Vicente, J G; Everett, B; Roberts, S J
2006-07-01
ABSTRACT Twenty-five Xanthomonas isolates, including some isolates received as either X. campestris pv. armoraciae or pv. raphani, caused discrete leaf spot symptoms when spray-inoculated onto at least one Brassica oleracea cultivar. Twelve of these isolates and four other Xanthomonas isolates were spray- and pin-inoculated onto 21 different plant species/cultivars including horseradish (Armoracia rusticana), radish (Raphanus sativus), and tomato (Lycopersicon esculentum). The remaining 13 leaf spot isolates were spray-inoculated onto a subset of 10 plant species/cultivars. The leaf spot isolates were very aggressive on several Brassica spp., radish, and tomato causing leaf spots and dark sunken lesions on the middle vein, petiole, and stem. Based on the differential reactions of several Brassica spp. and radish cultivars, the leaf spot isolates were divided into three races, with races 1 and 3 predominating. A differential series was established to determine the race-type of isolates and a gene-for-gene model based on the interaction of two avirulence genes in the pathogen races and two matching resistance genes in the differential hosts is proposed. Repetitive-DNA polymerase chain reaction-based fingerprinting was used to assess the genetic diversity of the leaf spot isolates and isolates of closely related Xanthomonas pathovars. Although there was variability within each race, the leaf spot isolates were clustered separately from the X. campestris pv. campestris isolates. We propose that X. campestris isolates that cause a nonvascular leaf spot disease on Brassica spp. should be identified as pv. raphani and not pv. armoraciae. Race-type strains and a neopathotype strain for X. campestris pv. raphani are proposed.
Transmission of Xanthomonas campestris pv. campestris in seed production crops of cauliflower
Kastelein, P.; Krijger, M.C.; Zouwen, van der P.S.; Steen, van der J.J.M.; Stevens, L.H.; Wolf, van der J.M.; Fernandes Vieira, J.; Amaral Villela, F.
2014-01-01
n 2011, two polytunnel greenhouse experiments were conducted on seed production farms, one under conventional conditions in the South-West (Rilland) and the other under organic conditions in the East (Voorst) of the Netherlands, to study transmission routes of Xanthomonas campestris pv. campestris
Directory of Open Access Journals (Sweden)
Dragana Radunović
2012-01-01
Full Text Available Brassicas form the most important group of vegetable crops in Montenegro. The cabbage(Brassica oleracea var. capitata is most commonly grown, although other brassicas,particularly kale, Brussels sprout, cauliflower and broccoli, have been increasingly producedsince recently. One of the specialties of vegetable production in Montenegro is growing ofcollard (Brassica oleracea var. acephala, which is the simplest variety of the Brassica oleraceaspecies and in the nearest relation with their wild ancestor – the sylvestris variety.Diseases are the main restrictive factors for successful production of these vegetables.Susceptibility of the cultivars and inadequate control often result in more or less damagedcrops in some plots.Causal agents of brassica diseases, especially bacterial, have not been investigated inMontenegro until 2009. Since the symptoms observed in 2009 were „V” shaped leaf edgenecrosis and black rot of vascular tissue, it was assumed that they were caused by plantpathogenic bacterium Xanthomonas campestris pv. campestris.Samples of the infected plants were collected from different localities in Montenegro.Isolation and identification of the bacterium were performed using laboratory methodsaccording to Schaad (1980, Lelliott and Stead (1987 and Arsenijević (1997. Examinationof chosen bacterial isolates was conducted using both, classical bacteriological methods(examination of their pathogenic, morphological, cultivation and biochemical and physiologicalcharacteristics, and ELISA test.The obtained results confirmed the presence of X.campestris pv. campestris (Pammel,1895 Dowson 1939, on cabbage, kale, broccoli and collard in Montenegro. This is the firstexperimental evidence that collard is the host of X. campestris pv. campestris in Montenegro.
Wolf, van der J.M.; Zouwen, van der P.S.; Heijden, van der L.
