are the abundant and somewhat irregularly distributed island and seamount volcanoes off the coast of northwest Africa. New40Ar / 39Ar ages and Sr–Nd–Pb isotope geochemistry of volcanic rocks from seamounts northeast of the Madeira Islands (Seine and Unicorn) and northeast of the Canary Islands (Dacia and Anika), however, provide support for the plu...
Directory of Open Access Journals (Sweden)
V Varnaseri Ghandali
2016-12-01
Full Text Available Introduction Canary seed (Phalaris canariensis L. is a forage plant from Poaceae family. This plant is drought tolerant. Canary seed is originally a native to Mediterranean region, which can be grown commercially in several parts of the word, especially in semi-arid conditions. Increasing growth of population and lack of ability of pastures to satisfy the food requirement of animal has led to more interest in cultivating forage plants. In this regard, Canary seed having properties such as high yield per unit area, high tillering power, very fast growth and appropriate nutritional value, is of considerable importance and its cultivation development especially in arid and semi-arid regions can be effective in providing part of the country forage needs. Optimum water requirement is considered as one the important factors to obtain a high growth and yield of the product. On the other hand, Iran is located in arid and semi-arid climate region of the world . Therefore, determination of appropriate amount of irrigation water can lead to the improvement of water use efficiency and preventing the water loss. In order to achieve a high yield and desirable quality in plants one of the important requirements in agricultural planning is the evaluation of different systems of plant feeding. By applying an appropriate method in soil productivity, in addition to protecting the environment, optimization of water usage, reduction of erosion and protection of biodiversity can be increased. Therefore, gradually replacing chemical fertilizers with biological and organic fertilizers will result in providing feed requirements of plants, improvement of physical, chemical and biological conditions of soil and reduction of adverse environmental effects resulting from application of chemical inputs. The aim of this research was to study the effects of deficit irrigation and fertilizer management based on sole chemical and organic fertilizers or their integrated
Water and power installation for Lanzarote (Canary Islands) Spain
Energy Technology Data Exchange (ETDEWEB)
Krebs, F.
1977-03-01
Water producing and electrical generating facilities had to be increased on the Spanish Canary Island of Lanzarote for it to develop beyond its 1972 status. The Ministry of Public Works, prepared specifications for a turnkey installation of two 2500 M/sup 3//D desalting plants and a 5 MW (net) generating system. In 1973 through international competition Babcock and Wilcox, Espanola won a contract to build the installation. In December 1975 the construction of the project was completed. In early January 1976 the first line was producing 103% of the rated production at a thermal efficiency of 120% of the rated value. The second line was modified to operate at a reduced maximum brine temperature and commissioned. This plant was brought to full production which was 115% of the rated production in 2/sup 1///sub 2/ days. Problems and delays during the commissioning, were minimal. A 5 days performance test of the installation was run. During this test the water production was 111/sup 1///sub 2/% of the rated value at a specific energy consumption of 93% of the rated value while the maximum brine temperature was maintained 6/sup 0/C less than the design value. The high performances were achieved because the plants were well designed and built and properly commissioned. During the first 4/sup 1///sub 2/ months that the owner operated the installation it provided water and power as demanded. During that time the average plant production was 107% of the rated capacity.
Foronda, P; Valladares, B; Rivera-Medina, J A; Figueruelo, E; Abreu, N; Casanova, J C
2004-09-01
The prevalence and intensity of the parasites from 50 wild doves (Columba livia) from the city of Santa Cruz de Tenerife, in the island of Tenerife (Canary Archipelago), were studied. The following ectoparasites were found in apparently healthy pigeons (prevalences are shown in percentage (%) and mean intensities with their standard deviations): the acari Dermanyssus gallinae (De Geer, 1778) (6, 241.0 +/- 138.9) and Tinaminyssus melloi Fain, 1962 (10%, 218.3 +/- 117.3); the louses, Columbicola columbae Linnaeus, 1758 (100%, 111.4 +/- 76.8) and Campanulotes bidentatus Scopoli, 1763 (94%, 48.4 +/- 26.6); and the pigeon fly, Pseudolynchia canariensis Macquart, 1839 (36%, 6.2 +/- 1.6). The endoparasites we found were: a haemoprotozoan species, Haemoproteus columbae Kruze, 1890 (82%, 14.8 +/- 10.3 per 1000); coccidian oocysts, Eimeria sp. (50%, 0.2 x 10(3) +/- 1.7 x 10(3) per gr); a cestode species Raillietina micracantha (Fuhrmann, 1909) López Neyra, 1947 (44%, 12.3 +/- 9.4); and four nematode species, Tetrameres (Tetrameres) fissispina (Diesing, 1861) Travassos, 1915 (4%, 99.5 +/- 34.1), Synhimantus (Dispharynx) spiralis (Molin, 1858) (8%, 46.8 +/- 11.6), Ascaridia columbae (Gmelin, 1790) Travassos, 1913 (40%, 8.4 +/- 8.8) and Aonchotheca sp. (18%, 6.0 +/- 3.1). Several species detected in our study can be pathogens for C. bollii and C. junoniae, which are endemic pigeons of the Canary Islands, considered endangered species. Parasites (ectoparasites, protozoa and helminths) of C. livia found in Tenerife and others from wild and farm birds in the island were considered as healthy controls.
Wiche, Oliver; Székely, Balázs; Moschner, Christin; Heilmeier, Hermann
2015-04-01
Nitrogen (N) fertilization is necessary for growth and development of plants but it may also causes an increased metal uptake by plants due to changes of physiochemical properties of the elements in soil. The research in phytoremediation and phytomining conducted so far has revealed that the effect of nitrogen fertilizers initially depends on the form of application, as N is the only element that can be readily utilized by plants in its cationic (ammonia) or anionic form (nitrate) causing several effects in soil-plant system. However, to our knowledge most of the recent studies only documented an improvement of yield parameters and the uptake of heavy metals by plants as a result of different forms of N-fertilization. Here we report the result of a field experiment were we tried to obtain more information about the effects of form of N-fertilization on uptake of As, Pb, Sc Ge and U in reed canary grass (Phalaris arundinacea L.). In this study, reed canary grass was grown on 15 plots (4 m² each) under field conditions on a semi-field lysimer at the off-site soil recycling and remediation center in Hirschfeld (Saxony, Germany). To test the effects of a fertilization with different N-forms on the accumulation, the plots plants received 5 g N / m² in three doses as NH4SO4, Mg(NO3)2 or NH4NO3. The geometrical arrangement of plots was randomized and every treatment was fivefold replicated. After a 50 day period of plant growth, the plants were harvested and concentrations of trace metals in the shoots were measured with ICP-MS. As a result of the different N-treatments we found that in plants treated with NH4SO4 concentrations of Pb and As as well as of Sc, Ge and U were significantly increased in plant tissues compared to plants treated with NH4NO3. Furthermore, no significant changes in mineral composition of plants between the Mg(NO3)2 and NH4NO3 treatments could be observed. Our interpretation of these results is that it might be an effect of the acidification of
Betzin, Anja; Thiv, Mike; Koch, Marcus A
2016-09-01
Macaronesian laurel forest is among the worldwide hotspots of threatened biodiversity. With increasing evidence that woodland composition on the Canary Islands changed dramatically during the last few thousand years, the aim of this study was to find evidence for substantial recent population dynamics of two representative species from laurel forest. Amplified fragment length polymorphism (AFLP) was used to evaluate fine-scaled genetic variation of the paradigmatic tree Laurus novocanariensis (Lauraceae) and a long-lived herbaceous gentian from core laurel forest, Ixanthus viscosus (Gentianaceae), on Tenerife. Bioclimatic variables were analysed to study the respective climate niches. A chloroplast DNA screening was performed to evaluate additional genetic variation. Genetic diversity of the laurel tree showed severe geographic partitioning. On Tenerife, fine-scaled Bayesian clustering of genetic variation revealed a western and an eastern gene pool, separated by a zone of high admixture and with a third major gene pool. Compared with genetic clusters found on the other Canary Islands, the East-West differentiation on Tenerife seems to be more recent than differentiation between islands. This is substantiated by the finding of extremly low levels of chloroplast DNA-based polymorphisms. Ixanthus showed no geographic structuring of genetic variation. Genetic data from Tenerife indicate contemporary gene flow and dispersal on a micro/local scale rather than reflecting an old and relic woodland history. In particular for Laurus, it is shown that this species occupies a broad bioclimatic niche. This is not correlated with its respective distribution of genetic variation, therefore indicating its large potential for contemporary rapid and effective colonization. Ixanthus is more specialized to humid conditions and is mostly found in the natural Monteverde húmedo vegetation types, but even for this species indications for long-term persistence in the respective
Becerril, L.; Galindo, I.; Martí, J.; Gudmundsson, A.
2015-04-01
Using new surface structural data as well as subsurface structural data obtained from seventeen water galleries, we provide a comprehensive model of the volcano-tectonic evolution of El Hierro (Canary Islands). We have identified, measured and analysed more than 1700 volcano-structural elements including vents, eruptive fissures, dykes and faults. The new data provide important information on the main structural patterns of the island and on its stress and strain fields, all of which are crucial for reliable hazard assessments. We conducted temporal and spatial analyses of the main structural elements, focusing on their relative age and association with the three main cycles in the construction of the island: the Tiñor Edifice, the El Golfo-Las Playas Edifice, and the Rift Volcanism. A radial strike distribution, which can be related to constructive episodes, is observed in the on-land structures. A similar strike distribution is seen in the submarine eruptive fissures, which are radial with respect to the centre of the island. However, the volcano-structural elements identified onshore and reflecting the entire volcano-tectonic evolution of the island also show a predominant NE-SW strike, which coincides with the main regional trend of the Canary archipelago as a whole. Two other dominant directions of structural elements, N-S and WNW-ESE, are evident from the establishment of the El Golfo-Las Playas edifice, during the second constructive cycle. We suggest that the radial-striking structures reflect comparatively uniform stress fields during the constructive episodes, mainly conditioned by the combination of overburden pressure, gravitational spreading, and magma-induced stresses in each of the volcanic edifices. By contrast, in the shallower parts of the edifice the NE-SW, N-S and WNW-ESE-striking structures reflect local stress fields related to the formation of mega-landslides and masking the general and regional radial patterns.
Directory of Open Access Journals (Sweden)
Ana María López Sala
2007-10-01
Full Text Available The Sindhi diaspora is one of the most extensive and influential of Asian commercial diasporas. Its expansion commenced in the 15th century, but it grew significantly in the second half of the 19th century and in the middle of the 20th. The aim of this article is to describe the Sindhis’ settling and commercial activity on the Canary Islands one of the establishing points of the network and to produce a critical reflection of some of the alternative guidelines for economic integration in places where, as in this case, the territory is presented as a space of opportunities for achieving economic objectives. Such an analysis must consider the make-up and dynamic of this transnational network through which information, capital, goods and people circulate.
Utama, D T; Lee, S G; Baek, K H; Chung, W S; Chung, I A; Kim, D I; Kim, G Y; Lee, S K
2018-02-01
Holstein-Friesian steer beef production is renowned globally as a secondary product of the milk industry. Grass feeding is a common practice in raising Holstein steers because of its low cost. Furthermore, grass feeding is an alternative way to produce beef with a balanced n-6 to n-3 fatty acids (FAs) ratio. However, the performance and meat quality of Holstein-Friesian cattle is more likely to depend on a high-quality diet. The aim of this study was to observe whether feeding two mixed diets; a corn-based total mixed ration (TMR) with winter ryegrass (Lolium perenne) or flaxseed oil-supplemented pellets with reed canary grass haylage (n-3 mix) provided benefits on carcass weight, meat quality and FA composition compared with cattle fed with reed canary grass (Phalaris arundinacea) haylage alone. In all, 15 21-month-old Holstein-Friesian steers were randomly assigned to three group pens, were allowed free access to water and were fed different experimental diets for 150 days. Blood samples were taken a week before slaughter. Carcass weight and meat quality were evaluated after slaughter. Plasma lipid levels and aspartate aminotransferase (AST), γ-glutamyl transpeptidase (GGT), creatine kinase (CK) and alkaline phosphatase (ALP) activities were determined. Diet did not affect plasma triglyceride levels and GGT activity. Plasma cholesterol levels, including low-density and high-density lipoproteins, were higher in both mixed-diet groups than in the haylae group. The highest activities of plasma AST, CK and ALP were observed in the haylage group, followed by n-3 mix and TMR groups, respectively. Carcass weight was lower in the haylage group than in the other groups and no differences were found between the TMR and n-3 mix groups. Although the n-3 mix-fed and haylage-fed beef provided lower n-6 to n-3 FAs ratio than TMR-fed beef, the roasted beef obtained from the TMR group was more acceptable with better overall meat physicochemical properties and sensory scores
2012-04-17
.... Chirikof (620) 0.0031 7,282 23 Kodiak (630) 0.0002 8,986 2 Annual WYK (640) 0.0000 3,244 0 SEO (650) 0.0000... 293 0 Demersal shelf rockfish Annual SEO 0.0000 293 0 Thornyhead rockfish Annual W 0.0047 150 1 C 0...
DEFF Research Database (Denmark)
Karki, Sandhya; Elsgaard, Lars; Audet, Joachim
2014-01-01
below the soil surface. Gross primary production (GPP) was estimated from the above ground biomass yield. Results The mean dry biomass yield across all water table treatments was 6 Mg ha−1 with no significant differences between the treatments. Raising the GWL to the surface decreased both the net...... of peatlands grown with reed canary grass (RCG) and rewetted to various extents. Methods Gas fluxes of CO2, methane (CH4) and nitrous oxide (N2O) were measured with a static chamber technique for 10 months from mesocosms sown with RCG and manipulated to ground water levels (GWL) of 0, −10, −20, −30 and −40 cm...... The results showed that a reduction in total GHG emission can be achieved without losing the productivity of newly established RCG when GWL is maintained close to the surface. Further studies should address the practical constrains and long-term productivity of RCG cultivation in rewetted peatlands....
Production and survival of projection neurons in a forebrain vocal center of adult male canaries
International Nuclear Information System (INIS)
Kirn, J.R.; Alvarez-Buylla, A.; Nottebohm, F.
1991-01-01
Neurons are produced in the adult canary telencephalon. Many of these cells are incorporated into the high vocal center (nucleus HVC), which participates in the control of learned song. In the present work, 3H-thymidine and fluorogold were employed to follow the differentiation and survival of HVC neurons born in adulthood. We found that many HVC neurons born in September grow long axons to the robust nucleus of the archistriatum (nucleus RA) and thus become part of the efferent pathway for song control. Many of these new neurons have already established their connections with RA by 30 d after their birth. By 240 d, 75-80% of the September-born HVC neurons project to RA. Most of these new projection neurons survive at least 8 months. The longevity of HVC neurons born in September suggests that these cells remain part of the vocal control circuit long enough to participate in the yearly renewal of the song repertoire
Gonzalez, P. J.; Tiampo, K. F.
2010-12-01
Multitemporal space radar interferometry analysis between 1992 and 2000 revealed significantly deforming areas with a magnitude of 4-6 mm/yr of lengthening in the radar line of sight at Timanfaya volcano (Lanzarote, Canary Island). Timanfaya volcano erupted almost 300 years ago (1730-1736), along a 15 km-long fissure-feeding magmatic system, resulting in the longest and largest historical eruption of the Canarian archipelago to date, with >1 km3 of erupted basaltic lavas covering 200 km2. High surficial temperature (600 degrees-C at 13 m) and high heat flux measurements (150 mW/m2) suggest that the remnants of the magmatic chamber that fed the 1730-1736 are still partly molten. Here, we present preliminary models of the subsidence taking into account all available data, including geophysical data (heat flux, seismic, magnetotelluric and gravity), the geochemistry of freshly erupted lavas, upper mantle and crustal xenoliths, and structural geology.
O'Shanahan Juan, José Joaquín; Hernández Rodríguez, Miguel Ángel; Del Otero Sanz, Laura; Henríquez Suárez, José Andrés; Mahtani Chugani, Vinita
The need for new approaches to strategic planning by incorporating the perspectives of professionals and inhabitants has led to a new model for the 3rd Canary Islands (Spain) Health Plan (IIIPSC). A dual-phase participatory process using qualitative techniques is proposed: 1) local phase: a quantitative and qualitative study based on training and a research-action-participation initiative; and 2) insular phase: health conferences with face-to-face discussion of results in each health area (island) and proposals for action. The process prioritises problems and establishes a specific action plan for each island through initiatives that are considered to be viable, grouped by themes and weighted according to the potential impact on priority problems. This process of interaction may help to guide planning model changes and health policy decision-making, and was included in the IIIPSC Project for its parliamentary procedure. Copyright © 2016 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Mesoscale structures viewed by SAR and AVHRR near the Canary islands
Directory of Open Access Journals (Sweden)
E. D. Barton
2001-07-01
Full Text Available Comparison of Synthetic Aperture Radar and Advanced Very High Resolution Radiometry images of sea surface backscatter and temperature during the peak of the summer Trade winds reveals many aspects of the regional oceanography of the Canary Islands. A strong correspondence occurs between the SAR and AVHRR signals. The generally uniform wind field is perturbed as it flows past the islands producing regions of calm immediately downstream. These are bounded by lines of strong horizontal wind shear that coincide with temperature fronts between warmer lee waters and the cooler surrounding ocean. Weaker winds prevail up to 50 km downstream while enhanced wind speed on the boundaries of the lee can extend more than 150 km. Lee waves are excited in the atmospheric inversion layer where the wind passes over abrupt island topography. Quantitative estimates of wind speed made with the CMOD4 algorithm are unreliable in the downstream region because wind direction is variable and unknown and because spatial gradients in air-sea temperature difference affect atmospheric boundary layer stability. A large anticyclone south of Tenerife strongly influenced the estimated wind speed probably because higher ocean temperatures in its centre caused atmospheric instability and increased radar backscatter. The temperature fronts marking boundaries of the upwelling filament and strong eddies observed in AVHRR appear as lines of current shear in the SAR images.
DEFF Research Database (Denmark)
Kandel, Tanka Prasad; Elsgaard, Lars; Karki, Sandhya
2013-01-01
Reed canary grass (RCG, Phalaris arundinacea L.) is a suitable energy crop for cultivation in northern peatlands. However, the atmospheric impact of RCG cultivation as influenced by harvest frequency and fertilization is not clear. Here, we compared the biomass yield and greenhouse gas (GHG......) balance for RCG cultivation in peatlands affected by cutting frequency and fertilizer managements. The managements included one-cut (OC) and two-cut (TC) systems that were either fertilized (TC-F) or unfertilized (TC-U) after the first cut in summer. Biomass yield of OC, TC-F and TC-U were 12, 16 and 11...
DEFF Research Database (Denmark)
Kandel, Tanka Prasad; Hastings, Astley; Jørgensen, Uffe
2016-01-01
Miscanthus and reed canary grass (RCG) are C4 and C3 perennial grasses which are popular in Europe as energy crops. Although Miscanthus is relatively chilling tolerant compared to other C4 species, its production in northern Europe is still constrained by cold temperature. A more chilling tolerant...... Miscanthus cultivar which can emerge early in the spring would utilize more solar radiation and produce higher biomass yields. In this study, using MiscanFor model, we estimated potential biomass yield of Miscanthus in current and future climates with the assumption that breeding would provide a chilling...