2013-01-01
During seed production, Brassica seed may become infected with Xanthomonas campestris pv. campestris after systemic colonization of plants upon leaf infection, or alternatively, after flower infection. Polytunnel experiments were conducted in 2007 and 2008 to study the relative importance of these
DNA polymorphism analysis of Xanthomonas campestris pv ...
African Journals Online (AJOL)
strand conformation polymorphism (SSCP) techniques using M13 and 16S rRNA primers, respectively, for genotyping of the phytopathogenic bacterium Xanthomonas campestris pv. campestris was studied. RAPD provided a simple, rapid, and ...
African Journals Online (AJOL)
eobe
Xanthan gum is a major biopolymer which finds a lot of applications industrially and domestically. ... gum was produced from pineapple peels using Xanthomonas campestris by ... producing microorganism is strongly influenced by the medium.
Xanthan gum production by Xanthomonas campestris pv ...
African Journals Online (AJOL)
Cassava starch is a main renewable bio-resource with low price and mass production in Guangxi, China. It was used as carbon source in growing Xanthomonas campestris pv. campestris 8004 (Xcc 8004) for xanthan gum production in this study. The xanthan gum yield of gelatinized cassava starch was higher than that of ...
DEFF Research Database (Denmark)
Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe
2009-01-01
Glycoside hydrolase family 13 (GH-13) mainly contains starch-degrading or starch-modifying enzymes. Sucrose hydrolases utilize sucrose instead of amylose as the primary glucosyl donor. Here, the catalytic properties and X-ray structure of sucrose hydrolase from Xanthomonas campestris pv. campestris...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...
Structure of XC6422 from Xanthomonas campestris at 1.6 Å resolution: a small serine α/β-hydrolase
Energy Technology Data Exchange (ETDEWEB)
Yang, Chao-Yu; Chin, Ko-Hsin [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China); Chou, Chia-Cheng; Wang, Andrew H.-J. [Institute of Biological Chemistry, Academia Sinica, Nankang, Taipei,Taiwan (China); Core Facility for Protein Crystallography, Academia Sinica, Nankang, Taipei,Taiwan (China); Chou, Shan-Ho, E-mail: shchou@nchu.edu.tw [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China)
2006-06-01
The crystal structure of a conserved hypothetical protein from X. campestris has been determined to a resolution of 1.6 Å. The determined X. campestris structure shows that it belongs to the superfamily of serine α/β hydrolase, with an extra strand preceding the first β-strand to lead to extensive subunit interactions in the crystal. XC6422 is a conserved hypothetical protein from Xanthomonas campestris pathovar campestris (Xcc), a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. The protein consists of 220 amino acids and its structure has been determined to 1.6 Å resolution using the multi-wavelength anomalous dispersion (MAD) method. Although it has very low sequence identity to protein sequences in the PDB (less than 20%), the determined structure nevertheless shows that it belongs to the superfamily of serine α/β-hydrolases, with an active site that is fully accessible to solvent owing to the absence of a lid domain. Modelling studies with the serine esterase inhibitor E600 indicate that XC6422 adopts a conserved Ser-His-Asp catalytic triad common to this superfamily and has a preformed oxyanion hole for catalytic activation. These structural features suggest that XC6422 is most likely to be a hydrolase active on a soluble ester or a small lipid. An extra strand preceding the first β-strand in the canonical α/β-hydrolase fold leads to extensive subunit interactions between XC6422 monomers, which may explain why XC6422 crystals of good diffraction quality can grow to dimensions of up to 1.5 mm in a few days.
Meio semi-seletivo para isolamento de Xanthomonas campestris pv. viticola
Directory of Open Access Journals (Sweden)
Peixoto Ana Rosa
2006-01-01
Full Text Available O cancro bacteriano causado por Xanthomonas campestris pv. viticola é a fitobacteriose mais importante da videira no Submédio São Francisco. O isolamento de X. campestris pv. viticola de tecidos vegetais infectados é dificultado pela presença de contaminantes bacterianos, entre os quais Microbacterium barkeri. Objetivando-se a formulação de meio de cultura semi-seletivo, 22 isolados de X. campestris pv. viticola foram testados com relação a 30 antibióticos. O meio semi-seletivo NYDAM (extrato de carne 3, peptona 5, glicose 10, extrato de levedura 5, ágar 18 e ampicilina 0,1 em g L-1 inibiu M. barkeri e bactérias fitopatogênicas podendo ser utilizado para isolar X. campestris pv. viticola de hospedeiros com infecção natural em campo.