Directory of Open Access Journals (Sweden)
Foronda P.
2004-09-01
Full Text Available The prevalence and intensity of the parasites from 50 wild doves (Columba livia from the city of Santa Cruz de Tenerife, in the island of Tenerife (Canary Archipelago, were studied. The following ectoparasites were found in apparently healthy pigeons (prevalences are shown in percentage (% and mean intensities with their standard deviations: the acari Dermanyssus gallinae (De Geer, 1778 (6 241 .0 ± 138.9 and Tinaminyssus melloi Fain, 1962 (10 %, 218.3 ± 117.3; the louses, Columbicola columbae Linnaeus, 1758 (100 %, 111.4 ± 76.8 and Campanulotes bidentatus Scopoli, 1763 (94 %, 48.4 ± 26.6; and the pigeon fly, Pseudolynchia canariensis Macquart, 1839 (36 %, 6.2 ± 1.6. The endoparasites we found, were: a haemoprotozoan species, Haemoproteus columbae Kruze, 1890 (82 %, 14.8 ± 10.3 per 1000; coccidian oocysts, Eimeria sp. (50 %, 0.2 x 103 ± 1.7 x 103 per gr; a cestode species Raillietina micracantha (Fuhrmann, 1909 López Neyra, 1947 (44 %, 12.3 ± 9.4; and four nematode species, Tetrameres (Tetrameres fissispina (Diesing, 1861 Travassos, 1915 (4 %, 99.5 ± 34,1, Synhimantus (Dispharynx spiralis (Molin, 1858 (8 %, 46. 8 ± 11.6, Ascaridia columbae (Gmelin, 1790 Travassos, 1913 (40 %, 8.4 ± 8.8 and Aonchotheca sp. (18 %, 6.0 ± 3.1. Several species detected in our study can be pathogens for C. bollii and C. junoniae, which are endemic pigeons of the Canary Islands, considered endangered species. Parasites (ectoparasites, protozoa and helminths of C. livia found in Tenerife and others from wild and farm birds in the island were considered as healthy controls.
Bioactive Secondary Metabolites from Schizogyne sericea (Asteraceae) Endemic to Canary Islands.
Venditti, Alessandro; Bianco, Armandodoriano; Muscolo, Camilla; Zorzetto, Christian; Sánchez-Mateo, Candelaria C; Rabanal, Rosa M; Quassinti, Luana; Bramucci, Massimo; Damiano, Silvia; Iannarelli, Romilde; Lupidi, Giulio; Papa, Fabrizio; Petrelli, Dezemona; Vitali, Luca A; Vittori, Sauro; Maggi, Filippo
2016-07-01
Schizogyne sericea (Asteraceae) is a halophytic shrub endemic to the Canary Islands and traditionally employed as analgesic, astringent, anti-inflammatory, and vulnerary. A comprehensive phytochemical investigation was conducted on the flowering aerial parts by analyzing both essential oil constituents and polar compounds. The essential oil was dominated by p-cymene, with the noteworthy occurrence of β-pinene and thymol esters. From the EtOH extract, eight compounds were isolated and structurally elucidated. Essential oil, polar fractions, and isolates (2), (4), and (5) were separately in vitro assayed for antiproliferative activity on human tumor cell lines (A375, MDA-MB 231, and HCT116) by MTT assay, for antioxidant potential by DPPH, ABTS, and FRAP assays, and for antimicrobial activity by the agar disk diffusion method. Results revealed that essential oil and compounds 1 and 2 exert a strong inhibition on tumor cells, and in some cases, higher than that of cisplatin. Fractions containing thymol derivatives (1 and 2) and caffeoylquinic acid derivatives 4 and 5 displayed antioxidant activity comparable to that of Trolox, making S. sericea extract an interesting natural product with potential applications as preservative or in the treatment of diseases in which oxidative stress plays an important role. © 2016 Wiley-VHCA AG, Zürich.
Directory of Open Access Journals (Sweden)
José Carlos Hernández
2006-12-01
Full Text Available Diadema antillarum Philippi occurs in high density populations in the Canary Islands, creating extensive barren areas. During one year we determined seasonal changes in the algal abundance and population densities, test diameter, gut contents and gonad index of sea urchins in two localities (Abades and Boca Cangrejo. Boca Cangrejo shows higher algae cover and species richness than Abades. The sea urchin population at Abades had a higher density and smaller urchins than Boca Cangrejo. Boca Cangrejo sea urchins showed higher specific richness in gut contents than Abades urchins. The sea urchin population at Abades did not have a clearer reproductive periodicity or higher gonad index than the Boca Cangrejo population. Temporal and spatial changes in gonad periodicity of Diadema antillarum are attributed, at least in part, to benthic food availability (algal cover and algal species number and intra-specific competition.
Directory of Open Access Journals (Sweden)
Vargas, J. M.
2004-12-01
Full Text Available The geographical patterns of Heteroptera species diversity in the Canary Islands were analysed, and endemic and non–endemic species were studied both together and separately. Causal processes most likely controlling these patterns, as well as the theory of island biogeography, hypotheses about evolutionary time, habitat heterogeneity, climatic stability, intermediate disturbances, energy, environmental favourableness–severity, productivity and human influence were investigated. The combination of habitat heterogeneity and human influence accounted for the total number of species. However, when endemic and non–endemic species were analysed separately, habitat heterogeneity and favourableness–severity explained the richness of endemic species, whereas habitat heterogeneity and human influence explained that of non–endemic species.
Landaeta, Mauricio F; Bustos, Claudia A; Contreras, Jorge E; Salas-Berríos, Franco; Palacios-Fuentes, Pámela; Alvarado-Niño, Mónica; Letelier, Jaime; Balbontín, Fernando
2015-05-01
During austral spring 2011, a survey was carried out in the inland sea (41°30'-44°S) of north Patagonia, South Pacific, studying a northern basin (NB: Reloncaví Fjord, Reloncaví Sound and Ancud Gulf) characterized by estuarine regime with stronger vertical stratification and warmer (11-14 °C) and most productive waters, and a southern basin (SB: Corcovado Gulf and Guafo mouth), with more oceanic water influence, showed mixed conditions of the water column, colder (11-10.5 °C) and less productive waters. Otolith microstructure and gut content analysis of larval lightfish Maurolicus parvipinnis and rockfish Sebastes oculatus were studied. Larval M. parvipinnis showed similar growth rates in both regions (0.13-0.15 mm d(-1)), but in NB larvae were larger-at-age than in SB. Larval S. oculatus showed no differences in size-at-age and larval growth (0.16 and 0.11 mm d(-1) for NB and SB, respectively). M. parvipinnis larvae from NB had larger number of prey items (mostly invertebrate eggs), similar total volume in their guts and smaller prey size than larvae collected in SB (mainly calanoid copepods). Larval S. oculatus had similar number, volume and body width of prey ingested at both basins, although prey ingestion rate by size was 5 times larger in NB than in SB, and prey composition varied from nauplii in NB to copepodites in SB. This study provides evidence that physical-biological interactions during larval stages of marine fishes from Chilean Patagonia are species-specific, and that in some cases large size-at-age correspond to increasing foraging success. Copyright © 2015 Elsevier Ltd. All rights reserved.
Luis, G; Rubio, C; González-Weller, D; Gutiérrez, A J; Revert, C; Hardisson, A
2014-04-01
Monitoring the metal content in foods such as potatoes is an important aspect of food safety and regulation. Samples of nine varieties of potatoes (73 samples of local potatoes and 77 samples of imported potatoes) were randomly obtained from supermarkets, farmers markets, and farmer plots in Tenerife (Canary Islands, Spain). The edible portion (pulp) was the only part considered for analysis because Spaniards traditionally eat only peeled potatoes. Cadmium (Cd) and lead (Pb) were determined using graphite furnace atomic absorption spectrometry. Cd concentrations ranged from 0.006 mg/kg in the Cara and Negra varieties to 0.019 mg/kg in the Bonita variety, and Pb concentrations ranged from 0.007 mg/kg in the Up-to-date variety to 0.023 mg/kg in the Recara variety. The mean concentrations of Cd (0.01 mg/kg) and Pb (0.014 mg/kg) were below the limits established by European regulations for potatoes (0.1 mg/kg of wet weight for each metal). Based on a mean consumption of 143.2 g of potato per person per day for the Canary Islands population, the mean daily intakes of Cd (0.015 mg/day) and Pb (0.023 mg/day) were below the legislated respective tolerable weekly intakes. Thus, the samples analyzed were considered safe to eat with regard to the metal concentrations found.
[Estimated prevalence of autism spectrum disorders in the Canary Islands].
Fortea Sevilla, M S; Escandell Bermúdez, M O; Castro Sánchez, J J
2013-12-01
To make an initial estimate of the prevalence of autism spectrum disorders (ASDs) among children in the province of Las Palmas (Spain). Descriptive study was conducted on 1,796 children between the ages of 18 and 30 months of age, all part of the Child Health Surveillance of the Canary Islands, more specifically the province of Las Palmas, with a population of 1,090,605. The parents of children involved completed the Spanish version of the Modified Checklist for Autism in Toddlers (M-CHAT/ES) in the paediatric clinic. The positive cases were then diagnosed by experts by means of the Autism Diagnostic Interview-Revised (ADIR) and the Autism Diagnostic Observation Schedule (ADOS). A 0.61% prevalence of ASDs was determined, similar to that reported in previous studies using the same tools. The ratio was six girls for every five boys. This was contrary to the results of previous studies which suggested more boys than girls were affected. This may have been due to the sample size, which will have to be increased in future studies to confirm this outcome. An increased sample size and also spread to other age ranges should be used in order to obtain a more reliable estimate of prevalence. As regards the gender ratio, this could be a result of the small size of the sample researched, and should therefore be confirmed by further studies. Copyright © 2012 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Rodrigo Riera
2014-09-01
Full Text Available A subtidal meiofaunal assemblage in Los Cristianos Bay, Tenerife, Canary Islands was sampled from May 2000 to April 2001, at 3 m depth. Nematodes dominated overwhelmingly during the study period, ranging from 84.52% in May 2000 to 95.93% in October 2000. Copepods and polychaetes were the second and the third most abundant groups, respectively. Meiofaunal densities showed significant differences throughout the study period, with minimum abundances during the spring-summer months (May-July and highest densities in winter (January and February. This seasonality is mainly due to the temporal variations of the most abundant species (nematodes Daptonema hirsutum and Pomponema sedecima, with differences in meiofauna species composition and abundance during May and June 2000 as compared to the remaining months of the study period. Environmental variables partly explained meiofaunal community structure, being the sedimentary type of very fine sands the most important, jointly with other variables, such as nitrogen and organic matter content.
Bhanot, K. K.; Downes, H.; Petrone, C. M.; Humphreys-Williams, E.
2017-04-01
Spinel pyroxene-clusters, which are intergrowths of spinel, orthopyroxene and clinopyroxene in mantle xenoliths, have been investigated through the use of micro-CT (μ-CT) in this study. Samples have been studied from two different tectonic settings: (1) the northern Massif Central, France, an uplifted and rifted plateau on continental lithosphere and (2) Lanzarote in the Canary Islands, an intraplate volcanic island on old oceanic lithosphere. μ-CT analysis of samples from both locations has revealed a range of spinel textures from small Lanzarote are regions that have experienced significant lithospheric thinning. This process provides a mechanism where the sub-solidus reaction of olivine + garnet = orthopyroxene + clinopyroxene + spinel is satisfied by providing a pathway from garnet peridotite to spinel peridotite. We predict that such textures would only occur in the mantle beneath regions that show evidence of thinning of the lithospheric mantle. Metasomatic reactions are seen around spinel-pyroxene clusters in some Lanzarote xenoliths, so metasomatism post-dated cluster formation.
DEFF Research Database (Denmark)
Karki, Sandhya; Elsgaard, Lars; Lærke, Poul Erik
2015-01-01
Cultivation of bioenergy crops in rewetted peatland (paludiculture) is considered as a possible land use option to mitigate greenhouse gas (GHG) emissions. However, bioenergy crops like reed canary grass (RCG) can have a complex influence on GHG fluxes. Here we determined the effect of RCG...... and bare soil were measured at weekly to fortnightly intervals with static chamber techniques for a period of 1 year. Cultivation of RCG increased both ER and CH4 emissions, but decreased the N2O emissions. The presence of RCG gave rise to 69, 75 and 85% of total ER at −20, −10 and 0 cm GWL, respectively...... from ER were obviously the dominant RCG-derived GHG flux, but above-ground biomass yields, and preliminary measurements of gross photosynthetic production, showed that ER could be more than balanced due to the photosynthetic uptake of CO2 by RCG. Our results support that RCG cultivation could be a good...
DEFF Research Database (Denmark)
Kandel, Tanka Prasad; Sutaryo, Sutaryo; Møller, Henrik Bjarne
2013-01-01
This study examined the influence of harvest time on biomass yield, dry matter partitioning, biochemical composition and biological methane potential of reed canary grass harvested twice a month in one-cut (OC) management. The regrowth of biomass harvested in summer was also harvested in autumn...... as a two-cut management with (TC-F) or without (TC-U) fertilization after summer harvest. The specific methane yields decreased significantly with crop maturity that ranged from 384 to 315 and from 412 to 283 NL (normal litre) (kg VS)-1 for leaf and stem, respectively. Approximately 45% more methane...... was produced by the TC-F management (5430 Nm3 ha-1) as by the OC management (3735 Nm3 ha-1). Specific methane yield was moderately correlated with the concentrations of fibre components in the biomass. Larger quantity of biogas produced at the beginning of the biogas assay from early harvested biomass...
Reyes-Batlle, María; Wagner, Carolina; Zamora-Herrera, Jonadab; Vargas-Mesa, Alejandro; Sifaoui, Ines; González, Ana C; López-Arencibia, Atteneri; Valladares, Basilio; Martínez-Carretero, Enrique; Piñero, José E; Lorenzo-Morales, Jacob
2016-09-01
In this study, twenty water samples were collected in the island of Lanzarote, Canary Islands, Spain in order to check for the presence of V. vermiformis strains in these samples. Water samples were cultured on 2% Non-Nutrient Agar (NNA) plates covered with a thin layer of heat killed E. coli and checked daily for the presence of Vermamoeba. After a week, V. vermiformis amoebae were observed in 2 of the 20 processed samples (10%) incubated at room temperature and 37°C. Molecular characterization was carried out by amplifying the 18S rDNA gene and DNA sequencing in order to confirm the identity of the isolated amoebic strains. To the best of our knowledge, this is the first report on the presence of FLA in environmental sources in Lanzarote Island and the first report of Vermamoeba vermiformis in water sources in this island. Furthermore, the two strains isolated in this study were collected in recreational areas with close contact with humans and thus awareness should be raised.
Jiménez, Juan E; Rodríguez, Cristina; Crespo, Patricia; González, Desirée; Artiles, Ceferino; Alfonso, Miguel
2010-11-01
The purpose of this study was to examine the effectiveness of second tier intervention at-risk readers within the context of a Response to Intervention approach. The study was conducted in the Canary Islands (Spain), directed by research team ¨Dificultades de Aprendizaje, Psicolingüística y Nuevas Tecnologías¨ (DEA&NT) from University of La Laguna, and supported by the Government of the Canary Islands. A sample of 1.123 Spanish children from fourteen schools districts were given the Spanish adaptation of The Hong Kong Specific Learning Difficulties Behavior Checklist and children who scored at or above the 75th percentile on the test were classified as "at risk" for early reading difficulties. Half of the students were randomly assigned to a project-based intervention condition where they received small group supplementary intervention for 30 minutes daily using the Prevención de las Dificultades Específicas de Aprendizaje (PREDEA) curriculum from mid to late December and continued until mid June. The other half received whatever remedial services were available at their schools. Results indicated that children who received the PREDEA curriculum had higher scores on the Early Grade Reading Assessment Test (EGRA) on initial sound identification, listening comprehension, letter sound knowledge and oral reading fluency compared to the control group.
Luzardo, Octavio P; Rodríguez-Hernández, Angel; Quesada-Tacoronte, Yohana; Ruiz-Suárez, Norberto; Almeida-González, Maira; Henríquez-Hernández, Luis Alberto; Zumbado, Manuel; Boada, Luis D
2013-10-01
Analysis of 16 polycyclic aromatic hydrocarbons (PAHs), 20 organochlorine pesticides (OCPs) and 18 polychlorinated biphenyls (PCBs) were performed on eggs from three different production types (conventional, free-run and organic) collected from the markets of the Canary Islands (Spain). Unlike other studies we did not found differences in the content of PCBs or OCPs of eggs in relation to its production type. Median ∑OCPs content was 3.87 ng g⁻¹ fat, being dieldrin, dicofol, hexachlorobenzene, p,p'-DDE and p,p'-DDT the most frequently detected. Median ∑PCBs value was 3.93 ng g⁻¹ fat, with 79.9% of this amount coming from the marker PCBs. Two samples, one free-run and one organic, greatly exceeded the current European Commission (EC) limit of 2.5 pg TEQ(PCDD/F) g⁻¹ lipid, but the rest were well below of this limit. The concentrations of PAHs in conventionally produced eggs were almost 4 times higher than in free-run or organic eggs. Mean dietary intake estimates of the organochlorine contaminants based on consumption of eggs, regardless of the type chosen, is negligible for the Canary Islands' population. However, the median dietary intake estimates of PAHs greatly depend on the type of eggs chosen, being much lower when free-run and organic eggs are consumed. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Noé Francisco Rodríguez
2014-07-01
Full Text Available Introduction Trypanosoma evansi was first identified in the Canary Islands in 1997, and is still present in a small area of the Archipelago. To date, the disease has exclusively affected camel herds, and has not been detected in any other animal hosts. However potential vectors of Trypanosoma evansi must be identified. Methods One Nzi trap was placed on a camel farm located in the infected area for a period of one year. Results Two thousand five hundred and five insects were trapped, of which Stomoxys calcitrans was the sole hematophagous vector captured. Conclusions Stomoxys calcitrans could be exclusively responsible for the transmission of Trypanosoma evansi among camels in the surveyed area, as other species do not seem to be infected by S. calcitrans in the presence of camels.
Directory of Open Access Journals (Sweden)
Antonio Arnaiz-Villena
2012-04-01
Full Text Available 760 officially recognized scripts on ceramics from Iruña-Veleia excavated by the archaeology firm Lurmen S.L. (approximately between years 2002-2008 have been analyzed. A number of these ceramics contains scripts which may be assimilated to Iberian/Tartessian writings. This number may be underestimated since more studies need to be done in already available and new found ceramics. This is the second time that Iberian writing is found by us in an unexpected location together with the Iberian-Guanche inscriptions of Lanzarote and Fuerteventura (Canary Islands. On the other hand, naviform scripting, usually associated to Iberian rock or stone engraving may have also been found in Veleia. Strict separation, other than in time and space stratification, between Iberian and (South Tartessian culture and script is doubted.
Diversity of acetic acid bacteria present in healthy grapes from the Canary Islands.
Valera, Maria José; Laich, Federico; González, Sara S; Torija, Maria Jesús; Mateo, Estibaliz; Mas, Albert
2011-11-15
The identification of acetic acid bacteria (AAB) from sound grapes from the Canary Islands is reported in the present study. No direct recovery of bacteria was possible in the most commonly used medium, so microvinifications were performed on grapes from Tenerife, La Palma and Lanzarote islands. Up to 396 AAB were isolated from those microvinifications and identified by 16S rRNA gene sequencing and phylogenetic analysis. With this method, Acetobacter pasteurianus, Acetobacter tropicalis, Gluconobacter japonicus and Gluconacetobacter saccharivorans were identified. However, no discrimination between the closely related species Acetobacter malorum and Acetobacter cerevisiae was possible. As previously described, 16S-23S rRNA gene internal transcribed spacer (ITS) region phylogenetic analysis was required to classify isolates as one of those species. These two species were the most frequently occurring, accounting for more than 60% of the isolates. For typing the AAB isolates, both the Enterobacterial Repetitive Intergenic Consensus (ERIC)-PCR and (GTG)5-PCR techniques gave similar resolution. A total of 60 profiles were identified. Thirteen of these profiles were found in more than one vineyard, and only one profile was found on two different islands (Tenerife and La Palma). Copyright © 2011 Elsevier B.V. All rights reserved.
Assessment of ASTER data for forest inventory in Canary Islands
Alonso-Benito, Alfonso; Arbelo, Manuel; Hernandez-Leal, Pedro A.; González-Calvo, Alejandro; Labrador Garcia, Mauricio
To understand and evaluate the forest structural attributes, forest inventories are conducted, which are costly and lengthy in time. Since the last 10-15 years there has been examining the possibility of using remote sensing data, to save costs and cheapen the process. One of the aims of SATELMAC, a project PCT-MAC 2007-2013 co-financing with FEDER funds, is to automate the forest inventory in Canary Islands using satellite images. In this study, Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) data were used to estimate forest structure of the endemic vegetal specie, Pinus canariensis, located on the island of Tenerife (Spain). The forest structural attributes analyzed have been volume, basal area, stem per hectare and tree height. ASTER is an imaging instrument flying on Terra, a satellite launched in December 1999 as part of NASA's Earth Observing System. ASTER data were used because it have relatively high spatial resolution in the three visible and near-infrared bands (15 m) and in the six spectral bands (30 m) in the shortwave-IR region. To identify the vegetation index that is most suitable to use, about specific forest structural attributes in our study area, we assess the ability of different spectral indices: Normalized Difference Vegetation Index, Transformed Soil Adjusted Vegetation Index, Modified Soil adjusted Vegetation Index, Perpendicular Vegetation Index and Reduced Simple Ratio. The information provided by the ASTER data has been supplemented by the Third National Forest Inventory (III NFI) and field data. The results are analyzed statistically in order to see the degree of correlation (R2) and the mean square error (RMSE) of the values studied.
Directory of Open Access Journals (Sweden)
Ramón Díaz Hernández
2014-12-01
Full Text Available En este trabajo formulamos como hipótesis de partida que Canarias, como frontera meridional de Europa, en un contexto de creciente internacionalización, tiene en los mercados africanos una gran baza histórica que desempeñar. Dado el interés general que este asunto suscita entre las ciencias sociales, se requiere abordarlo desde el análisis geográfico. Para cumplimentar este estudio se emplearon las estadísticas que ofrecen organismos oficiales como el Instituto Nacional de Estadística, Instituto Canario de Estadística, Agencia Estatal de la Administración Tributaria, Instituto de Comercio Exterior y entidades internacionales como la Conferencia de las Naciones Unidas para el Comercio y el Desarrollo (UNCTAD y la Organización Mundial del Comercio (OCM.In this work we formulate the hypothesis that the Canary Islands, as Europe’s southern border, must develop an important role in African markets, in a context of increasing internationalization. Because of the general interest in this issue within the social sciences, to address it from the geographic analysis is required. This study is based, on the one hand, on statistics provided by Spanish government agencies such as the National Statistics Institute, the Canary Institute of Statistics, the State Tax Administration Agency and the Institute of Foreign Trade and, on the other hand, by international entities such as the United Nations Conference for Trade and Development (UNCTAD and the World Trade Organization (WTO.
Luzardo, Octavio P; Almeida, Maira; Zumbado, Manuel; Boada, Luis D
2011-11-01
The social problems of drug abuse are a matter of increasing global problem. Nowadays, international agencies need fresh methods to monitor trends of the use of illicit drugs. In this sense, small amounts of drugs are transferred to banknotes and they could be detected and quantified. An analytical procedure based upon extraction with organic solvent, liquid chromatography separation, and mass spectrometric detection allowed the identification of 21 drugs and metabolites in 120 used Euro banknotes collected in the Canary Islands (Spain). Most of the banknotes analyzed showed detectable drug residues (92.5%). Cocaine was the most frequently detected drug, present in approximately 90% of the samples. In addition, 75%, 35%, and 15% of the banknotes showed residues of amphetamine derivatives, opiates, and benzodiazepines, respectively. An average of three drug residues per banknote was detected. In summary, the presence of drug residues in banknotes could be useful as tracer for drugs prevalence. © 2011 American Academy of Forensic Sciences.
González, Sara S; Alcoba-Flórez, Julia; Laich, Federico
2013-01-01
During the characterization of the microbiota biodiversity associated with grapes and wineries in different bioclimatic conditions of the Canary Islands (Spain), a novel yeast species was isolated from Lanzarote, the driest wine-producing region of the archipelago. Seven strains isolated from grapes, microvinifications and wineries are described. Sequence analysis of the D1/D2 domain of the LSU rDNA gene and 5.8S-ITS regions revealed that the isolates were phylogenetically a member of the genus Lachancea and are closely related to Lachancea meyersii NRRL Y-27269(T) and Lachancea nothofagi NRRL Y-48670(T). On the basis of morphological, biochemical and physiological characterization and phylogenetic analysis, a novel ascosporogenous yeast species, Lachancea lanzarotensis sp. nov., is proposed. The type strain is L2C-15(T) ( = CBS 12615(T) = CECT 13066(T)) which was isolated from grape berries of Vitis vinifera L. cv. Listán Negro red grape variety in Tinajo, Lanzarote. The MycoBank no. is MB 801390.
Energy Technology Data Exchange (ETDEWEB)
Richie, A.B.
2005-07-01
The Topgrass Project, established in 2002, investigated the potential of miscanthus, switchgrass and reed canary grass as biofuel crops at various sites in the UK. This interim report covers the period from the harvesting in winter 2003/04 to the harvesting in winter 2004/05. The report gives details on (i) pest and weed control and (ii) yields and associated costs per species per unit area. It was concluded that maximum potential yield has not been reached at some sites. The study was funded by the DTI and carried out by IACR Rothamstead with ADAS Consulting, Duchy College Cornwall and SCRI Invergowrie as collaborators. The project has now terminated.
Longpre, M. A.; Muller, J.; Beaudry, P.; Andronikides, A.; Felpeto, A.
2017-12-01
Since the 16th century, at least 13 volcanic eruptions have occurred in the Canary Islands that formed monogenetic cinder cones and lava flow fields: 2 on Lanzarote, 4 on Tenerife, 6 on La Palma, and 1 on the submarine flank of El Hierro. Here we present a comprehensive new dataset of tephra composition for all 13 eruptions, comprising major and trace element data for bulk rocks and matrix glasses, as well as vesicularity and crystallinity measurements. In addition, we compile available volcanological and petrological information for specific eruptions, including estimates of lava flow area and volume. All lapilli samples show a vesicularity of 40-50 vol% and a vesicle-free crystallinity (crystals ≥ 250 µm) of 5-15 vol%. Modal mineralogy varies significantly between samples, typically consisting of olivine ± clinopyroxene ± Fe-Ti oxide ± plagioclase ± amphibole in different proportions. All but 2 tephras have basanite-tephrite bulk rock compositions. Lapilli from vents of the AD 1730-1736 Timanfaya eruption, Lanzarote, largely are basaltic, whereas the AD 1798 Chahorra eruption, Tenerife, produced phonotephrite tephra. These results are in agreement with published bulk lava flow data. Unsurprisingly, glass compositions are more evolved than bulk rocks and MgOglass is weakly positively correlated to MgObulk (MgOglass = 0.30*MgObulk + 2.11, R2 = 0.54). Both bulk rocks and glasses show strikingly similar multi-element diagram patterns, with strong enrichment relative to the bulk-silicate Earth and marked positive Nb and Ta and negative Pb anomalies — typical for ocean island basalts. Glass/bulk rock elemental ratios reveal systematic differences between samples that relate to their mineralogy; for example, Lanzarote tephras that lack significant clinopyroxene and Fe-Ti oxide crystals have higher Scglass/Scbulk and Vglass/Vbulk than Tenerife, La Palma and El Hierro samples that typically contain these minerals. Among all elements, K and P display the greatest
Tomé, Beatriz; Pereira, Ana; Jorge, Fátima; Carretero, Miguel A; Harris, D James; Perera, Ana
2018-03-19
Host-parasite relationships are expected to be strongly shaped by host specificity, a crucial factor in parasite adaptability and diversification. Because whole host communities have to be considered to assess host specificity, oceanic islands are ideal study systems given their simplified biotic assemblages. Previous studies on insular parasites suggest host range broadening during colonization. Here, we investigate the association between one parasite group (haemogregarines) and multiple sympatric hosts (of three lizard genera: Gallotia, Chalcides and Tarentola) in the Canary Islands. Given haemogregarine characteristics and insular conditions, we hypothesized low host specificity and/or occurrence of host-switching events. A total of 825 samples were collected from the three host taxa inhabiting the seven main islands of the Canarian Archipelago, including locations where the different lizards occurred in sympatry. Blood slides were screened to assess prevalence and parasitaemia, while parasite genetic diversity and phylogenetic relationships were inferred from 18S rRNA gene sequences. Infection levels and diversity of haplotypes varied geographically and across host groups. Infections were found in all species of Gallotia across the seven islands, in Tarentola from Tenerife, La Gomera and La Palma, and in Chalcides from Tenerife, La Gomera and El Hierro. Gallotia lizards presented the highest parasite prevalence, parasitaemia and diversity (seven haplotypes), while the other two host groups (Chalcides and Tarentola) harbored one haplotype each, with low prevalence and parasitaemia levels, and very restricted geographical ranges. Host-sharing of the same haemogregarine haplotype was only detected twice, but these rare instances likely represent occasional cross-infections. Our results suggest that: (i) Canarian haemogregarine haplotypes are highly host-specific, which might have restricted parasite host expansion; (ii) haemogregarines most probably reached the
Directory of Open Access Journals (Sweden)
Federico Fabbri
2015-03-01
Full Text Available Seagrass meadows perform essential ecosystem functions and services. Though the meadows are globally deteriorating, numerous regressions remain unreported as a result of data fragmentation. Cymodocea nodosa is the most important seagrass in shallow coastal waters of the Canary Islands. No study has so far investigated temporal population trends at the entire archipelago scale. Using data collected in the past 23 years by local companies, public authorities and research groups, the population trends of Cymodocea nodosa were analysed over the past two decades at the scales of islands, island sectors and meadows. During this period, a prevalence of negative trends was revealed for three seagrass demographic descriptors (seagrass shoot density, coverage and leaf length at the three scales, evidencing an overall deterioration in seagrass meadow integrity. These results suggest the need to develop correct management strategies to guarantee the conservation of this seagrass and the meadows it creates.
Puppo, Pamela; Curto, Manuel; Gusmão-Guedes, Joana; Cochofel, Jaqueline; Pérez de Paz, Pedro Luis; Bräuchler, Christian; Meimberg, Harald
2015-08-01
Here we reconstruct the evolutionary history of Micromeria in the Canary Islands using eight nuclear markers. Our results show two centers of diversification for Micromeria, one in the eastern islands Gran Canaria and Lanzarote, the other in the western islands, Tenerife, La Palma and El Hierro. Suggested directions of inter-island colonization are the following: Gran Canaria to Lanzarote and La Gomera; Tenerife to La Palma (from the paleoisland of Teno), to El Hierro (from the younger, central part), and to La Gomera and Madeira (from the paleoislands). Colonization of La Gomera probably occurred several times from Gran Canaria and Tenerife. The taxonomic implications of these results are discussed. Incongruence among the different markers was evaluated and, using next generation sequencing, we investigated if this incongruence is due to gene duplication. Copyright © 2015 Elsevier Inc. All rights reserved.
[Seroprevalence of Q fever among the adult population of Lanzarote (Canary Islands)].
Pascual Velasco, F; Rodríguez Pérez, J C; Otero Ferrio, I; Borobio Enciso, M V
1992-09-01
Q fever is an endemic zoonosis in the Canary Islands. In 1986, we detected, in a pilot study, residual antibodies of the infection in 3% of the population from Lanzarote. In 1989, we performed a new study in order to assess seroprevalence of Q fever among the adult native population from the island. We studied 390 human serums obtained from an statistically representative sample. Age ranged from 30 to 64 years. Out of 390 serums, 196 (50.25%) were obtained from men and 194 (49.74%) from women. The serological technique used was the fixation of complement using Coxiella burnetii antigens in phase II. Titres equal or higher than 1/8 were considered positive. No statistically significant differences were observed with regard to seroprevalence rates considering sex, age, nor living in or outside the island's capital city. However, when dividing the island's territory in three areas (north, centre and south), and assessing independently their respective seroprevalences, we observed relatively higher seroprevalences in the furthest areas (13.3% in the north and 13.5% in the south) than in the central area (4.7%), although only the higher seroprevalence in the south reached statistical significance when compared with the mean prevalence. Probably, these observations indicate that, although Q fever is extended all over the island, it is a more frequent infection in rural areas of Lanzarote, at the north and the south, than in the central area, where the main urban areas are located.
Valladares, María; Reyes-Batlle, María; Martín-Navarro, Carmen M; López-Arencibia, Atteneri; Dorta-Gorrín, Alexis; Wagner, Carolina; Martínez-Carretero, Enrique; Piñero, José E; Valladares, Basilio; Lorenzo-Morales, Jacob
2015-06-01
The present study describes two cases of Acanthamoeba infections (keratitis and ascites/peritonitis) in small breed domestic dogs in Tenerife, Canary Islands, Spain. In both cases, amoebic trophozoites were observed under the inverted microscope and isolated from the infected tissues and/or fluids, without detecting the presence of other viral, fungal or bacterial pathogens. Amoebae were isolated using 2 % non-nutrient agar plates and axenified for further biochemical and molecular analyses. Osmotolerance and thermotolerance assays revealed that both isolates were able to grow up to 37 °C and 1 M of mannitol and were thus considered as potentially pathogenic. Moreover, the strains were classified as highly cytotoxic as they cause more than 75 % of toxicity when incubated with two eukaryotic cell lines. In order to classify the strains at the molecular level, the diagnostic fragment 3 (DF3) region of the 18S rDNA of Acanthamoeba was amplified and sequenced, revealing that both isolates belonged to genotype T4. In both cases, owners of the animals did not allow any further studies or follow-up and therefore the current status of these animals is unknown. Furthermore, the isolation of these pathogenic amoebae should raise awareness with the veterinary community locally and worldwide.
Directory of Open Access Journals (Sweden)
Desiderio Juan García-Almeida
2017-05-01
Full Text Available This paper sheds light on the relationship between immigration and tourism competitiveness on the island of Lanzarote through the analysis of reputation from the demand perspective. The tourists’ knowledge about news on immigration from a destination, their contact with immigrants in the area, and the influence of the presence of immigrants there are studied, as all these factors can have a major impact on island competitiveness in tourism. The empirical work has been conducted with a survey of tourists on Lanzarote, Canary Islands, Spain. A total of 359 valid questionnaires were obtained. Results show a relatively low impact and retention of immigration news about the destination, and a low perceived contact with non-European immigrants when visiting the island. Moreover, tourists tend to recognize the positive value created by immigrants on the island, though some negative effects are also indicated. Finally, immigration seems to have a positive impact on the tourist’s global satisfaction and loyalty to the island destination.
Claisse, J.; Pondella, D.; Love, M.; Zahn, L.; Williams, C.; Bull, A. S.
2016-02-01
When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.
Claisse, Jeremy T; Pondella, Daniel J; Love, Milton; Zahn, Laurel A; Williams, Chelsea M; Bull, Ann S
2015-01-01
When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.
Directory of Open Access Journals (Sweden)
Jeremy T Claisse
Full Text Available When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes. "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.
Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival
Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.
2017-10-01
Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastes spp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.
Roegner, G. Curtis; Daly, Elizabeth A.; Brodeur, Richard D.
2013-06-01
In the California Current coastal boundary zone, the spring transition between downwelling and upwelling conditions, along with the fluctuating structure of the Columbia River plume, creates highly dynamic interactions. In this study, we investigated whether the surface distribution of brachyuran larvae and ichthyoplankton would track the dynamics of the Columbia River plume. By happenstance, the cruise period coincided with the spring transition from downwelling to sustained upwelling conditions in 2010, a year when the transition was delayed and Columbia River flow was substantially higher than average. We used time series of wind and freshwater input to evaluate the influence of physical forcing on oceanographic patterns, and sampled hydrography and surface plankton concentrations within a 182 km2 grid off Willapa Bay, WA. Additionally, two longer transects, one cross-shelf and the other along-shore, were made to discern the extent of plume influence on larval crab and fish abundance. We found that plume waters that were trapped in a northward-flowing coastal-boundary current during downwelling conditions were advected offshore after several days of upwelling-favorable winds. Neustonic collections of brachyuran larvae and ichthyoplankton varied in response to this large seaward advective event. Megalopae of cancrid crabs exhibited patterns of both offshore transport (Cancer oregonensis/productus) and nearshore retention (C. magister). Additionally, abundant numbers of large juvenile widow (Sebastes entomelas) and yellowtail (S. flavidus) rockfish of a size appropriate for settlement were sampled during a period when ocean conditions favored high recruitment success. These results demonstrated that the response of planktonic crab larvae and ichthyoplankton to large-scale advection varied by species, with larger and more vagile fish exhibiting less evidence of passive transport than smaller crab larvae. Importantly, portions of the planktonic fish and crab
Long-term variation in a central California pelagic forage assemblage
Ralston, Stephen; Field, John C.; Sakuma, Keith M.