Production and cytogenetics of Brassica campestris-alboglabra chromosome addition lines
DEFF Research Database (Denmark)
Chen, B.Y.; Cheng, B.F.; Bagger Jørgensen, Rikke
1997-01-01
Four different Brassica campestris-alboglabra monosomic addition lines (AA + 1 chromosome from C, 2n = 21) were obtained after consecutive backcrosses between resynthesized B. napus (AACC, 2n = 38) and the parental B. campestris (AA, 2n = 20) accession. The alien chromosomes of B. alboglabra (CC, 2...
MicroRNAs from the parasitic plant Cuscuta campestris target host messenger RNAs.
Shahid, Saima; Kim, Gunjune; Johnson, Nathan R; Wafula, Eric; Wang, Feng; Coruh, Ceyda; Bernal-Galeano, Vivian; Phifer, Tamia; dePamphilis, Claude W; Westwood, James H; Axtell, Michael J
2018-01-03
Dodders (Cuscuta spp.) are obligate parasitic plants that obtain water and nutrients from the stems of host plants via specialized feeding structures called haustoria. Dodder haustoria facilitate bidirectional movement of viruses, proteins and mRNAs between host and parasite, but the functional effects of these movements are not known. Here we show that Cuscuta campestris haustoria accumulate high levels of many novel microRNAs (miRNAs) while parasitizing Arabidopsis thaliana. Many of these miRNAs are 22 nucleotides in length. Plant miRNAs of this length are uncommon, and are associated with amplification of target silencing through secondary short interfering RNA (siRNA) production. Several A. thaliana mRNAs are targeted by 22-nucleotide C. campestris miRNAs during parasitism, resulting in mRNA cleavage, secondary siRNA production, and decreased mRNA accumulation. Hosts with mutations in two of the loci that encode target mRNAs supported significantly higher growth of C. campestris. The same miRNAs that are expressed and active when C. campestris parasitizes A. thaliana are also expressed and active when it infects Nicotiana benthamiana. Homologues of target mRNAs from many other plant species also contain the predicted target sites for the induced C. campestris miRNAs. These data show that C. campestris miRNAs act as trans-species regulators of host-gene expression, and suggest that they may act as virulence factors during parasitism.
DEFF Research Database (Denmark)
Adriko, John; Aritua, V.; Mortensen, Carmen Nieves
2012-01-01
The present study developed a pathovar-specific PCR for the detection of Xanthomonas campestris pv. musacearum (Xcm), the cause of banana xanthomonas wilt, by amplification of a 265-bp region of the gene encoding the general secretion pathway protein D (GspD). A distinct DNA fragment......-specific PCR was successfully multiplexed with internal control primers targeting 16S rDNA for application on DNA from bacterial cultures and with primers targeting plant mitochondrial 26S rDNA for application on DNA extracted from plant material. Diagnostic discrimination of healthy and infected plants...
Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui
2015-04-01
Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous addition of host plant juice or ethanol extract to the growth medium of X. campestris pv. campestris could significantly boost DSF family signal production. It was subsequently revealed that X. campestris pv. campestris produces not only DSF but also BDSF (cis-2-dodecenoic acid) and another novel DSF family signal, which was designated DSF-II. BDSF was originally identified in Burkholderia cenocepacia to be involved in regulation of motility, biofilm formation, and virulence in B. cenocepacia. Functional analysis suggested that DSF-II plays a role equal to that of DSF in regulation of biofilm dispersion and virulence factor production in X. campestris pv. campestris. Furthermore, chromatographic separation led to identification of glucose as a specific molecule stimulating DSF family signal biosynthesis in X. campestris pv. campestris. (13)C-labeling experiments demonstrated that glucose acts as a substrate to provide a carbon element for DSF biosynthesis. The results of this study indicate that X. campestris pv. campestris could utilize a common metabolite of the host plant to enhance DSF family signal synthesis and therefore promote virulence. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge; Leonhardt, Nathalie; Berthomé, Richard; Noël, Laurent D
2017-06-01
Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower ( Brassica oleracea ) and Arabidopsis ( Arabidopsis thaliana ) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris ( Xcc ), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. © 2017 American Society of Plant Biologists. All Rights Reserved.
Directory of Open Access Journals (Sweden)
Sayonara M.P. Assis
1999-07-01
Full Text Available Twenty yeast isolates, obtained from cabbage phylloplane, were evaluated for antagonistic activity against Xanthomonas campestris pv. campestris, in field. Plants of cabbage cv. Midori were pulverized simultaneously with suspensions of antagonists and pathogen. After 10 days, plants were evaluated through percentage of foliar area with lesions. Percentage of disease severity reduction (DSR% was also calculated. Yeast isolates LR32, LR42 and LR19 showed, respectively, 72, 75 and 79% of DSR. These antagonists were tested in seven different application periods in relation to pathogen inoculation (T1=4 d before; T2=simultaneously; T3=4 d after; T4=4 d before + simultaneously; T5=4 d after + simultaneously; T6=4 d before + 4 d after; T7=4 d before + simultaneously + 4 d after. The highest DSRs were showed by LR42 (71%, LR42 (67%, LR35 (69% and LR19 (68% in the treatments T7, T4, T5 and T6, which significantly differed from the others. The same yeast antagonists were also tested for black rot control using different cabbage cultivars (Fuyutoyo, Master-325, Matsukaze, Midori, Sekai I and Red Winner. The DSRs varied from 58 to 61%, and there was no significant difference among cultivars.Vinte isolados de leveduras, obtidos a partir do filoplano de repolho foram avaliados pela atividade antagônica contra Xanthomonas campestris pv. campestris, em condições de campo. Plantas de repolho cv. Midori foram pulverizadas simultaneamente com suspensões do antagonista e do patógeno. Após 10 dias, as plantas foram avaliadas através da porcentagem de área foliar infectada. A porcentagem de redução da severidade da doença (DSR%, também foi calculada. Os isolados de leveduras LR32, LR42 e LR19 apresentaram, respectivamente, 72, 75 e 79% de DSR. Estes isolados foram testados em sete diferentes períodos de aplicação dos antagonistas em relação a inoculação do patógeno. (T1=4d antes; T2=simultaneamente; T3=4 d após; T4=4 d antes + simultaneamente; T5
Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge
2017-01-01
Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower (Brassica oleracea) and Arabidopsis (Arabidopsis thaliana) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris (Xcc), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. PMID:28184011
Directory of Open Access Journals (Sweden)
Nilvanira Donizeti Tebaldi
2007-12-01
Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliados, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica de sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento de plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants (`Baron', `Flórida', `Hana Midori Sakata', `Precoce Piracicaba de Verão', `Ramoso Santana' and `Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight. The
Directory of Open Access Journals (Sweden)
Nilvanira Donizete Tebaldi
2007-09-01
Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliadas, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica das sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento das plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants ('Baron', 'Flórida', 'Hana Midori Sakata', 'Precoce Piracicaba de Verão', 'Ramoso Santana' and 'Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight
Glycerol as a carbon source for xantan production by Xanthomonas campestris isolates
Directory of Open Access Journals (Sweden)
Bajić Bojana Ž.