2015-06-01
A continuous 23 year midwater trawl survey (1990-2012) of the epipelagic forage assemblage off the coast of central California (lat. 36°30‧-38°20‧ N) is described and analyzed. Twenty taxa occurred in ≥ 10% of the 2037 trawls that were completed at 40 distinct station locations. The dominant taxa sampled by the 9.5 mm mesh net included a suite of young-of-the-year (YOY) groundfish, including rockfish (Sebastes spp.) and Pacific hake (Merluccius productus), two clupeoids (Engraulis mordax and Sardinops sagax), krill (Euphausiacea), cephalopods (Doryteuthis opalescens and Octopus sp.), and a variety of mesopelagic species, i.e., Diaphus theta, Tarltonbeania crenularis, "other" lanternfish (Myctophidae), deep-sea smelts (Bathylagidae), and sergestid shrimp. Annual abundance estimates of the 20 taxa were obtained from analysis of variance models, which included year and station as main effects. Principal components analysis of the abundance estimates revealed that 61% of assemblage variance was explained by the first three components. The first component revealed a strong contrast in the abundance of: (a) YOY groundfish, market squid (D. opalescens), and krill with (b) mesopelagics and clupeoids; the second component was associated with long-term trends in abundance. An evaluation of 10 different published oceanographic data sets and CTD data collected during the survey indicated that seawater properties encountered each year were significantly correlated with abundance patterns, as were annual sea-level anomalies obtained from an analysis of AVISO satellite information. A comparison of our findings with several other recent studies of biological communities occurring in the California Current revealed a consistent structuring of forage assemblages, which we conjecture is primarily attributable to large-scale advection patterns in the California Current ecosystem.
Seroprevalence of Angiostrongylus cantonensis in wild rodents from the Canary Islands.
Martin-Alonso, Aarón; Foronda, Pilar; Quispe-Ricalde, María Antonieta; Feliu, Carlos; Valladares, Basilio
2011-01-01
Angiostrongylus cantonensis is a lungworm of rats (Muridae) that is the causative agent of human cerebral angiostrongyliasis. The life cycle of A. cantonensis involves rats and mollusks as the definitive and intermediate hosts, respectively. This study was designed to increase the knowledge about the occurrence and distribution of A. cantonensis in its definitive host in the Canary Islands, using parasitological and serological analysis in different areas and age groups. Between 2009 and 2010, 54 black rats (Rattus rattus) from Tenerife were captured from six human-inhabited areas and sera samples were obtained. The lung nematodes were identified by morphological and molecular tools as A. cantonensis. The 31-kDa glycoprotein antigen was purified from A. cantonensis adult worms by electrophoresis and electroelution. Of the 54 tested rodents, 30 showed IgG antibodies against A. cantonensis 31-kDa antigen by ELISA. Therefore, the overall seroprevalence was 55.6% (95% CI: 42.4-68). Seroprevalent rodents were found in all the 6 areas. This 31-kDa antigen was not recognized by some sera of rats infected by other helminth species (but not A. cantonensis). Seroprevalence of IgG antibodies against A. cantonensis and prevalence based on the presence of adult worms showed significant correlation (R(2) = 0.954, p<0.05). The present results could indicate a high prevalence of A. cantonensis in Tenerife and suggest the inclusion of two new zones in the distribution area of the parasite. The commonness and wide distribution of A. cantonensis in rats implies the presence of intermediate hosts, indicating that humans may be at risk of getting infected.
Kandel, Tanka P; Sutaryo, Sutaryo; Møller, Henrik B; Jørgensen, Uffe; Lærke, Poul E
2013-02-01
This study examined the influence of harvest time on biomass yield, dry matter partitioning, biochemical composition and biological methane potential of reed canary grass harvested twice a month in one-cut (OC) management. The regrowth of biomass harvested in summer was also harvested in autumn as a two-cut management with (TC-F) or without (TC-U) fertilization after summer harvest. The specific methane yields decreased significantly with crop maturity that ranged from 384 to 315 and from 412 to 283 NL (normal litre) (kgVS)(-1) for leaf and stem, respectively. Approximately 45% more methane was produced by the TC-F management (5430Nm(3)ha(-1)) as by the OC management (3735Nm(3)ha(-1)). Specific methane yield was moderately correlated with the concentrations of fibre components in the biomass. Larger quantity of biogas produced at the beginning of the biogas assay from early harvested biomass was to some extent off-set by lower concentration of methane. Copyright © 2012 Elsevier Ltd. All rights reserved.
Comments on Uncertainty in Groundwater Governance in the Volcanic Canary Islands, Spain
Directory of Open Access Journals (Sweden)
Emilio Custodio
2015-06-01
Full Text Available The uncertainty associated with natural magnitudes and processes is conspicuous in water resources and groundwater evaluation. This uncertainty has an essential component and a part that can be reduced to some extent by increasing knowledge, improving monitoring coverage, continuous elaboration of data and accuracy and addressing the related economic and social aspects involved. Reducing uncertainty has a cost that may not be justified by the improvement that is obtainable, but that has to be known to make the right decisions. With this idea, this paper contributes general comments on the evaluation of groundwater resources in the semiarid Canary Islands and on some of the main sources of uncertainty, but a full treatment is not attempted, nor how to reduce it. Although the point of view is local, these comments may help to address similar situations on other islands where similar problems appear. A consequence of physical and hydrological uncertainty is that different hydrogeological and water resource studies and evaluations may yield different results. Understanding and coarsely evaluating uncertainty helps in reducing administrative instability, poor decisions that may harm groundwater property rights, the rise of complaints and the sub-optimal use of the scarce water resources available in semiarid areas. Transparency and honesty are needed, but especially a clear understanding of what numbers mean and the uncertainty around them, to act soundly and avoid conflicting and damaging rigid attitudes. However, the different situations could condition that what may be good in a place, may not always be the case in other places.
Energy Technology Data Exchange (ETDEWEB)
Jonsson, Aasa; Paulrud, Susanne; Laitila, Thomas
2010-02-15
The contribution of energy crops from the agricultural sector is an example of a resource that has a potential to increase substantially in the near future. However, one problem is the lack of interest in cultivating energy crops within the agricultural Several studies have shown that there are a number of reasons for farmers not becoming involved in energy crops. Besides biological aspects, market potential and profitability the farmers are also affected by the available resources on the farm, the effect of the crops on the surroundings, work load, liquidity and the perceived risks. The overall aim with the present study is to increase the knowledge about how to change farmers' attitudes regarding energy crop cultivation, i.e. making them more interested. This study also shows that there is a large fraction of farmers that generally believe they have no or little knowledge of energy crops, such as willow, reed canary grass and hemp. The fraction of farmers considering there is a larger probability of future cultivation of these crops with increased knowledge is also quite large. Energy crop cultivation does not suit everybody. Generally, growing willow and reed canary grass is an alternative for farmers having another business besides agricultural business. Characteristics for these farms are working hours <1500 hours and that the machines are partly owned
Pérez, Nemesio M.; Somoza, Luis; Hernández, Pedro A.; de Vallejo, Luis González; León, Ricardo; Sagiya, Takeshi; Biain, Ander; González, Francisco J.; Medialdea, Teresa; Barrancos, José; Ibáñez, Jesús; Sumino, Hirochika; Nogami, Kenji; Romero, Carmen
2014-12-01
We report precursory geophysical, geodetic, and geochemical signatures of a new submarine volcanic activity observed off the western coast of El Hierro, Canary Islands. Submarine manifestation of this activity has been revealed through acoustic imaging of submarine plumes detected on the 20-kHz chirp parasound subbottom profiler (TOPAS PS18) mounted aboard the Spanish RV Hespérides on June 28, 2012. Five distinct "filament-shaped" acoustic plumes emanating from the flanks of mounds have been recognized at water depth between 64 and 88 m on a submarine platform located NW El Hierro. These plumes were well imaged on TOPAS profiles as "flares" of high acoustic contrast of impedance within the water column. Moreover, visible plumes composed of white rafts floating on the sea surface and sourcing from the location of the submarine plumes were reported by aerial photographs on July 3, 2012, 5 days after acoustic plumes were recorded. In addition, several geophysical and geochemical data support the fact that these submarine vents were preceded by several precursory signatures: (i) a sharp increase of the seismic energy release and the number of daily earthquakes of magnitude ≥2.5 on June 25, 2012, (ii) significant vertical and horizontal displacements observed at the Canary Islands GPS network (Nagoya University-ITER-GRAFCAN) with uplifts up to 3 cm from June 25 to 26, 2012, (iii) an anomalous increase of the soil gas radon activity, from the end of April until the beginning of June reaching peak values of 2.7 kBq/m3 on June 3, 2012, and (iv) observed positive peak in the air-corrected value of 3He/4He ratio monitored in ground waters (8.5 atmospheric 3He/4He ratio ( R A)) at the northwestern El Hierro on June 16, 2012. Combining these submarine and subaerial information, we suggest these plumes are the consequence of submarine vents exhaling volcanic gas mixed with fine ash as consequence of an event of rapid rise of volatile-rich magma beneath the NW submarine ridge
Directory of Open Access Journals (Sweden)
Miguel A. González-Pérez
2009-01-01
Full Text Available Six novel polymorphic microsatellite markers were isolated from enriched libraries in Myrica faya Ait., recently renamed Morella faya , (fayatree, firetree, or firebush in order to examine the genetic diversity in natural populations. Also, test cross-specific amplification and genetic diversity in Myrica rivas-martinezii, which is endemic on the Canary islands. Microsatellite loci were screened in 225 individuals of both species from different islands of the Canarian archipelago. All markers were successfully amplified from both Myrica species, with an average number of 6.5 and 9.3 alleles per locus in M. rivas-martinezii and M. faya , respectively. There was no evidence for linkage disequilibrium between loci, and the probability of null alleles ranged from 0.01 to 0.17.
Fernández-Alvarez, A; Modry, D; Foronda, P
2016-05-01
The present study was conducted with the objective of identifying the species of Eimeria present in a cynegetic farm. A new coccidian (Apicomplexa: Eimeriidae) species is described from Barbary partridge, Alectoris barbara, from the Canary Islands. Experimental infections were carried out in order to determine the prepatent period, sporulation time, site of infection, and morphology of endogenous stages. One species is described as new. Eimeria barbarae n. sp. has ellipsoidal oocysts, 20.0 × 14.4 (16-23 × 13-16) μm, with a shape-index (SI) of 1.39. Sporocysts are almond-shaped, 9.0 × 5.4 (6.5-11 × 4.5-6) μm, SI = 1.56. The endogenous development takes place along the intestine. The present study showed that E. barbarae causes severe pathologies in A. barbara chickens, with impact on their health condition. Control strategies needs to be implemented to reduce the loss due to coccidiosis at studied farm.
Energy Technology Data Exchange (ETDEWEB)
Vepsaelaeinen, Ville [Finnish Museum of Natural History, P.O. Box 17, University of Helsinki, FI-00014 Helsinki (Finland)
2010-07-15
Here, I present the first comparison of the abundance of farmland birds in energy grass fields and in cereal-dominated conventionally cultivated fields (CCFs). I demonstrate that in boreal farmland, skylark (Alauda arvensis) densities were significantly lower in reed canary grass (RCG) (Phalaris arundinacea) fields than in CCFs. I found that during the early breeding season RCG fields and CCFs are equally good habitats, but over the ensuing couple of weeks RCG rapidly grows too tall and dense for field-nesting species. Consequently, RCG is an inferior habitat for skylark for laying replacement clutches (after failure of first nesting) or for a second clutch after one successful nesting. The results imply that if RCG cultivation is to be expanded, the establishment of large monocultures should be avoided in farmland landscapes; otherwise the novel habitat may affect detrimentally the seriously depleted skylark population, and probably also other field-nesting bird species with similar breeding habitats. (author)
Armas-Capote, Natalia; Pérez-Yépez, Juan; Martínez-Hidalgo, Pilar; Garzón-Machado, Víctor; Del Arco-Aguilar, Marcelino; Velázquez, Encarna; León-Barrios, Milagros
2014-03-01
Cicer canariense is a threatened perennial wild chickpea endemic to the Canary Islands. In this study, rhizobia that nodulate this species in its natural habitats on La Palma (Canary Islands) were characterised. The genetic diversity and phylogeny were estimated by RAPD profiles, 16S-RFLP analysis and sequencing of the rrs, recA, glnII and nodC genes. 16S-RFLP grouped the isolates within the Mesorhizobium genus and distinguished nine different ribotypes. Four branches included minority ribotypes (3-5 isolates), whereas another five contained the predominant ribotypes that clustered with reference strains of M. tianshanense/M. gobiense/M. metallidurans, M. caraganae, M. opportunistum, M. ciceri and M. tamadayense. The sequences confirmed the RFLP groupings but resolved additional internal divergence within the M. caraganae group and outlined several potential novel species. The RAPD profiles showed a high diversity at the infraspecific level, except in the M. ciceri group. The nodC phylogeny resolved three symbiotic lineages. A small group of isolates had sequences identical to those of symbiovar ciceri and were only detected in M. ciceri isolates. Another group of sequences represented a novel symbiotic lineage that was associated with two particular chromosomal backgrounds. However, nodC sequences closely related to symbiovar loti predominated in most isolates, and they were detected in several chromosomal backgrounds corresponding to up to nine Mesorhizobium lineages. The results indicated that C. canariense is a promiscuous legume that can be nodulated by several rhizobial species and symbiotypes, which means it will be important to determine the combination of core and symbiotic genes that produce the most effective symbiosis. Copyright © 2013 Elsevier GmbH. All rights reserved.
Motomura, Hiroyuki; Causse, Romain; Struthers, Carl D
2016-01-21
The Indo-Pacific scorpionfish, Scorpaenodes guamensis (Quoy & Gaimard 1824), is redescribed on the basis of 137 specimens, including types, from a wide geographic range in the Indo-Pacific. Seven nominal species, Scorpaena rubropunctata Cuvier in Cuvier & Valenciennes 1829, Sebastes minutus Cuvier in Cuvier & Valenciennes 1829, Scorpaena chilioprista Rüppell 1838, Scorpaena polylepis Bleeker 1851, Centropogon echinatus Macleay 1881, Scorpaena erinacea Garman 1903, and Scorpaenopsis quiescens Seale 1906, are regarded here as junior synonyms of S. guamensis. The type status of these nominal species is discussed, and lectotypes of Scorpaena guamensis, Scorpaena rubropunctata, Sebastes minutus, and Scorpaena polylepis are herein designated. Validity of Scorpaenopsis scaber (Ramsay & Ogilby 1886) is also discussed.
International Nuclear Information System (INIS)
Marti, J; Andujar, J; Costa, F; Wolff, J A; Carroll, M R
2008-01-01
We have performed phase equilibrium experiments to determine the pre-eruptive conditions of the largest phonolitic caldera-forming eruption (∼20 km3 of DRE) that occurred on Tenerife (Canary Islands). The Abrigo ignimbrite was erupted during the last caldera-forming episode (ca. 190 ka), from the Canadas caldera. Comparison of the natural and experimental phase proportions and compositions indicates that the phonolite at the roof of the Abrigo magma reservoir was at 130 ± 50 MPa (corresponding to ca. 4 - 5 km below the surface), 825 ± 25 oC, with 3 ± 1 wt% dissolved H2O and fO2 at the Ni-NiO buffer ? 1 log unit. This shows that the magma that produced the largest ignimbrite on Tenerife was stored at relatively shallow depths but was water-undersaturated, and its eruption was probably triggered by input of fresh mafic magma.
von Suchodoletz, H.; Oberhänsli, H.; Faust, D.; Zöller, L.; Hambach, U.; Fuchs, M.
2009-04-01
A Holocene increase of Saharan dust input to the area of the Canary islands is accompanied by a strong coarsening of this material during the Early Holocene as recorded in loess-like sediments deposited on Lanzarote. Whereas natural causes can be ruled out for the coarsening that is exceptional during the period of the last 180 ka, it is assumed that anthropogenic activity strongly mobilized dust in an area on the pathway of dust prior to its arrival in Lanzarote comprising parts of Western Sahara and northern Mauritania. Although scarce archaeological data from the coastal area of that region do not point to strong anthropogenic activity during the Early Holocene yet, a high density of unexplored archaeological remains reported from the coastal hinterlands does not exclude this hypothesis. Thus, the results of this study highlight the need of further archaeological investigations in that Saharan region.
Energy Technology Data Exchange (ETDEWEB)
Marti, J; Andujar, J; Costa, F [Institute of Earth Sciences ' Jaume Almera' , CSIC, C/ Lluis Sole I Sabaris, s/n Barcelona, 08028 Spain (Spain); Wolff, J A [School of Earth and Environmental Sciences, Washington State University, Pullman, WA 99164-2812 (United States); Carroll, M R [Dipartimento di Scienze della Terra, Via Gentile III da Varano, Universita di Camerino, 62032 MC (Italy)], E-mail: jawolff@mail.wsu.edu, E-mail: Michael.carroll@unicam.it
2008-10-01
We have performed phase equilibrium experiments to determine the pre-eruptive conditions of the largest phonolitic caldera-forming eruption ({approx}20 km3 of DRE) that occurred on Tenerife (Canary Islands). The Abrigo ignimbrite was erupted during the last caldera-forming episode (ca. 190 ka), from the Canadas caldera. Comparison of the natural and experimental phase proportions and compositions indicates that the phonolite at the roof of the Abrigo magma reservoir was at 130 {+-} 50 MPa (corresponding to ca. 4 - 5 km below the surface), 825 {+-} 25 oC, with 3 {+-} 1 wt% dissolved H2O and fO2 at the Ni-NiO buffer ? 1 log unit. This shows that the magma that produced the largest ignimbrite on Tenerife was stored at relatively shallow depths but was water-undersaturated, and its eruption was probably triggered by input of fresh mafic magma.
Directory of Open Access Journals (Sweden)
Agnieszka Zgrzywa
2013-01-01
Full Text Available The point of departure for this article is the memory of moving fragments of Janusz Korczak’s journal from Warsaw ghetto. The author confronts the fragments with Korczak’s earlier texts, such as the short storied about holiday camps for Polish and Jewish children, and the novel Król Maciuś na bezludnej wyspie [King Maciuś on a Desert Island]. The image of a canary bird, used in the novel, is confronted with other symbolic stories about this bird, such as the story in Wiesław Myśliwski’s Pałac [Palace]. With reference to the image, the article invokes Korczak’s meditations on identity and tolerance, and human ethical and aesthetic choices. The audacity of Korczak’s thoughts and conclusions goes far beyond his time, and seems perfectly fit for ours.
Energy Technology Data Exchange (ETDEWEB)
Burvall, J [Sveriges Lantbruksuniversitet, Enheten foer Biomassa, Biobraenslen och Fibergroedor, Umeaa (Sweden)
1992-03-01
In two different types of district heating combustion plants in Denmark, normally using straw as fuel, the energy grass Reed canary grass (summer harvested) has been tested as a new fuel. The combustion plant in Ringsted burns the fuel as whole bales with the so called `cigar method`. In Nykoebing the fuel is burned on a rust as unpacked bales using a straw divider to divide the bales. The heating effect of the combustion plants is 4.5 MW and 4.0 MW, respectively. For both plants, there was no handling or technical problem observed in the test with Reed canary grass compared to straw. The analysis of the emission to air shows high average values for CO- and NO{sub x} during the test period which is unacceptable according to Swedish limit values for emissions. For combustion plants with a heating effect over 10 MW, the limit values for NO{sub x} is 100-200 mg/MJ. For smaller plants there are no limits values today but in the future demands for limitation of NO{sub x} emission may come. For both plants, the O{sub 2}-content in fumes varied a lot, with a high mean value, about 10%. The content of chlorine in straw and energy grass can reach high levels. Most of the chlorine binds up in the ash (KCl), and therefore the emission of HCl are low. The emission to air of SO{sub x}, which is 100 mg/MJ, is below the limit value for smaller plants. The variation of moisture and the low density are the properties of grass and straw that mainly causes problems in the combustion and gives high emission levels. Today it seems to be necessary to press the material into fuel briquetts or fuel pellets to get a better combustion, that can meet environmental demands. (7 figs., 17 tabs.).