2015-01-01
Full Text Available The success of xanthan biosynthesis depends on several factors, most importantly the genetic potential of the production microorganism and cultivation media composition. Cultivation media composition affects the yield and quality of the desired product as well as production costs. This is why many studies focus on finding cheap alternative raw materials, especially carbon sources, to replace commercially used glucose and sucrose. In addition to the Xanthomonas campestris ATCC 13951 which is the primary industrial production microorganism, other Xanthomonas strains can produce xanthan as well. Under the same conditions, different strains produce different amounts of the biopolymer of varying quality. The aim of this paper is to compare producibility of phytopathogenic X. campestris strains, isolated from the environment with the reference X. campestris ATCC 13951 strain and to estimate the possibility of xanthan production using alternative glycerol-based media than the synthetic glucose-based media. Submerged cultivation on the medium based on glucose or glycerol (2.0 %w/v was performed using the reference strain and eight isolated X. campestris strains. In order to assess the success of biosynthesis, xanthan yield and rheological properties were determined. Strains isolated from the environment produced yields between 2.98 g/L and 12.17 g/L on the glucose-based medium and 1.68 g/L and 6.31 g/L on the glycerol-based medium. Additionally, X. campestris ATCC 13951 provided the highest yield when using glucose (13.24 g/L, as well as glycerol-based medium (7.44 g/L. The obtained results indicate that in the applied experimental conditions and using all tested strains, glycerol is viable as a carbon source for the production of xanthan.
and Saccostomus campestris (Cricetomyinae) in relation to ...
African Journals Online (AJOL)
The gastric anatomy of two African cricetomyines is described and compared with that of the only African cricetine. The stomach of C. gambianus is more specialized than that of S. campestris and shows many parallels with that of M. albicaudatus. Both cricetomyines possess an oesophageal groove system which is absent ...
Directory of Open Access Journals (Sweden)
Niehaus Karsten
2008-06-01
Full Text Available Abstract Background Outer membrane vesicles (OMVs are released from the outer membrane of many Gram-negative bacteria. These extracellular compartments are known to transport compounds involved in cell-cell signalling as well as virulence associated proteins, e.g. the cytolysine from enterotoxic E. coli. Results We have demonstrated that Xanthomonas campestris pv. campestris (Xcc releases OMVs into the culture supernatant during growth. A proteome study identified 31 different proteins that associate with the OMV fraction of which half are virulence-associated. A comparison with the most abundant outer membrane (OM proteins revealed that some proteins are enriched in the OMV fraction. This may be connected to differences in the LPS composition between the OMVs and the OM. Furthermore, a comparison of the OMV proteomes from two different culture media indicated that the culture conditions have an impact on the protein composition. Interestingly, the proteins that are common to both culture conditions are mainly involved in virulence. Conclusion Outer membrane vesicles released from the OM of Xcc contain membrane- and virulence-associated proteins. Future experiments will prove whether these structures can serve as "vehicles" for the transport of virulence factors into the host membrane.
Directory of Open Access Journals (Sweden)
Pedro Gutiérrez Nava
2010-09-01
Full Text Available Lupinus campestris Schltdl. & Cham. grows in shallow fields and disturbed areas of Central Mexico. It has potential to improve soil fertility and as fodder. Seeds of L. campestris show dormancy, and the technology needed to increase its potential use requires information about conditions favouring seed germination. The aim of this study was to evaluate the seed germination responseof L. campestris under controlled (laboratory and natural field conditions. Under laboratory conditions, 2 yr old seeds had a maximum germination percentage (50% when they were scarified with sulphuric acid for 90 min prior to sowing and when laboratory light (0.5 µmol m-2 s-1 was maintained during the diurnal period. Without scarification, only about 3% of the seeds germinated. Light in laboratory resulted in an increased seed germination as compared to darkness condition. In the field experiment 1 yr old seeds were used testing the following treatments: (a seed scarification (seeds scarified by 30 min immersion in sulphuric acid vs. not scarified, (b presence or absence of plants of L. campestris in plots before field experiments, and (c sowing depth (on soil surface and at 3 cm deep. The scarified seeds showed a germination percentage range between 50 and 64%, whereas non-scarified seeds had 9 to 16% germination. The seeds sowed in plots with or without plants of L. campestris (before the experiment germinated similarly, indicating no evidence of self-inhibition of germination. Three conclusions come out: (1 Scarification treatment with sulphuric acid effectively breaks dormancy in L. campestris seeds; (2 Direct sowing of scarified seeds (on the soil surface or at 3 cm depth resulted in a range of 50-64% of germination under field conditions; and (3 no evidence was obtained for self-inhibition or a positive interaction between preceding vegetation and seed germination of L. campestris.Lupinus campestris Schltdl. & Cham. crece en campos en descanso y
Over-expression of miR158 causes pollen abortion in Brassica campestris ssp. chinensis.
Ma, Zhiming; Jiang, Jianxia; Hu, Ziwei; Lyu, Tianqi; Yang, Yang; Jiang, Jingjing; Cao, Jiashu
2017-02-01
We identified and cloned the two precursors of miR158 and its target gene in Brassica campestris ssp. chinensis, which both had high relative expression in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility, which was caused by the degradation of pollen contents from the binucleate microspore stage. These results first suggest the role of miR158 in pollen development of Brassica campestris ssp. chinensis. MicroRNAs (miRNAs) play crucial roles in many important growth and development processes both in plants and animals by regulating the expression of their target genes via mRNA cleavage or translational repression. In this study, miR158, a Brassicaceae specific miRNA, was functionally characterized with regard to its role in pollen development of non-heading Chinese cabbage (Brassica campestris ssp. chinensis). Two family members of miR158 in B. campestris, namely bra-miR158a1 and bra-miR158a2, and their target gene bra027656, which encodes a pentatricopeptide repeat (PPR) containing protein, were identified. Then, qRT-PCR analysis and GUS-reporter system revealed that both bra-miR158 and its target gene had relatively high expression levels in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility and pollen germination ratio, and the degradation of pollen contents from the binucleate microspore stage was also found in those deformed pollen grains, which led to pollen shrinking and collapse in later pollen development stage. These results first shed light on the importance of miR158 in pollen development of Brassica campestris ssp. chinensis.
Deng, Yinyue; Wu, Jien; Yin, Wenfang; Li, Peng; Zhou, Jianuan; Chen, Shaohua; He, Fei; Cai, Jun; Zhang, Lian-Hui
2016-05-01
Diffusible signal factor (DSF) represents a new class of widely conserved quorum sensing signals, which regulates various biological functions through intra- or interspecies signaling. The previous studies identified that there is an antagonistic interaction between Xanthomonas and Bacillus species bacteria in natural ecosystem, but the detailed molecular mechanism of interspecies competition is not clear. This study showed that Xanthomonas campestris pv. campestris (Xcc) interfered with morphological transition and sporulation of Bacillus thuringiensis in mixed cultures, whereas abrogation of the DSF synthase RpfF reduced the interference. DSF inhibited B. thuringiensis cell division and sporulation through modulation of ftsZ, which encodes an important cell division protein in bacterial cells. In addition, RpfF is essential for production of six DSF-family signals in Xcc, which employ the same signaling pathways to regulate biological functions in Xcc and play similar effects on reduction of cell division, sporulation and antibiotic resistance of B. thuringiensis. Furthermore, abrogation of RpfF decreased the competitive capability of Xcc against B. thuringiensis on the surface of Chinese cabbage leaves. Our findings provide new insights into the role of DSF-family signals in interspecies competition and depict molecular mechanisms with which Xcc competes with B. thuringiensis. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Guo-Feng Jiang
2013-09-01
Full Text Available It is well known that the type III secretion system (T3SS and type III (T3 effectors are essential for the pathogenicity of most bacterial phytopathogens and that the expression of T3SS and T3 effectors is suppressed in rich media but induced in minimal media and plants. To facilitate in-depth studies on T3SS and T3 effectors, it is crucial to establish a medium for T3 effector expression and secretion. Xanthomonas campestris pv. campestris (Xcc is a model bacterium for studying plant-pathogen interactions. To date no medium for Xcc T3 effector secretion has been defined. Here, we compared four minimal media (MME, MMX, XVM2, and XOM2 which are reported for T3 expression induction in Xanthomonas spp. and found that MME is most efficient for expression and secretion of Xcc T3 effectors. By optimization of carbon and nitrogen sources and pH value based on MME, we established XCM1 medium, which is about 3 times stronger than MME for Xcc T3 effectors secretion. We further optimized the concentration of phosphate, calcium, and magnesium in XCM1 and found that XCM1 with a lower concentration of magnesium (renamed as XCM2 is about 10 times as efficient as XCM1 (meanwhile, about 30 times stronger than MME. Thus, we established an inducing medium XCM2 which is preferred for T3 effector secretion in Xcc.