Energy Technology Data Exchange (ETDEWEB)
Burvall, J [Sveriges Lantbruksuniversitet, Enheten foer Biomassa, Biobraenslen och Fibergroedor, Umeaa (Sweden)
1992-03-01
In two different types of district heating combustion plants in Denmark, normally using straw as fuel, the energy grass Reed canary grass (summer harvested) has been tested as a new fuel. The combustion plant in Ringsted burns the fuel as whole bales with the so called 'cigar method'. In Nykoebing the fuel is burned on a rust as unpacked bales using a straw divider to divide the bales. The heating effect of the combustion plants is 4.5 MW and 4.0 MW, respectively. For both plants, there was no handling or technical problem observed in the test with Reed canary grass compared to straw. The analysis of the emission to air shows high average values for CO- and NO[sub x] during the test period which is unacceptable according to Swedish limit values for emissions. For combustion plants with a heating effect over 10 MW, the limit values for NO[sub x] is 100-200 mg/MJ. For smaller plants there are no limits values today but in the future demands for limitation of NO[sub x] emission may come. For both plants, the O[sub 2]-content in fumes varied a lot, with a high mean value, about 10%. The content of chlorine in straw and energy grass can reach high levels. Most of the chlorine binds up in the ash (KCl), and therefore the emission of HCl are low. The emission to air of SO[sub x], which is 100 mg/MJ, is below the limit value for smaller plants. The variation of moisture and the low density are the properties of grass and straw that mainly causes problems in the combustion and gives high emission levels. Today it seems to be necessary to press the material into fuel briquetts or fuel pellets to get a better combustion, that can meet environmental demands. (7 figs., 17 tabs.).
Directory of Open Access Journals (Sweden)
Juan E. Jiménez
2011-08-01
Full Text Available The main aim of this study is to provide an overview of monitoring progress within a Response to Intervention model (Tier-2, small group intervention used in the Canary Islands. This programme is conducted within the framework of a scientific cooperation agreement between the University of La Laguna research team “Dificultades de aprendizaje, psicolingüística y nuevas tecnologías” (“Problems in learning, psycholinguistics, and the new technologies”, the University of Oregon’s Center on Teaching and Learning, and the Consejería de Educación, Universidades y Sostenibilidad of the Canary Islands Government. The Indicadores Dinámicos del Éxito Lector is used for monitoring progress. The Indicadores Dinámicos del Éxito Lector is the Spanish version of Dynamic Indicators of Basic Early Literacy Skills. Its main purpose is to evaluate reading progress in students identified as “at risk” of developing reading difficulties using an Response to Intervention model.
Energy Technology Data Exchange (ETDEWEB)
Erhardsson, Thomas; Oehman, Marcus; Geyter, Sigrid de; Oehrstroem, Anna
2006-12-15
The market of forest products is expanding and thus resulting in more expensive biomass fuels. Therefore research within the combustion industry for alternative fuels is needed, for example cultivated fuels. Combustion and gasification research on these cultivated fuels are limited. The objectives of this work was to increase the general knowledge of silicon rich cultivated fuels by study the agglomeration characteristics for wheat straw, reed canary grass and industrial hemp in combination with commercial bed materials. Controlled fluidized bed agglomeration tests was conducted in a 5 kW, bench-scale, bubbling fluidized bed reactor. The tendencies of agglomeration were determined with the three cultivated fuels in combination with various minerals present in natural sand (quarts, plagioclase and potassium feldspar) and an alternative bed material (olivine). During the experiments bed samples and formed agglomerates were collected for further analyses with a scanning electron microscope (SEM) and with X-ray microanalysis (EDS). Wheat straw had the highest agglomeration tendency of the studied fuels followed by reed canary grass and industrial hemp. No significant layer formation was found around the different bed particles. Instead, the ash forming matter were found as individual ash sticky (partial melted) particles in the bed. The bed material mineralogical composition had no influence of the agglomeration process because of the non layer formation propensities of the used silicon rich fuels.
Total dietary intake of mercury in the Canary Islands, Spain.
Rubio, C; Gutiérrez, A; Burgos, A; Hardisson, A
2008-08-01
Estimating the risk associated with dietary intake of heavy metals by consumers is a vital and integral part of regulatory processes. The assessment of exposure to mercury shown in this paper has been performed by means of a study on the whole diet. Total mercury (Hg) levels were determined by cold vapour atomic absorption spectrometry (AAS) in 420 samples of regularly consumed food and drink. The total Hg concentrations measured in the different groups of food ranged from non-detectable to 119 microg kg(-1) w/w. The fish group had the highest concentrations of total Hg. All groups of food with regulated Hg content showed levels that were lower than the legally set values. The food consumption data used in the analysis were taken from the latest nutritional survey made in the Canary Islands, Spain. The estimated total Hg intake of local population (5.7 microg/person day(-1)) did not exceed the provisional tolerable weekly intake (PTWI) limit of 0.3 mg week(-1) of total mercury (43 microg/person day(-1)) fixed by the Joint Food and Agricultural Organization/World Health Organization (FAO/WHO) Expert Committee on Food Additives. Fishery products contributed 96% of the total Hg intake. The mean Hg intake for each island in this archipelago, formed by seven, has also been calculated. Fuerteventura, Lanzarote and El Hierro are the islands with the highest level of Hg intake (7.0, 7,0 and 6.1 microg/person day(-1), respectively). La Palma Island, due to its low fish consumption, had the lowest level of Hg intake (4.5 microg/person day(-1)), followed by La Gomera (5.4 microg/person day(-1)), Tenerife (5.5 microg/person day(-1)) and Gran Canaria (5.6 microg/person day(-1)). A comparison has been made of the results obtained in this study with those found for other national and international communities.
Energy Technology Data Exchange (ETDEWEB)
Hdez Armas, O.; Glez Martin, A.; Bethencourt Pana, A.; Catalan Acosta, A.; Hdez Armas, J.
2011-07-01
This paper provides data for the number and diversity of computerized tomography scans performed on pediatric patients (<15 years) at the University Hospital of Tenerife (UHT), Canary Islands. The analysis of the frequency and trends of these medical procedures will make comparisons with the medical use of CT in other parts of Spain and the world.
Energy Technology Data Exchange (ETDEWEB)
Criado, C.; Romero, C.; Solar, V.
2009-07-01
The eruption of Timanfaya (1730-1736) has been the most important volcanic activity on Canary Islands during historical times (after XV Century). The lave flows and piroclastic layers buried at least 1/4 of Lanzarote surface. Overall the island we can see artificial cross-sections showing ash layers, overlapping paleargids soils or interbedded between alluvial sediment on the bottom of in filled valleys. Sedimentological analysis has been applied on four cross-section located along the island. These data, together with historical information and pottery remains, allow conclude a very recent age for many of this layers, produced by a strong erosion input started by the overgrazing produced by the concentration of livestock during the volcanic crisis. (Author) 6 refs.
Directory of Open Access Journals (Sweden)
Vicente Jara Vera
2017-07-01
Full Text Available The wooden carving of Our Lady of Candelaria, discovered in the municipality of the same name on the island of Tenerife (Canary Islands during the first half of the fifteenth century, had nearly two hundred letters of the Latin alphabet inscribed on her garments. Unfortunately the original carving disappeared after the storm that took place in 1826. Once the original letters on the first image were discovered by means of analysing both textual and artistic documentation and sources, we conclude that the text is archaic-Berber language used by the islanders, Insular-Amazigh, which no longer exists in the present day. Having discussed lexical, morphological, syntactic and phonetic aspects of this archaic language, as well as conducted a semantic analysis of the carving both from the native aboriginal perspective and the Christian one, we expound here our proposal of the meaning of the letters engraved on the Marian carving of Candelaria from its lexical voices and roots of their Berber and Insular-Amazigh languages, with the previous proposed solutions.
Directory of Open Access Journals (Sweden)
C. Marrero
2009-04-01
Full Text Available In November 2005 an extratropical storm named Delta affected the Canary Islands (Spain. The high sustained wind and intense gusts experienced caused significant damage. A numerical sensitivity study of Delta was conducted using the Weather Research & Forecasting Model (WRF-ARW. A total of 27 simulations were performed. Non-hydrostatic and hydrostatic experiments were designed taking into account physical parameterizations and geometrical factors (size and position of the outer domain, definition or not of nested grids, horizontal resolution and number of vertical levels. The Factor Separation Method was applied in order to identify the major model sensitivity parameters under this unusual meteorological situation. Results associated to percentage changes relatives to a control run simulation demonstrated that boundary layer and surface layer schemes, horizontal resolutions, hydrostaticity option and nesting grid activation were the model configuration parameters with the greatest impact on the 48 h maximum 10 m horizontal wind speed solution.
Peña-Méndez, E M; Astorga-España, M S; García-Montelongo, F J
2001-01-01
Chemical fingerprinting approach to environmental assessment is illustrated in the evaluation of marine oil pollution in the coasts using two limpet species as bioindicator organisms, and based on profiles and concentrations of n-alkanes and aromatic hydrocarbons in their tissues. Accidental and chronic releases of hydrocarbons can contaminate the marine environment of the Canary Islands not only because of their geographical situation but also because of the very dense tanker traffic around. This situation affects coastal areas, fishing activities, tourism resort, etc. Concentrations of n-alkanes and aromatic hydrocarbons (polycyclic aromatic hydrocarbons and methyl-polycyclic aromatic hydrocarbons) in the soft tissues of the marine intertidal and subtidal limpets, Patella crenata and Patella ullysiponensis aspera, were evaluated. Limpet samples were collected at monthly intervals, at three locations on the southeast coast of Tenerife over a 3-year period (1991-93). Levels of hydrocarbons found in limpets are similar to concentrations found in unpolluted areas around the world. From application of principal component analysis, the interpretation of variable loading plots gives information on variable correlation and can be used to distinguish among potential sources of pollution and the ability of studied molluscs to be used as bioindicator organisms.
International Nuclear Information System (INIS)
Pena-Mendez, E.Ma.; Garcia-Montelongo, F.J.; Astorga-Espana, Ma.S.
2001-01-01
Chemical fingerprinting approach to environmental assessment is illustrated in the evaluation of marine oil pollution in the coasts using two limpet species as bioindicator organisms, and based on profiles and concentrations of n-alkanes and aromatic hydrocarbons in their tissues. Accidental and chronic releases of hydrocarbons can contaminate the marine environment of the Canary Islands not only because of their geographical situation but also because of the very dense tank traffic around. This situation affects coastal areas, fishing activities, tourism resort, etc. Concentrations of n-alkanes and aromatic hydrocarbons (polycyclic aromatic hydrocarbons and methyl-polycyclic aromatic hydrocarbons) in the soft tissues of the marine intertidal and subtidal limpets, Patella crenata and Patella ullysiponensis aspera, were evaluated. Limpet samples were collected at monthly intervals, at three locations on the southeast coast of Tenerife over a 3-year period (1991-93). Levels of hydrocarbons found in limpets are similar to concentrations found in unpolluted areas around the world. From application of principal component analysis, the interpretation of variable loading plots gives information on variable correlation and can be used to distinguish among potential sources of pollution and the ability of studied molluscs to be used as bioindicator organisms. (Author)
DEFF Research Database (Denmark)
Karki, Sandhya; Elsgaard, Lars; Kandel, Tanka Prasad
2015-01-01
Empirical greenhouse gas (GHG) flux estimates from diverse peatlands are required in order to derive emission factors for managed peatlands. This study on a drained fen peatland quantified the annual GHG balance (Carbon dioxide (CO2), nitrous oxide (N2O), methane (CH4), and C exported in crop yield......) from spring barley (SB) and reed canary grass (RCG) using static opaque chambers for GHG flux measurements and biomass yield for indirectly estimating gross primary production (GPP). Estimates of ecosystem respiration (ER) and GPP were compared with more advanced but costly and labor-intensive dynamic...... by static chamber and dynamic chamber methods was similar, particularly when using nonlinear regression techniques for flux calculations. A comparison of GPP derived from aboveground biomass and from measuring net ecosystem exchange (NEE) showed that GPP estimation from biomass might be useful, or serve...
Díaz-Zabala, Héctor J; Nieves-Colón, María A; Martínez-Cruzado, Juan C
2017-04-01
Maternal lineages of West Eurasian and North African origin account for 11.5% of total mitochondrial ancestry in Puerto Rico. Historical sources suggest that this ancestry arrived mostly from European migrations that took place during the four centuries of the Spanish colonization of Puerto Rico. This study analyzed 101 mitochondrial control region sequences and diagnostic coding region variants from a sample set randomly and systematically selected using a census-based sampling frame to be representative of the Puerto Rican population, with the goal of defining West Eurasian-North African maternal clades and estimating their possible geographical origin. Median-joining haplotype networks were constructed using hypervariable regions 1 and 2 sequences from various reference populations in search of shared haplotypes. A posterior probability analysis was performed to estimate the percentage of possible origins across wide geographic regions for the entire sample set and for the most common haplogroups on the island. Principal component analyses were conducted to place the Puerto Rican mtDNA set within the variation present among all reference populations. Our study shows that up to 38% of West Eurasian and North African mitochondrial ancestry in Puerto Rico most likely migrated from the Canary Islands. However, most of those haplotypes had previously migrated to the Canary Islands from elsewhere, and there are substantial contributions from various populations across the circum-Mediterranean region and from West African populations related to the modern Wolof and Serer peoples from Senegal and the nomad Fulani who extend up to Cameroon. In conclusion, the West Eurasian mitochondrial ancestry in Puerto Ricans is geographically diverse. However, haplotype diversity seems to be low, and frequencies have been shaped by population bottlenecks, migration waves, and random genetic drift. Consequently, approximately 47% of mtDNAs of West Eurasian and North African ancestry
Dynamics of diffuse carbon dioxide emissions from Cumbre Vieja volcano, La Palma, Canary Islands
Padrón, Eleazar; Pérez, Nemesio M.; Rodríguez, Fátima; Melián, Gladys; Hernández, Pedro A.; Sumino, Hirochika; Padilla, Germán; Barrancos, José; Dionis, Samara; Notsu, Kenji; Calvo, David
2015-04-01
We report herein the results of 13 soil CO2 efflux surveys at Cumbre Vieja volcano, La Palma Island, the most active basaltic volcano in the Canary Islands. The CO2 efflux measurements were undertaken using the accumulation chamber method between 2001 and 2013 to constrain the total CO2 output from the studied area and to evaluate occasional CO2 efflux surveys as a volcanic surveillance tool for Cumbre Vieja. Soil CO2 efflux values ranged from non-detectable up to 2442 g m-2 days-1, with the highest values observed in the south, where the last volcanic eruption took place (Teneguía, 1971). Isotopic analyses of soil gas carbon dioxide suggest an organic origin as the main contribution to the CO2 efflux, with a very small magmatic gas component observed at the southern part of the volcano. Total biogenic and magmatic combined CO2 emission rates showed a high temporal variability, ranging between 320 and 1544 t days-1 and averaging 1147 t days-1 over the 220-km2 region. Two significant increases in the CO2 emission observed in 2011 and 2013 were likely caused by an enhanced magmatic endogenous contribution revealed by significant changes in the 3He/4He ratio in a CO2-rich cold spring. The relatively stable emission rate presented in this work defines the background CO2 emission range for Cumbre Vieja during a volcanic quiescence period.
Palaeomagnetic constraints on the age of Lomo Negro volcanic eruption (El Hierro, Canary Islands)
Villasante-Marcos, Víctor; Pavón-Carrasco, Francisco Javier
2014-12-01
A palaeomagnetic study has been carried out in 29 cores drilled at six different sites from the volcanic products of Lomo Negro eruption (El Hierro, Canary Islands, Spain). Systematic thermal and alternating field demagnetization of the samples' natural remanent magnetization revealed a northward, stable palaeomagnetic direction similar in all the samples. Rock magnetic experiments indicate that this palaeomagnetic component is carried by a mixture of high-Ti and low-Ti titanomagnetite crystals typical of basaltic lithologies that have experienced a significant degree of oxyexsolution during subaerial cooling. The well constrained palaeomagnetic direction of Lomo Negro lavas was used to perform a palaeomagnetic dating of the volcanic event, using the SHA.DIF.14k global geomagnetic model restricted for the last 3000 yr. It can be unambiguously concluded that Lomo Negro eruption occurred well before the previously proposed date of 1793 AD, with three different age ranges being statistically possible during the last 3 ka: 115 BC-7 AD, 410-626 AD and 1499-1602 AD. The calibration of a previously published non-calibrated 14C dating suggests a XVI c. date for Lomo Negro eruption. This conclusion leaves open the possibility that the seismic crisis occurred at El Hierro in 1793 AD was related to an intrusive magmatic event that either did not reach the surface or either culminated in an unregistered submarine eruption similar to the one occurred in 2011-2012 at the southern off-shore ridge of the island.
Laurel forest recovery during 20 years in an abandoned firebreak in Tenerife, Canary Islands
Ramón Arévalo, José; Dolores Peraza, María; Álvarez, Carlos; Bermúdez, Alfredo; Domingo Delgado, Juan; Gallardo, Antonio; María Fernández-Palacios, José
2008-01-01
This study assessed the recovery of the structure and species composition of a laurel forest in an abandoned firebreak in the Rural Park of Anaga, Tenerife (Canary Islands). We statistically compared values of species richness, density and biovolume between 23 plots in the firebreak and six control plots in natural forest near the firebreak. We evaluated changes in species composition with detrended correspondence analysis (DCA) based on densities and biovolume. Biovolume is increasing significantly along the successional gradient (from 1990 to 2004) but remains less than the values in control plots. Stem densities were significantly lower in control plots than in 2004 plots. Species richness was significantly higher in control plots than in 2004 plots (although there were no differences in values obtained between the first sampling period 6 years after abandonment, and the second sampling 20 years after abandonment). Changes in species richness are significant, but all species present in control plots are also found in the firebreak plots. DCA based on biovolume significantly discriminated control plots from firebreak plots in 1990 (for axis I). Results suggest recovery to a laurel forest is occurring, although more time will be required to reach control plot density and biovolume values. The low intensity of disturbance and a well-conserved forest adjacent to the firebreak favour the recovery of species inside the firebreak. We advise eliminating suckers from all small trees (leaving the bigger stems) to accelerate succession to a vegetation structure similar to that found surrounding the firebreak.
Pedrazzi, D.; Marti, J.; Geyer, A.
2012-04-01
The El Golfo tuff cone is an example of phreatomagmatic edifice, developed in the western coast of Lanzarote (Canary Islands). El Golfo, together with other edifices of the same age, is aligned along a fracture oriented NEE-SWW coinciding with the main lineation of the historic volcanism in this part of the island. In this contribution we present a detailed stratigraphic study of the succession of deposits and we interpret them in terms of depositional processes and eruptive dynamics. The eruptive sequence is exclusively represented by a succession of pyroclastic deposits, and we infer it according to variations in flow regime and the magma-water interaction. Several pyroclastic units were identified according to facies variations based on sedimentary discontinuities, grain size, components, variations in primary laminations and bedforms following the facies model proposed by Chough and Sohn (1990). The growth of the El Golfo tuff cone involved several stages based on variations in depositional processes. The edifice was constructed very rapidly around the vent controlling the amount of water that got access to the eruption conduit. Although the invariable phreatomagmatic character of most of the pyroclastic sequence, it is possible to deduce variations in the explosive energy, with a general increment upwards, according to the increase in the degree of fragmentation of pyroclasts, The absence of hyaloclastites, the nature of the palagonite alteration and the observed sedimentary structures, demonstrate the subaereal character of most of the deposits
Directory of Open Access Journals (Sweden)
José Valdazo
2017-12-01
Full Text Available Brown macroalgae within the genus Cystoseira are some of the most relevant “ecosystem-engineers” found throughout the Mediterranean and the adjacent Atlantic coasts. Cystoseira-dominated assemblages are sensitive to anthropogenic pressures, and historical declines have been reported from some regions. In particular, Cystoseira abies-marina, thriving on shallow rocky shores, is a key species for the ecosystems of the Canary Islands. In this work, we analyse changes in the distribution and extension of C. abies-marina in the last decades on the island of Gran Canaria. This alga dominated the shallow rocky shores of the entire island in the 1980s; a continuous belt extended along 120.5 km of the coastline and occupied 928 ha. In the first decade of the 21st century, fragmented populations were found along 52.2 km of the coastline and occupied 12.6 ha. Today, this species is found along 37.8 km of the coastline and occupies only 7.4 ha, mainly as scattered patches. This regression has been drastic around the whole island, even in areas with low anthropogenic pressure; the magnitude of the decline over time and the intensity of local human impacts have not shown a significant correlation. This study highlights a real need to implement conservation and restoration policies for C. abies-marina in this region.
Energy Technology Data Exchange (ETDEWEB)
Morales, J. [Departamento de Quimica Fisica, Universidad de La Laguna, 38071 La Laguna, Tenerife (Spain)]. E-mail: jmorales@ull.es; Diaz, F. [Departamento de Quimica Fisica, Universidad de La Laguna, 38071 La Laguna, Tenerife (Spain); Hernandez-Borges, J. [Departamento de Quimica Analitica, Nutricion y Bromatologia, Universidad de La Laguna, 38071 La Laguna, Tenerife (Spain); Gonzalez, S. [Departamento de Quimica Fisica, Universidad de La Laguna, 38071 La Laguna, Tenerife (Spain)
2006-02-15
In the present paper, zinc sheets have been exposed for 4 years to the action of different atmospheres in 35 test sites located in the province of Santa Cruz de Tenerife, Canary Islands, Spain. Corrosion products formed on the surface of the samples have been identified by means of X-ray diffraction (XRD) for the first and second year of exposure. Zincite, hydrozincite, simonkolleite, zinc chlorohydroxysulphate, zinc oxysulphate and zinc hydroxysulphate have been identified in the test sheets. Preliminary results of an electrochemical study of the breakdown potential of zinc samples are also presented in order to test the protective effect of the film formed on the surface of the samples. It was found that the protective effect of this film increases linearly with exposure time.
Directory of Open Access Journals (Sweden)
Yen E. Lam González
2015-06-01
Full Text Available Nautical tourism is considered to be an under-exploited research area, taking into account its evolution and growth prospects. The present study was conducted with nautical tourists during their visit to the Canary Islands and Morocco between 2013 and 2014. Our aim is to better guide the creation of new joint businesses by determining the most demanded activities among the nautical tourists that visit this part of the world. Some findings indicate that tourists’ consumption and satisfaction vary between a nautical tourist that sails and a tourist motivated by other nautical activities, regardless of the destination they choose. The study also differentiates the nautical tourists’ preferences according to the most popular activities carried out at the destinations they are visiting, highlighting the role that resources such as “sea” and “nature” play as the main tourists’ motivations behind the trip. Finally, the results also reveal which elements of the nautical tourism products and services in offer are the current destinations’ weaknesses, according to the nautical tourists.
Marine and Anadromous Fish :: NOAA Fisheries
Conservation Commission bocaccio Bocaccio (Sebastes paucispinis) Photo: NOAA sand tiger shark Sand Tiger Shark Updated: June 29, 2017 Fisheries Service Home Information Quality Exit Disclaimer Linking Policy Privacy
The effects of agriculture on the volcanic aquifers of the canary islands
Custodio, E.; Guerra, J. A.; Jiménez, J.; Medina, J. A.; Soler, C.
1983-12-01
Agriculture is a basic economic activity in the Canary Islands, a Spanish region in the Atlantic Ocean, facing the Sahara. The main crops are bananas, tomatoes, and other special ones suitable for exportation. Fertilizers are applied in high quantities on the scarce land available. The relatively good vertical permeability of the soils favors the deep infiltration of irrigation return flows. Water is obtained by an extraordinary net of shaft wells and water galleries, supplemented when possible by surface reservoirs in the deep gullies. Water is distributed by an extensive network of pipes and canals, allowing the transportation of water to virtually any point from any water source. Water quality is widely variable, from almost rain water to brackish, with a high frequency of sodium bicarbonate types. Return flows, especially when water is applied with good irrigation techniques and the original quality is poor, are saline and contain chemicals leached from the fertilizers. On Tenerife Island, most of the return flows go to coastal aquifers, while most of the water comes from high-altitude water galleries. Agricultural pollution is not generally appraised, but it exists. It can be masked by the frequent, high natural nitrate content in groundwater. On Gran Canaria Island, since water comes mainly from deep shaft wells near the irrigated areas, the nitrate pollution is much more clear. On La Palma Island, besides the nitrate pollution, a potassium pollution of agricultural origin has been mentioned. Other situations on the remaining islands are also discussed. It can be concluded that agriculture is a big concern for the water quality in many areas and impairs its suitability for other uses. Because of the great depth of the water table, the nitrate pollution may not become obvious for many years, especially for the deep-water galleries.
Zapatero, C; Castaño, C; Zapatero, L M
1999-03-01
Pharyngodonid nematodes (Oxyuroidea) belonging to the genus Alaeuris Thapar, 1925, were collected from the posterior gut of Gallotia stehlini (Lacertidae) from Grand Canary Island. Two species Alaeuris stehlini n. sp. and Alaeuris numidica canariensis n. ssp. were identified. The new species is described in which the long thin males are characterized by narrow caudal alae, a rounded first pair of adanal papillae non pedunculate, the second pair attached and elongate, the three pair teated; a short narrow V plate and a relatively long caudal appendage. The females are also long and thin with a slightly salient vulva, a conical pointed caudal appendage, oesophageal length approximately one third of body, excretory pore below the oesophageal bulb. The new subspecies most closely resembles Alaeuris numidica numidica. (Seurat, 1918) Petter, 1966 and Alaeuris numidica madagascariensis Petter, 1966.
Fuentes, Ernesto Gabriel; Hernández-Suárez, Estrella; Simón, Oihane; Williams, Trevor; Caballero, Primitivo
2017-01-01
Chrysodeixis chalcites, an important pest of banana crops on the Canary Islands, is usually controlled by chemical insecticides. The present study aimed to evaluate the efficacy of the most prevalent isolate of the Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV, Baculoviridae) as a biological insecticide. Overall the prevalence of ChchNPV infection in C. chalcites populations was 2.3% (103 infected larvae out of 4,438 sampled), but varied from 0-4.8% on Tenerife and was usually low (0-2%) on the other islands. On Tenerife, infected larvae were present at 11 out of 17 plantations sampled. The prevalence of infection in larvae on bananas grown under greenhouse structures was significantly higher (3%) than in open-field sites (1.4%). The ChchNPV-TF1 isolate was the most abundant and widespread of four genetic variants of the virus. Application of 1.0x109 viral occlusion bodies (OBs)/l of ChchNPV-TF1 significantly reduced C. chalcites foliar damage in young banana plants as did commonly used pesticides, both in greenhouse and open-field sites. The insecticidal efficacy of ChchNPV-TF1 was similar to that of indoxacarb and a Bacillus thuringiensis (Bt)-based insecticide in one year of trials and similar to Bt in the following year of trails in greenhouse and field crops. However, larvae collected at different time intervals following virus treatments and reared in the laboratory experienced 2-7 fold more mortality than insects from conventional insecticide treatments. This suggests that the acquisition of lethal dose occurred over an extended period (up to 7 days) compared to a brief peak in larvae on plants treated with conventional insecticides. These results should prove useful for the registration of a ChchNPV-based insecticide for integrated management of this pest in banana crops on the Canary Islands.
Directory of Open Access Journals (Sweden)
Ernesto Gabriel Fuentes
Full Text Available Chrysodeixis chalcites, an important pest of banana crops on the Canary Islands, is usually controlled by chemical insecticides. The present study aimed to evaluate the efficacy of the most prevalent isolate of the Chrysodeixis chalcites nucleopolyhedrovirus (ChchNPV, Baculoviridae as a biological insecticide. Overall the prevalence of ChchNPV infection in C. chalcites populations was 2.3% (103 infected larvae out of 4,438 sampled, but varied from 0-4.8% on Tenerife and was usually low (0-2% on the other islands. On Tenerife, infected larvae were present at 11 out of 17 plantations sampled. The prevalence of infection in larvae on bananas grown under greenhouse structures was significantly higher (3% than in open-field sites (1.4%. The ChchNPV-TF1 isolate was the most abundant and widespread of four genetic variants of the virus. Application of 1.0x109 viral occlusion bodies (OBs/l of ChchNPV-TF1 significantly reduced C. chalcites foliar damage in young banana plants as did commonly used pesticides, both in greenhouse and open-field sites. The insecticidal efficacy of ChchNPV-TF1 was similar to that of indoxacarb and a Bacillus thuringiensis (Bt-based insecticide in one year of trials and similar to Bt in the following year of trails in greenhouse and field crops. However, larvae collected at different time intervals following virus treatments and reared in the laboratory experienced 2-7 fold more mortality than insects from conventional insecticide treatments. This suggests that the acquisition of lethal dose occurred over an extended period (up to 7 days compared to a brief peak in larvae on plants treated with conventional insecticides. These results should prove useful for the registration of a ChchNPV-based insecticide for integrated management of this pest in banana crops on the Canary Islands.
García-Hernández, Rubén; Melián, Gladys; D'Auria, Luca; Asensio-Ramos, María; Alonso, Mar; Padilla, Germán D.; Rodríguez, Fátima; Padrón, Eleazar; Barrancos, José; García-Merino, Marta; Amonte, Cecilia; Pérez, Aarón; Calvo, David; Hernández, Pedro A.; Pérez, Nemesio M.
2017-04-01
Tenerife (2034 km2) is the largest of the Canary Islands and hosts four main active volcanic edifices: three volcanic rifts and a central volcanic complex, Las Cañadas, which is characterized by the eruption of differentiated magmas. Laying inside Las Cañadas a twin stratovolcanoes system, Pico Viejo and Teide, has been developed. Although there are no visible gas emanations along the volcanic rifts of Tenerife, the existence of a volcanic-hydrothermal system beneath Teide volcano is suggested by the occurrence of a weak fumarolic system, steamy ground and high rates of diffuse CO2 degassing all around the summit cone of Teide. Soil CO2 efflux surveys have been performed at the summit crater of Teide volcano since 1999, to determine the diffuse CO2 emission from the summit crater and to evaluate the temporal variations of CO2 efflux and their relationships with seismic-volcanic activity. Soil CO2 efflux and soil temperature have been always measured at the same 38 observation sites homogeneously distributed within an area of about 6,972 m2 inside the summit crater. Soil CO2 diffuse effluxes were estimated according to the accumulation chamber method by means of a non-dispersive infrared (NDIR) LICOR-820 CO2 analyzer. Historical seismic activity in Tenerife has been characterized by low- to moderate-magnitude events (M de Canarias (INVOLCAN) registered an earthquake of M 2.5 located in the vertical of Teide volcano with a depth of 6.6 km. It was the strongest earthquake located inside Cañadas caldera since 2004. Between October 11 and December 13, 2016, a continuous increase on the diffuse CO2 emission was registered, from 21.3 ± 2.0 to 101.7 ± 20.7 t d-1, suggesting the occurrence of future increase in the seismic-volcanic activity. In fact, this precursory signal preceded the occurrence of the 2.5 seismic event and no significant horizontal and vertical displacements were registered by the Canary GPS network belonged to INVOLCAN. This seismic event was
Palomino, Desirée; Vázquez, Juan-Tomás; Somoza, Luis; León, Ricardo; López-González, Nieves; Medialdea, Teresa; Fernández-Salas, Luis-Miguel; González, Francisco-Javier; Rengel, Juan Antonio
2016-02-01
The margin of the continental slope of the Volcanic Province of Canary Islands is characterised by seamounts, submarine hills and large landslides. The seabed morphology including detailed morphology of the seamounts and hills was analysed using multibeam bathymetry and backscatter data, and very high resolution seismic profiles. Some of the elevation data are reported here for the first time. The shape and distribution of characteristics features such as volcanic cones, ridges, slides scars, gullies and channels indicate evolutionary differences. Special attention was paid to recent geological processes that influenced the seamounts. We defined various morpho-sedimentary units, which are mainly due to massive slope instability that disrupt the pelagic sedimentary cover. We also studied other processes such as the role of deep bottom currents in determining sediment distribution. The sediments are interpreted as the result of a complex mixture of material derived from a) slope failures on seamounts and submarine hills; and b) slides and slumps on the continental slope.
Baztan, Juan; Carrasco, Ana; Chouinard, Omer; Cleaud, Muriel; Gabaldon, Jesús E; Huck, Thierry; Jaffrès, Lionel; Jorgensen, Bethany; Miguelez, Aquilino; Paillard, Christine; Vanderlinden, Jean-Paul
2014-03-15
Coastal zones and the biosphere as a whole show signs of cumulative degradation due to the use and disposal of plastics. To better understand the manifestation of plastic pollution in the Atlantic Ocean, we partnered with local communities to determine the concentrations of micro-plastics in 125 beaches on three islands in the Canary Current: Lanzarote, La Graciosa, and Fuerteventura. We found that, in spite of being located in highly-protected natural areas, all beaches in our study area are exceedingly vulnerable to micro-plastic pollution, with pollution levels reaching concentrations greater than 100 g of plastic in 1l of sediment. This paper contributes to ongoing efforts to develop solutions to plastic pollution by addressing the questions: (i) Where does this pollution come from?; (ii) How much plastic pollution is in the world's oceans and coastal zones?; (iii) What are the consequences for the biosphere?; and (iv) What are possible solutions? Copyright © 2014 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Perez-Torrado, F J; Carracedo, J C; Rodriguez-Gonzalez, A; Soler, V; Troll, V R; Wiesmaier, S
2012-11-01
The first signs of renewed volcanic activity at El Hierro began in July 2011 with the occurrence of abundant, low-magnitude earthquakes. The increasing seismicity culminated on October 10, 2011, with the onset of a submarine eruption about 2 km offshore from La Restinga, the southernmost village on El Hierro. The analysis of seismic and deformation records prior to, and throughout, the eruption allowed the reconstruction of its main phases: 1) ascent of magma and migration of hypo centres from beneath the northern coast (El Golfo) towards the south rift zone, close to La Restinga, probably marking the hydraulic fracturing and the opening of the eruptive conduit; and 2) onset and development of a volcanic eruption indicated by sustained and prolonged harmonic tremor whose intensity varied with time. The features monitored during the eruption include location, depth and morphological evolution of the eruptive source and emission of floating volcanic bombs. These bombs initially showed white, vesiculated cores (originated by partial melting of underlying pre-volcanic sediments upon which the island of El Hierro was constructed) and black basanite rims, and later exclusively hollow basanitic lava balloons. The eruptive products have been matched with a fissural submarine eruption without ever having attained surtseyan explosiveness. The eruption has been active for about five months and ended in March 2012, thus becoming the second longest reported historical eruption in the Canary Islands after the Timanfaya eruption in Lanzarote (1730-1736). This eruption provided the first opportunity in 40 years to manage a volcanic crisis in the Canary Islands and to assess the interpretations and decisions taken, thereby gaining experience for improved management of future volcanic activity. Seismicity and deformation during the eruption were recorded and analysed by the Instituto Geografico Nacional (IGN). Unfortunately, a lack of systematic sampling of erupted pyroclasts and
Burns, F.; Cole, M.; Vaccaro, W.; Alonso Cótchico, M.; Melián, G.; Asensio-Ramos, M.; Padron, E.; Hernandez Perez, P. A.; Perez, N. M.
2017-12-01
Volcanic activity at La Palma (Canary Islands) in the last 123 ka has taken place exclusively at the southern part of the island, where Cumbre Vieja volcano, which is characterized by a main north-south rift zone 20 km long and up to 1950 m in elevation and covering an area of 220 km2 with vents located also at the northwest and northeast. Cumbre Vieja is the most active basaltic volcano in the Canaries with 7 historical eruptions being San Juan (1949) and Teneguía (1971) the most recent ones. Since no visible degassing (fumaroles, etc.) at Cumbre Vieja occurs, our geochemical program for the volcanic surveillance of Cumbre Vieja is mainly focused on diffuse degassing monitoring. Diffuse CO2 emission surveys are yearly performed in summer to minimize the influence of meteorological variations. About 570 sampling sites were selected for each survey to obtain a homogeneous distribution after taking into consideration the local geology, structure, and accessibility. Measurements of soil CO2 efflux were performed in situ by means of a portable non-dispersive infrared sensor following the accumulation chamber method. The soil CO2 efflux values of the 2017 survey ranged from non-detectable to 47.7 g m-2 d-1. Statistical-graphical analysis of the data show two different geocheleemical populations; background (B) and peak (P) represented by 98.2% and 1.8% of the total data, respectively. The geometric means of the B and P populations are 2.9 and 36.5 g m-2 d-1, respectively. Most of the area showed B values while the P values were mainly observed both flanks of the main N-S volcanic rift. To estimate the diffuse CO2 emission in metric tons per day released from Cumbre Vieja (220 km2) for the 2017 survey, we ran about 100 sGs simulations. The estimated 2017 diffuse CO2 output released to atmosphere by Cumbre Vieja was at 801 ± 27 t d-1, value relatively higher than the background average of CO2 emission estimated on 374 t d-1 and within the background range of 132 t d-1
García, A.; Fernández-Ros, A.; Berrocoso, M.; Marrero, J. M.; Prates, G.; De la Cruz-Reyna, S.; Ortiz, R.
2014-04-01
Significant deformations, followed by increased seismicity detected since 2011 July at El Hierro, Canary Islands, Spain, prompted the deployment of additional monitoring equipment. The climax of this unrest was a submarine eruption first detected on 2011 October 10, and located at about 2 km SW of La Restinga, southernmost village of El Hierro Island. The eruption ceased on 2012 March 5, after the volcanic tremor signals persistently weakened through 2012 February. However, the seismic activity did not end with the eruption, as several other seismic crises followed. The seismic episodes presented a characteristic pattern: over a few days the number and magnitude of seismic event increased persistently, culminating in seismic events severe enough to be felt all over the island. Those crises occurred in 2011 November, 2012 June and September, 2012 December to 2013 January and in 2013 March-April. In all cases the seismic unrest was preceded by significant deformations measured on the island's surface that continued during the whole episode. Analysis of the available GPS and seismic data suggests that several magma displacement processes occurred at depth from the beginning of the unrest. The first main magma movement or `injection' culminated with the 2011 October submarine eruption. A model combining the geometry of the magma injection process and the variations in seismic energy release has allowed successful forecasting of the new-vent opening.