International Nuclear Information System (INIS)
Chin, Ko-Hsin; Huang, Zhao-Wei; Wei, Kun-Chou; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Gao, Fei Philip; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A conserved hypothetical protein XC1692 from X. campestris pv. campestris has been overexpressed in E. coli. The purified recombinant protein crystallized in a variety of forms and diffracted to a resolution of at least 1.45 Å. Xanthomonas campestris pv. campestris strain 17 is a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. Its genome contains approximately 4500 genes, one third of which have no known structure and/or function yet are highly conserved among several different bacterial genuses. One of these gene products is XC1692 protein, containing 141 amino acids. It was overexpressed in Escherichia coli, purified and crystallized in a variety of forms using the hanging-drop vapour-diffusion method. The crystals diffract to at least 1.45 Å resolution. They are hexagonal and belong to space group P6 3 , with unit-cell parameters a = b = 56.9, c = 71.0 Å. They contain one molecule per asymmetric unit
Directory of Open Access Journals (Sweden)
Mónica A Lugo
2011-12-01
Full Text Available En ecosistemas áridos y semiáridos las raíces de las plantas suelen formar simbiosis con hongos, los que les proporcionan nutrientes y agua. Poco se conoce sobre los hongos asociados a palmeras nativas y cómo éstos podrían estar relacionados entre ellos. Se describe y cuantifica la colonización radical de los simbiontes de Trithrinax campestris en poblaciones leve y fuertemente afectadas por el fuego. T. campestris fue colonizada por hongos micorrícico-arbusculares (HMA y endófitos septados oscuros (ESO. La colonización por HMA fue del tipo intermedio entre los tipos Arum y Paris. La colonización por HMA y ESO y la producción de pelos radicales, presentó diferencias entre las poblaciones estudiadas. Los resultados sugieren que en T. campestris la relación entre hongos simbiontes/producción de pelos radicales podrían estar relacionada con su alta tolerancia al fuego y la aridez.In arid and semiarid ecosystems, roots frequently form symbiosis with fungi that provides access to nutrients and water. Knowledge regarding the study of fungal symbionts colonizing native palms roots is still scarce. We described, quantified and compared fungal colonization in roots of Trithrinax campestris from two environmental situations: population with weak-burning-signs and population with strong-burning-signs. T. campestris was colonized by arbuscular-mycorrhizal-fungi (AMF and dark-septate-endophytes (DSE. AMF colonization was an intermediate type between Arum and Paris. The AMF and DSE colonization and root hair production differed between populations. Our results suggest that in T. campestris the relation between fungal-symbionts and root-hair-production might be related to tolerance to burning and aridity.
Ayyachamy, M; Khelawan, K; Pillay, D; Permaul, K; Singh, S
2007-10-01
To access inulinase production by Xanthomonas campestris pv phaseoli using the submerged and solid state cultivation (SSC) methods. Various carbon sources, inulin-rich solid substrates and pure synthetic inulin were tested for their efficiency in inulinase induction. The highest inulinase production (17.42 IU ml(-1)) in submerged cultures of X. campestris was observed with inulin as a carbon source with an initial pH, temperature and agitation of 7.0, 37 degrees C and 150 rev min(-1) respectively. Among the various substrates, garlic peels (117 IU gds(-1)) and onion peels (101 IU gds(-1)) were found to be the best for inulinase production. The inulinase production level of X. campestris was 6.7-fold higher in garlic and 5.8-fold in onion, under optimized SSC conditions compared with the submerged culture. This is the first report on inulinase production from garlic and onion peels by X. campestris using SSC. SSC is an efficient method for inulinase production by X. campestris for commercial applications.
[Flavonoids of Artemisia campestris, ssp. glutinosa].