Mentaberre, Gregorio; Gutiérrez, Carlos; Rodríguez, Noé F; Joseph, Sunitha; González-Barrio, David; Cabezón, Oscar; de la Fuente, José; Gortazar, Christian; Boadella, Mariana
2013-12-27
The Canary Islands contain the most important dromedary camel (Camelus dromedarius) population in the European Union and are the main export point of dromedaries to continental Europe and Latin America. We investigated the presence of antibodies against relevant disease agents in 100 Canarian camel sera. Selected blood samples of the same animals were also tested by PCR. Sera were tested for antibodies against Bluetongue virus (BTV; 0%), Bovine Viral Diarrhoea virus (BVDV; 0%), Camelpox virus (CPV; 8% by serum neutralization, 16% by ELISA), Peste des Petits Ruminants virus (PPRV, 0%), Rift Valley Fever virus (RVFV; 0%) and West Nile Fever virus (WNV; 3%), the bacterial pathogens Anaplasma sp. (3%), Brucella sp. (1%), Coxiella burnetii (19%), Mycobacterium avium paratuberculosis (MAP; 22%), Mycobacterium tuberculosis complex (MTC; 10%) and Rickettsia sp. (83%), and the parasites Toxoplasma gondii (36%) and Neospora caninum (86%). The most remarkable findings were the detection of antibodies against CPV and the high antibody prevalence against C. burnetii, Rickettsia sp., T. gondii and N. caninum. By PCR, we found no C. burnetii, N. caninum and Anaplasma sp. DNA in the tested samples. However, Rickettsia sp. DNA was detected in six antibody positive tested samples. These results should be taken into consideration in order to implement adequate control measures and avoid a potential dissemination of infections to other territories. Copyright © 2013 Elsevier B.V. All rights reserved.
Diversity, rarity and the evolution and conservation of the Canary Islands endemic flora
Directory of Open Access Journals (Sweden)
Reyes-Betancort, J. Alfredo
2008-06-01
Full Text Available The endemic vascular flora of the Canary Islands comprises over 680, taxa collectively accounting for more than 50% of the total native flora. To investigate geographical patterns of diversity within the endemic flora, distribution data from published sources together with other field observation and herbarium data were used to compile a data matrix comprising the distributions of ca. 90% of endemic taxa scored on a 10 × 10km UTM grid. WORLDMAP was then used to investigate patterns of endemic diversity, range size rarity (a measure of endemicity, phylogenetic diversity and threatened taxon richness. Endemic taxon richness was found to be highly heterogeneous across the archipelago, with cells containing between one and 139 taxa each (0.05-22.82% of endemic diversity. Patterns of variation in range size rarity and phylogenetic diversity were found to be largely congruent with endemic diversity, although some cells exhibited markedly higher range size rarity scores than would be predicted by their endemic diversity scores. In contrast, the pattern of endangered taxon richness across the archipelago differed markedly from endemic taxon richness. Many cells in Lanzarote, Fuerteventura and Gran Canaria exhibit higher endangered taxon richness scores than would be predicted from their endemic richness scores whereas in Tenerife, El Hierro, La Palma and La Gomera, the converse is generally true. The implications of the results both for understanding the evolution of Canary Island endemic diversity and for the conservation of the region’s unique and vulnerable flora are considered.La flora vascular endémica de las Islas Canarias comprende unos 680 táxones, lo que viene a representar más del 50% de la flora nativa. Con objeto de investigar patrones geográficos de diversidad en la flora endémica, se recopilaron los datos publicados que, junto con otras observaciones de campo y datos de herbario, sirvieron para completar una matriz de datos
Does mesoscale matters in decadal changes observed in the northern Canary upwelling system?
Relvas, P.; Luís, J.; Santos, A. M. P.
2009-04-01
The Western Iberia constitutes the northern limb of the Canary Current Upwelling System, one of the four Eastern Boundary Upwelling Systems of the world ocean. The strong dynamic link between the atmosphere and the ocean makes these systems highly sensitive to global change, ideal to monitor and investigate its effects. In order to investigate decadal changes of the mesoscale patterns in the Northern Canary upwelling system (off Western Iberia), the field of the satellite-derived sea surface temperature (SST) trends was built at the pixel scale (4x4 km) for the period 1985-2007, based on the monthly mean data from the Advanced Very High Resolution Radiometer (AVHRR) on board NOAA series satellites, provided by the NASA Physical Oceanography Distributed Active Archive Center (PO.DAAC) at the Jet Propulsion Laboratory. The time series were limited to the nighttime passes to avoid the solar heating effect and a suite of procedures were followed to guarantee that the temperature trends were not biased towards the seasonally more abundant summer data, when the sky is considerably clear. A robust linear fit was applied to each individual pixel, crossing along the time the same pixel in all the processed monthly mean AVHRR SST images from 1985 until 2007. The field of the SST trends was created upon the slopes of the linear fits applied to each pixel. Monthly mean SST time series from the one degree enhanced International Comprehensive Ocean-Atmosphere Data Set (ICOADS) and from near-shore measurements collected on a daily basis by the Portuguese Meteorological Office (IM) are also used to compare the results and extend the analysis back until 1960. A generalized warming trend is detected in the coastal waters off Western Iberia during the last decades, no matter which data set we analyse. However, significant spatial differences in the warming rates are observed in the satellite-derived SST trends. Remarkably, off the southern part of the Western Iberia the known
GonzáLez, Pablo J.; FernáNdez, José
2011-10-01
Interferometric Synthetic Aperture Radar (InSAR) is a reliable technique for measuring crustal deformation. However, despite its long application in geophysical problems, its error estimation has been largely overlooked. Currently, the largest problem with InSAR is still the atmospheric propagation errors, which is why multitemporal interferometric techniques have been successfully developed using a series of interferograms. However, none of the standard multitemporal interferometric techniques, namely PS or SB (Persistent Scatterers and Small Baselines, respectively) provide an estimate of their precision. Here, we present a method to compute reliable estimates of the precision of the deformation time series. We implement it for the SB multitemporal interferometric technique (a favorable technique for natural terrains, the most usual target of geophysical applications). We describe the method that uses a properly weighted scheme that allows us to compute estimates for all interferogram pixels, enhanced by a Montecarlo resampling technique that properly propagates the interferogram errors (variance-covariances) into the unknown parameters (estimated errors for the displacements). We apply the multitemporal error estimation method to Lanzarote Island (Canary Islands), where no active magmatic activity has been reported in the last decades. We detect deformation around Timanfaya volcano (lengthening of line-of-sight ˜ subsidence), where the last eruption in 1730-1736 occurred. Deformation closely follows the surface temperature anomalies indicating that magma crystallization (cooling and contraction) of the 300-year shallow magmatic body under Timanfaya volcano is still ongoing.
Aparicio, Alfredo; Tassinari, Colombo C. G.; García, Roberto; Araña, Vicente
2010-01-01
The lavas produced by the Timanfaya eruption of 1730-1736 (Lanzarote, Canary Islands) contain a great many sedimentary and metamorphic (metasedimentary), and mafic and ultramafic plutonic xenoliths. Among the metamorphosed carbonate rocks (calc-silicate rocks [CSRs]) are monomineral rocks with forsterite or wollastonite, as well as rocks containing olivine ± orthopyroxene ± clinopyroxene ± plagioclase; their mineralogical compositions are identical to those of the mafic (gabbros) and ultramafic (dunite, wherlite and lherzolite) xenoliths. The 87Sr/ 86Sr (around 0.703) and 143Nd/ 144Nd (around 0.512) isotope ratios of the ultramafic and metasedimentary xenoliths are similar, while the 147Sm/ 144Nd ratios show crustal values (0.13-0.16) in the ultramafic xenoliths and mantle values (0.18-0.25) in some CSRs. The apparent isotopic anomaly of the metamorphic xenoliths can be explained in terms of the heat source (basaltic intrusion) inducing strong isotopic exchange ( 87Sr/ 86Sr and 143Nd/ 144Nd) between metasedimentary and basaltic rocks. Petrofabric analysis also showed a possible relationship between the ultramafic and metamorphic xenoliths.
International Nuclear Information System (INIS)
Perez, Yannick; Ramos Real, Francisco Javier
2008-01-01
This paper presents a geographic dimension not often studied in the dynamics of creating an internal market for electricity within the European Union, namely the case of small European electricity systems like those found on the Greek islands of Cyprus and Crete. Our question, then, is how to achieve a suitable internal market for electricity in small and isolated systems. To address this issue, we identify the main problems to be overcome by introducing a methodology in which the Canary Islands experience is taken as a case study for understanding the challenges in creating an 'EU-like market for electricity'. Our results show that the design of the vertical industrial structure and the figure of the grid operator and its attributes are key features for the proper operation of any electrical system. We also stress the minor roles of other possible options to achieve this EU-compatible market by highlighting first, in the wholesale market, the call-for-tender solution to introduce more generation and the risk of using safety requirements as barriers to entry in these small markets, and second, in the supply activities, the potential problems of an improperly regulated tariff scheme. (author)
Directory of Open Access Journals (Sweden)
Marie Pagès
Full Text Available BACKGROUND: The lava mouse, Malpaisomys insularis, was endemic to the Eastern Canary islands and became extinct at the beginning of the 14(th century when the Europeans reached the archipelago. Studies to determine Malpaisomys' phylogenetic affinities, based on morphological characters, remained inconclusive because morphological changes experienced by this insular rodent make phylogenetic investigations a real challenge. Over 20 years since its first description, Malpaisomys' phylogenetic position remains enigmatic. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we resolved this issue using molecular characters. Mitochondrial and nuclear markers were successfully amplified from subfossils of three lava mouse samples. Molecular phylogenetic reconstructions revealed, without any ambiguity, unsuspected relationships between Malpaisomys and extant mice (genus Mus, Murinae. Moreover, through molecular dating we estimated the origin of the Malpaisomys/mouse clade at 6.9 Ma, corresponding to the maximal age at which the archipelago was colonised by the Malpaisomys ancestor via natural rafting. CONCLUSION/SIGNIFICANCE: This study reconsiders the derived morphological characters of Malpaisomys in light of this unexpected molecular finding. To reconcile molecular and morphological data, we propose to consider Malpaisomys insularis as an insular lineage of mouse.
Photosynthetic response and zonation of three species of Gelidiales from Tenerife, Canary Islands
Directory of Open Access Journals (Sweden)
Domíguez-Álvarez, S.
2011-06-01
Full Text Available Three species of Gelidiales (Gelidium arbuscula, Gelidium canariense and Pterocladiella capillacea (Rhodophyta were selected due to their abundance in the marine lower intertidal of the north coast of the island of Tenerife (Canary Islands, to assess, using PAM fluorescence, the importance of irradiance and exposure to air on vertical distribution. We compared tolerance to emersion by air-drying fronds under simulated emersion, and results suggest that recovery of photosynthesis after emersion plays a major role in the vertical distribution of these three species. Morphological traits such as clumped fronds explain the higher tolerances, and reduced water loss of the species upper on the shore. Local differences between sites may be related to slight differences in the light regime related to topography.
Se han seleccionado tres especies de Gelidiales (Gelidium arbuscula, Gelidium canariense y Pterocladiella capillacea que son abundantes en los niveles inferiores del intermareal de la costa N de Tenerife para establecer, utilizando fluorescencia tipo PAM, la importancia de la cantidad de luz y la exposición al aire en su zonación vertical. Se ha comparado la tolerancia a la emersión en frondes expuestas al aire, y los resultados sugieren que la capacidad de recuperación de la fotosíntesis tras la emersión tiene un papel fundamental en la explicación de la posición vertical de estas tres especies. Además, características morfológicas como el apelotonamiento de las frondes pueden coadyuvar a la mayor tolerancia, al reducir la pérdida de agua en emersión en las especies de niveles más altos. Las variaciones entre sitios se pueden deber a desigualdades locales en la cantidad de luz provocadas por diferencias topográficas.
Blood Dendritic Cells: Canary in the Coal Mine to Predict Chronic Inflammatory Disease?
Directory of Open Access Journals (Sweden)
Brodie eMiles
2014-01-01
Full Text Available The majority of risk factors for chronic inflammatory diseases are unknown. This makes personalized medicine for assessment, prognosis, and choice of therapy very difficult. It is becoming increasingly clear, however, that low-grade subclinical infections may be an underlying cause of many chronic inflammatory diseases and thus may contribute to secondary outcomes (e.g. cancer. Many diseases are now categorized as inflammatory-mediated diseases that stem from a dysregulation in host immunity. There is a growing need to study the links between low-grade infections, the immune responses they elicit, and how this impacts overall health. One such link explored in detail here is the extreme sensitivity of myeloid dendritic cells (mDC in peripheral blood to chronic low-grade infections and the role that these mDCs play in arbitrating the resulting immune responses. We find that emerging evidence supports a role for pathogen-induced mDCs in chronic inflammation leading to increased risk of secondary clinical disease. The mDCs that are elevated in the blood as a result of low-grade bacteremia often do not trigger a productive immune response, but can disseminate the pathogen throughout the host. This aberrant trafficking of mDCs can accelerate systemic inflammatory disease progression. Conversely, restoration of DC homeostasis may aid in pathogen elimination and minimize dissemination. Thus it would seem prudent when assessing chronic inflammatory disease risk to consider blood mDC numbers, and the microbial content (microbiome and activation state of these mDCs. These may provide important clues (the canary in the coal mine of high inflammatory disease risk. This will facilitate development of novel immunotherapies to eliminate such smoldering infections in atherosclerosis, cancer, rheumatoid arthritis, and pre-eclampsia.
Grazing effects on species composition in different vegetation types (La Palma, Canary Islands)
Arévalo, J. R.; de Nascimento, L.; Fernández-Lugo, S.; Mata, J.; Bermejo, L.
2011-05-01
Grazing management is probably one of the most extensive land uses, but its effects on plant communities have in many cases been revealed to be contradictory. Some authors have related these contradictions to the stochastic character of grazing systems. Because of that, it is necessary to implement specific analyses of grazing effects on each community, especially in natural protected areas, in order to provide the best information to managers. We studied the effects of grazing on the species composition of the main vegetation types where it takes place (grasslands, shrublands and pine forests) on the island of La Palma, Canary Islands. We used the point-quadrat intersect method to study the species composition of grazed and ungrazed areas, which also were characterized by their altitude, distance to farms, distance to settlements, year of sampling, herbaceous aboveground biomass and soil organic matter. The variables organic matter, productivity and species richness were not significantly affected by grazing. The species composition of the analyzed plant communities was affected more by variables such as altitude or distance to farms than by extensive grazing that has been traditionally carried out on the island of La Palma involving certain practices such as continuous monitoring of animals by goat keepers, medium stocking rates adjusted to the availability of natural pastures, supplementation during the dry season using local forage shrubs or mown pastures and rotating animals within grazing areas Although some studies have shown a negative effect of grazing on endangered plant species, these results cannot be freely extrapolated to the traditional grazing systems that exert a low pressure on plant communities (as has been found in this study). We consider extensive grazing as a viable way of ensuring sustainable management of the studied ecosystems.
Human impacts quantification on the coastal landforms of Gran Canaria Island (Canary Islands)
Ferrer-Valero, Nicolás; Hernández-Calvento, Luis; Hernández-Cordero, Antonio I.
2017-06-01
The coastal areas of the Canary Islands are particularly sensitive to changes, both from a natural perspective and for their potential socio-economic implications. In this paper, the state of conservation of an insular coast is approached from a geomorphological point of view, considering recent changes induced by urban and tourism development. The analysis is applied to the coast of Gran Canaria, a small Atlantic island of volcanic origin, subject to a high degree of human pressure on its coastal areas, especially in recent decades. Currently, much of the economic activity of Gran Canaria is linked to mass tourism, associated with climatic and geomorphological features of the coast. This work is addressed through detailed mapping of coastal landforms across the island (256 km perimeter), corresponding to the period before the urban and tourism development (late 19th century for the island's capital, mid-20th century for the rest of the island) and today. The comparison between the coastal geomorphology before and after the urban and tourism development was established through four categories of human impacts, related to their conservation state: unaltered, altered, semi-destroyed and extinct. The results indicate that 43% of coastal landforms have been affected by human impacts, while 57% remain unaltered. The most affected are sedimentary landforms, namely coastal dunes, palaeo-dunes, beaches and wetlands. Geodiversity loss was also evaluated by applying two diversity indices. The coastal geodiversity loss by total or partial destruction of landforms is estimated at - 15.2%, according to Shannon index (H‧), while it increases to - 32.1% according to an index proposed in this paper. We conclude that the transformations of the coast of Gran Canaria induced by urban and tourism development have heavily affected the most singular coastal landforms (dunes, palaeo-dunes and wetlands), reducing significantly its geodiversity.
Directory of Open Access Journals (Sweden)
S. HELLQVIST
2008-12-01
Full Text Available A severe infestation of the gall midge Epicalamus phalaridis (Diptera: Cecidomyiidaeoccurred in a field of reed canary grass, Phalaris arundinacea in northern Sweden. The midge species has potential to become a serious pest on Phalaris grown for bioenergy or fibre production. Larvae of the midge feed beneath leaf sheaths and the crop lodges in late summer. Details are given on the biology of the midge. In the infested field, population densities of the midge were very high during three consecutive years. The crop was weakened and the occurrence of weeds increased. The dry matter yields declined markedly and were after three years of midge-attack about 50% of the average yield in the preceding years. The yield dropped comparatively more when the crop was harvested in the spring as opposed to harvest in late autumn and more at a nitrogen fertilisation at 100 kg compared to 200 kg N ha1 per year. The effect of midge attack on fibre quality was studied. The fibre properties of midge-infested parts of internodes were poor, but as midge-damaged parts are brittle, they could probably be sorted out in a fractionation process. Undamaged parts of infested internodes had the same fibre properties as those from an uninfested crop.;
National Oceanic and Atmospheric Administration, Department of Commerce — Raw DNA chromatogram data produced by the ABI 373, 377, 3130 and 3730 automated sequencing machines in ABI format. These are from fish (primarily Sebastes spp.,...
Rodriguez-Losada, Jose A.; Eff-Darwich, Antonio; Hernandez, Luis E.; Viñas, Ronaldo; Pérez, Nemesio; Hernandez, Pedro; Melián, Gladys; Martinez-Frías, Jesús; Romero-Ruiz, M. Carmen; Coello-Bravo, Juan Jesús
2015-02-01
This paper describes the main physical, petrological and geochemical features of the floating fragments that were emitted in the initial stages of the 2011-2012 submarine eruption off the coast of the Canarian island of El Hierro, located 380 km from the Northwest African Coast. It attempts to assess the potential of radiometric analyses to discern the intriguing origin of the floating fragments and the differences between their constituent parts. In this regard, the material that conforms the core of the fragments contains the largest concentration of uranium (U) ever found in volcanic rocks of the Canary Islands. This enrichment in U is not found in the content of thorium (Th), hence the floating fragments have an unusual U/Th ratio, namely equal to or larger than 3. Although the origin of this material is under discussion, it is proposed that the enrichment in U is the result of hydrothermal processes.
The continental slope current system between Cape Verde and the Canary Islands
Directory of Open Access Journals (Sweden)
Jesús Peña-Izquierdo
2012-08-01
Full Text Available We use hydrographic, velocity and drifter data from a cruise carried out in November 2008 to describe the continental slope current system in the upper thermocline (down to 600 m between Cape Verde and the Canary Islands. The major feature in the region is the Cape Verde Frontal Zone (CVFZ, separating waters from tropical (southern and subtropical (northern origin. The CVFZ is found to intersect the slope north of Cape Blanc, between 22°N and 23°N, but we find that southern waters are predominant over the slope as far north as 24°N. South of Cape Blanc (21.25°N the Poleward Undercurrent (PUC is a prominent northward jet (50 km wide, reaching down to 300 m and indistinguishable from the surface Mauritanian Current. North of Cape Blanc the upwelling front is found far offshore, opening a near-slope northward path to the PUC. Nevertheless, the northward PUC transport decreases from 2.8 Sv at 18°N to 1.7 Sv at 24°N, with about 1 Sv recirculating ofshore just south of Cape Blanc, in agreement with the trajectory of subsurface drifters. South of the CVFZ there is an abrupt thermohaline transition at σϴ=26.85 kg m–3, which indicates the lower limit of the relatively pure (low salt and high oxygen content South Atlantic Central Water (SACW variety that coexists with the dominant locally-diluted (salinity increases through mixing with North Atlantic Central Water but oxygen diminishes because of enhanced remineralization Cape Verde (SACWcv variety. At 16°N about 70% of the PUC transport corresponds to the SACW variety but but this is transformed into 40% SACWcv at 24°N. However, between Cape Verde and Cape Blanc and in the 26.85 < σϴ < 27.1 layer, we measure up to 0.8 Sv of SACWcv being transported south. The results strongly endorse the idea that the slope current system plays a major role in tropical-subtropical water-mass exchange.
Karki, Sandhya; Elsgaard, Lars; Kandel, Tanka P; Lærke, Poul Erik
2015-03-01
Empirical greenhouse gas (GHG) flux estimates from diverse peatlands are required in order to derive emission factors for managed peatlands. This study on a drained fen peatland quantified the annual GHG balance (Carbon dioxide (CO2), nitrous oxide (N2O), methane (CH4), and C exported in crop yield) from spring barley (SB) and reed canary grass (RCG) using static opaque chambers for GHG flux measurements and biomass yield for indirectly estimating gross primary production (GPP). Estimates of ecosystem respiration (ER) and GPP were compared with more advanced but costly and labor-intensive dynamic chamber studies. Annual GHG balance for the two cropping systems was 4.0 ± 0.7 and 8.1 ± 0.2 Mg CO2-Ceq ha(-1) from SB and RCG, respectively (mean ± standard error, n = 3). Annual CH4 emissions were negligible (peatland cropped to SB and RCG and presented a valid alternative to estimating the full GHG balance by dynamic chambers.
Melt inclusion study of the most recent basanites from El Hierro and Lanzarote, Canary Islands
Gomez-Ulla, Alejandra; Sigmarsson, Olgeir; Huertas, Maria Jose; Ancochea, Eumenio
2015-04-01
The latest eruptions of both Lanzarote (one of the oldest and easternmost of the Canary Island archipelago) and El Hierro (the youngest and westernmost) produced basanite lavas. Major, volatile and trace element concentrations of melt inclusion (MI) hosted in olivine for both eruptions have been analysed. The basanites display primitive mantle normalized trace element spectra suggesting a magma source largely composed of recycled oceanic crust. In addition, beneath Lanzarote an interaction with a carbonatitic fluid phase or metasome would explain eccentric Ba/U and other trace element ratios. Contribution of carbonatitic component would readily account for extremely volatile-rich (Cl, F, S) MI from Lanzarote (Cl=1577-2500 ppm) whereas the maximum for El Hierro is 1080 ppm. The submarine character of the 2011-12 eruption off El Hierro appears to have affected the degassing behavior, whereas estimated sulfur emission to the atmosphere during the historical Lanzarote eruptions are amongst the highest observed so far. An estimated magma volume (VDRE) of 0.02 km3 yields atmospheric mass loading of 0.2 Mt SO2 from the 1824 Lanzarote eruption. Scaling the volume of the 1824 Lanzarote eruption to that of the previous Timanfaya eruption (1730-6; 5 km3) results in estimated 12 Mt SO2, an atmospheric mass loading only outnumbered by the historical Laki and Eldgjá eruptions in Iceland. The significantly greater volatile budget of basanites from Lanzarote compared to El Hierro is thus controlled by more fertile source composition closer to the African continent.
Telesca, Luciano; Lovallo, Michele; Lopez, Carmen; Marti Molist, Joan
2016-03-01
A detailed statistical investigation of the seismicity occurred at El Hierro volcano (Canary Islands) from 2011 to 2014 has been performed by analysing the time variation of four parameters: the Gutenberg-Richter b-value, the local coefficient of variation, the scaling exponent of the magnitude distribution and the main periodicity of the earthquake sequence calculated by using the Schuster's test. These four parameters are good descriptors of the time and magnitude distributions of the seismic sequence, and their variation indicate dynamical changes in the volcanic system. These variations can be attributed to the causes and types of seismicity, thus allowing to distinguish between different host-rock fracturing processes caused by intrusions of magma at different depths and overpressures. The statistical patterns observed among the studied unrest episodes and between them and the eruptive episode of 2011-2012 indicate that the response of the host rock to the deformation imposed by magma intrusion did not differ significantly from one episode to the other, thus suggesting that no significant local stress changes induced by magma intrusion occurred when comparing between all them. Therefore, despite the studied unrest episodes were caused by intrusions of magma at different depths and locations below El Hierro island, the mechanical response of the lithosphere was similar in all cases. This suggests that the reason why the first unrest culminated in an eruption while the other did not, may be related to the role of the regional/local tectonics acting at that moment, rather than to the forceful of magma intrusion.
Selective algicidal action of peptides against harmful algal bloom species.
Directory of Open Access Journals (Sweden)
Seong-Cheol Park
Full Text Available Recently, harmful algal bloom (HAB, also termed "red tide", has been recognized as a serious problem in marine environments according to climate changes worldwide. Many novel materials or methods to prevent HAB have not yet been employed except for clay dispersion, in which can the resulting sedimentation on the seafloor can also cause alteration in marine ecology or secondary environmental pollution. In the current study, we investigated that antimicrobial peptide have a potential in controlling HAB without cytotoxicity to harmless marine organisms. Here, antimicrobial peptides are proposed as new algicidal compounds in combating HAB cells. HPA3 and HPA3NT3 peptides which exert potent antimicrobial activity via pore forming action in plasma membrane showed that HPA3NT3 reduced the motility of algal cells, disrupted their plasma membrane, and induced the efflux of intracellular components. Against raphidoflagellate such as Heterosigma akashiwo, Chattonella sp., and C. marina, it displayed a rapid lysing action in cell membranes at 1~4 µM within 2 min. Comparatively, its lysing effects occurred at 8 µM within 1 h in dinoflagellate such as Cochlodium polykrikoides, Prorocentrum micans, and P. minimum. Moreover, its lysing action induced the lysis of chloroplasts and loss of chlorophyll a. In the contrary, this peptide was not effective against Skeletonema costatum, harmless algal cell, even at 256 µM, moreover, it killed only H. akashiwo or C. marina in co-cultivation with S. costatum, indicating to its selective algicidal activity between harmful and harmless algal cells. The peptide was non-hemolytic against red blood cells of Sebastes schlegeli, the black rockfish, at 120 µM. HAB cells were quickly and selectively lysed following treatment of antimicrobial peptides without cytotoxicity to harmless marine organisms. Thus, the antibiotic peptides examined in our study appear to have much potential in effectively controlling HAB with minimal
Bustos, Claudia A.; Landaeta, Mauricio F.; Balbontín, Fernando
2011-03-01
The occidental shore of the southern tip of South America is one of the largest estuarine ecosystems around the world. Although demersal finfish fisheries are currently in full exploitation in the area, the fjords south of 47°S have been poorly investigated. Two bio-oceanographic cruises carried out in austral spring 1996 and 2008 between 47°S and 50°09'S were utilized to investigate the spatial distribution of fish eggs and larvae. Small differences in the environmental conditions were identified in the top 200 m of the water column between years (5.3-10.5 °C and 0.7-33.9 units of salinity in October 1996; 6.3-11.5 °C and 1.2-34.2 units of salinity in November 2008). The low salinity surface layer generated a highly stable water column within the fjords (Brunt-Väisälä frequency, N>0.1 rad/s; wave period ichthyoplankton analysis showed that early life stages of lightfish Maurolicus parvipinnis were dominant (>75% total eggs and >70% total larvae) and they were collected throughout the area, irrespective of the water column stratification. However, other components of the ichthyoplankton such as Falkland sprat Sprattus fuegensis, rockfish Sebastes oculatus, and hoki Macruronus magellanicus were more abundant and found in a wider range of larval sizes in less stable waters ( N<0.1 rad/s). Oceanic taxa such as myctophids ( Lampanyctodes hectoris) and gonostomatids ( Cyclothone sp.) were collected exclusively in open waters. The October 1996 observation of Engraulis ringens eggs in plankton samples corresponded to the southernmost record of early stages of this fish in the Pacific Ocean. We found a significant negative relationship between the number of larval species and N, and a significant positive relationship between the number of larval species and wave period. Therefore, only some marine fish species are capable to utilize fjords systems as spawning and nursery grounds in areas having high amounts of freshwater discharges and very high vertical
Caillaud, A; Eixarch, H; de la Iglesia, P; Rodriguez, M; Dominguez, L; Andree, K B; Diogène, J
2012-01-01
The ouabain/veratridine-dependent neuroblastoma (neuro-2a) cell-based assay (CBA) was applied for the determination of the presence of ciguatoxin (CTX)-like compounds in ciguatera-suspected fish samples caught in the Canary Islands. In order to avoid matrix interferences the maximal concentration of wet weight fish tissue exposed to the neuro-2a cells was set at 20 mg tissue equivalent (TE) ml(-1) according to the sample preparation procedure applied. In the present study, the limit of quantification (LOQ) of CTX1B equivalents in fish extract was set at the limit of detection (LOD), being defined as the concentration of CTX1B equivalents inhibiting 20% cell viability (IC(20)). The LOQ was estimated as 0.0096 ng CTX1B eq.g TE(-1) with 23-31% variability between experiments. These values were deemed sufficient even though quantification given at the IC(50) (the concentration of CTX1B equivalents inhibiting 50% cell viability) is more accurate with a variability of 17-19% between experiments. Among the 13 fish samples tested, four fish samples were toxic to the neuro-2a cells with estimations of the content in CTX1B g(-1) of TE ranging from 0.058 (± 0.012) to 6.23 (± 0.713) ng CTX1B eq.g TE(-1). The high sensitivity and specificity of the assay for CTX1B confirmed its suitability as a screening tool of CTX-like compounds in fish extracts at levels that may cause ciguatera fish poisoning. Species identification of fish samples by DNA sequence analysis was conducted in order to confirm tentatively the identity of ciguatera risk species and it revealed some evidence of inadvertent misidentification. Results presented in this study are a contribution to the standardisation of the neuro-2a CBA and to the risk analysis for ciguatera in the Canary Islands.
International Nuclear Information System (INIS)
Antonanzas-Torres, F.; Antonanzas, J.; Urraca, R.; Alia-Martinez, M.; Martinez-de-Pison, F.J.
2016-01-01
Highlights: • Assessment on the performance of solar clear-sky models at different altitude. • SOLIS and REST2 clear-sky models were superior with fine atmospheric inputs. • ESRA proved more robust with low spatial resolution atmospheric inputs. • Over-estimation occurred at the lower site when using inputs from the upper site. - Abstract: The estimation of clear-sky solar irradiance via clear-sky models depends on reliable values of aerosol optical depth, water vapor and ozone content. These atmospheric variables are rarely on-site measured and are generally provided as gridded estimates in very low spatial resolution (1°). The high spatial variability of atmospheric variables within the grid resolution (pixel) leads to important errors in those areas with great atmospheric variability, such as in mountainous regions. In this paper, the performance of three clear-sky solar irradiance models was evaluated in a site with especially great elevation range, the Izana station from the Baseline Surface Radiation Network (Tenerife, Canary Islands) located at a high elevation (2373 m) and just 14 km from the ocean. Aerosols data were obtained from measurements from the Aerosol Robotic Network (AERONET) at the same site. The evaluation was also compared with global horizontal irradiance estimations with clear-sky models in the Guimar station, located at a lower elevation (156 m) and only 11.5 km away from Izana. Results showed a strong influence of elevation on solar radiation estimation under clear-sky conditions.
Mittelbach, Moritz; Yurkov, Andrey M; Nocentini, Daniele; Nepi, Massimo; Weigend, Maximilian; Begerow, Dominik
2015-02-01
Studies on the diversity of yeasts in floral nectar were first carried out in the late 19th century. A narrow group of fermenting, osmophilous ascomycetes were regarded as exclusive specialists able to populate this unique and species poor environment. More recently, it became apparent that microorganisms might play an important role in the process of plant pollination. Despite the importance of these nectar dwelling yeasts, knowledge of the factors that drive their diversity and species composition is scarce. In this study, we linked the frequencies of yeast species in floral nectars from various host plants on the Canary Islands to nectar traits and flower visitors. We estimated the structuring impact of pollination syndromes (nectar volume, sugar concentration and sugar composition) on yeast diversity.The observed total yeast diversity was consistent with former studies, however, the present survey yielded additional basidiomycetous yeasts in unexpectedly high numbers. Our results show these basidiomycetes are significantly associated with ornithophilous flowers. Specialized ascomycetes inhabit sucrose-dominant nectars, but are surprisingly rare in nectar dominated by monosaccharides. There are two conclusions from this study: (i) a shift of floral visitors towards ornithophily alters the likelihood of yeast inoculation in flowers, and (ii) low concentrated hexose-dominant nectar promotes colonization of flowers by basidiomycetes. In the studied floral system, basidiomycete yeasts are acknowledged as regular members of nectar. This challenges the current understanding that nectar is an ecological niche solely occupied by ascomycetous yeasts.
International Nuclear Information System (INIS)
Vinas, Ronaldo; Eff-Darwich, Antonio; Soler, Vicente; Martin-Luis, Maria C.; Quesada, Maria L.; Nuez, Julio de la
2007-01-01
The analysis of temporal and spatial variations in the flux of soil gases across the soil-air interface is a useful tool to study geo-dynamical processes associated with volcanic and/or seismic activity. However, many of these variations are induced by external variables, such as temperature, barometric pressure, rainfall and other meteorological variables. In an attempt to filter out non-endogenous variations in the emissions of gases, the optimal choice of the monitoring sites with numerical filtering techniques based on multi-variate and frequency domain analysis of the time series for gaseous emissions were combined, in the case of radon ( 222 Rn). Monitoring sites are located in underground galleries in the volcanic island of Tenerife, Canary Islands, Spain. Since the effect of wind, rainfall and temperature variations are very small inside galleries, a first natural filtering process of external parameters in the emissions of gases was achieved. This new approach has been successfully tested and as a result, the background level for radon emissions at various locations has been defined, by which correlations between gaseous emissions and the volcanic and/or seismic activity could be carried out
Gomez-Ortiz, David; Montesinos, Fuensanta G.; Martin-Crespo, Tomas; Solla, Mercedes; Arnoso, Jose; Velez, Emilio
2014-05-01
The Timanfaya National Park is a volcanic area, which occupies a surface area of about 51 sq. km in the southwest of Lanzarote Island (Canary Archipelago, Spain). The 1730-1736 eruption gave rise to this volcanic landscape with more than 30 volcanic cones formed in different phases of basaltic type eruptions. It was one of the most important volcanic events occurred in the Canary Archipelago over the last 500 years. Several canyons ("jameos") are crossing this landscape in all directions, being created while the surface of the lava cooled off, and broke into pieces, falling down into the several tubes. Its location and identification is important to prevent hazards or to achieve a good exploitation from a visitor viewpoint in a restricted touristic area as the Timanfaya National Park. The use of prospective techniques to investigate the near subsurface structure of the park is very complicated, and only some regional study through gravity, magnetism and seismicity have been undertaken to attempt to model the deeper crustal structure of Lanzarote Island. This work presents a new study about the location of recent lava tubes at the volcanic area of Timanfaya National Park by the analysis and joint interpretation of high-resolution gravity, ground penetrating radar (GPR), and electromagnetic induction (EMI) data obtained over areas which had not been surveyed up to date. The studied lava flows are located at the Calderas Quemadas zone. The processed GPR radargram displays a complex pattern of reflections along the whole profile up to ~9 m depth. The strongest reflections can be grouped in four different areas defined by several hyperbolic reflections. Direct visual inspections carried out in the field allow confirming the occurrence of lava tubes at two of the locations where hyperbolic reflections are defined. Then, the strong reflections observed have been interpreted as the effect of the roof and bottom interfaces of several lava tubes. A microgravity survey along
Curto, M; Puppo, P; Kratschmer, S; Meimberg, H
2017-08-22
Especially on islands closer to the mainland, such as the Canary Islands, different lineages that originated by multiple colonization events could have merged by hybridization, which then could have promoted radiation events (Herben et al., J Ecol 93: 572-575, 2005; Saunders and Gibson, J Ecol 93: 649-652, 2005; Caujapé-Castells, Jesters, red queens, boomerangs and surfers: a molecular outlook on the diversity of the Canarian endemic flora, 2011). This is an alternative to the scenario where evolution is mostly driven by drift (Silvertown, J Ecol 92: 168-173, 2004; Silvertown et al., J Ecol 93: 653-657, 2005). In the former case hybridization should be reflected in the genetic structure and diversity patterns of island species. In the present work we investigate Micromeria from the Canary Islands by extensively studying their phylogeographic pattern based on 15 microsatellite loci and 945 samples. These results are interpreted according to the hypotheses outlined above. Genetic structure assessment allowed us to genetically differentiate most Micromeria species and supported their current classification. We found that populations on younger islands were significantly more genetically diverse and less differentiated than those on older islands. Moreover, we found that genetic distance on younger islands was in accordance with an isolation-by-distance pattern, while on the older islands this was not the case. We also found evidence of introgression among species and islands. These results are congruent with a scenario of multiple colonizations during the expansion onto new islands. Hybridization contributes to the grouping of multiple lineages into highly diverse populations. Thus, in our case, islands receive several colonization events from different sources, which are combined into sink populations. This mechanism is in accordance with the surfing syngameon hypothesis. Contrary to the surfing syngameon current form, our results may reflect a slightly different