Hurabielle, M; Eberle, J; Paris, M
1982-10-01
Four flavanones (pinostrobin, pinocembrin, sakuranetin and naringenin), one dihydroflavonol (7-methyl aromadendrin) and one flavone (hispidulin) have been isolated from Artemisia campestris L. ssp. glutinosa Gay and identified by spectroscopic methods. Artemisia campestris L. sous-espèce glutinosa Gay est une Composée Anthémidée largement répandue sur les sables du littoral méditerranéean et abondante dans certaines régions d'Espagne et d'Italie. Dans le cadre d'une étude chimiotaxonomique du genre Artemisia Tourn., nous nous sommes intéressés à l'analyse des flavonoïdes, composés jamais décrits, à notre connaissance, dans cette espèce d' Artemisia. Les sommités fleuries d' Artemisia campestris sous-espèce glutinosa, séchées et pulvérisées, sont dégraissées à l'ether de pétrole et épuisées par le chloroforme. Le fractionnement de l'extrait chloroformique, par chromatographie sur colonne de silice, et la purification de certaines fractions conduisent à l'isolement de six génines flavoniques, à l'etat pur. L' étude des spectres UV, des spectres de masse et des spectres de RMN [1,2] et la comparaison avec des échantillons authentiques permettent de proposer, pour ces flavonoïdes, les structures de la pinostrobine [3], de la pinocembrine [4], de la sakuranétine, de la naringénine [5] (flavanones), de la méthyl-7-aromadendrine, [6, 7] (dihydroflavonol) et de l'hispiduline [8, 9] (flavone); quatre de ces génines sont méthylées. Parmi ces flavonoïdes, la pinostrobine n'a jamais été décrite, à notre connaissance, dans la famille des Composées; la pinocembrine, la sakuranétine et la naringénine ont déjà été signalées chez quelques Astéracées et Eupatoriées [10], et l'hispiduline dans la tribu des Anthémidées ( Santolina chamaecyparissus L.) [8]. Seule, la méthyl-7-aromadendrine semble décrite, à ce jour, dans le genre Artemisia Tourn. [7].
Temperature Effects on Cuscuta campestris Yunk. Seed Germination
Directory of Open Access Journals (Sweden)
Marija Sarić-Krsmanović
2013-01-01
Full Text Available Studies of biological characteristics of seeds and conditions for their germination havea major importance for planning and executing rational measures of weed control. Theaim of this study was to investigate the effect of different temperatures on germinationof C. campestris seeds. Three treatments (T1- storage at room temperature; T2 – exposureto 4°C for 30 days; T3 – scarification by concentrated sulphuric acid differing in manipulationwith seeds before germination were tested at different temperatures (5°C, 10°C, 15°C,20°C, 25°C, 30°C, 35°C, 40°C, 45°C. Germinated seeds were counted daily for ten days andthe length of seedlings was measured on the last day. The results showed that differencesin germination of C. campestris seeds were very prominent between temperatures, as wellas between treatments T1, T2 and T3. Seeds failed to germinate at 5°C and 45°C in all treatments(T1, T2, T3. Germination ranged from 6.25 at 10°C to 96.88%, the highest percentage,achieved at 30°C.
International Nuclear Information System (INIS)
Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A putative ApaG gene product from X. campestris pv. campestris was overexpressed in E. coli, purified and crystallized. The crystals diffracted to a resolution of at least 2.3 Å. Xanthomonas campestris pv. campestris is the causative agent of black rot, one of the major worldwide diseases of cruciferous crops. Its genome encodes approximately 4500 proteins, roughly one third of which have unknown function. XC2382 is one such protein, with a MW of 14.2 kDa. Based on a bioinformatics study, it was annotated as an ApaG gene product that serves multiple functions. The ApaG protein has been overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method. The crystals diffracted to a resolution of at least 2.30 Å. They are tetragonal and belong to space group P4 1/3 , with unit-cell parameters a = b = 57.6, c = 122.9 Å. There are two, three or four molecules in the asymmetric unit
DEFF Research Database (Denmark)
Mikkelsen, T.R.; Jensen, J.; Bagger Jørgensen, Rikke
1996-01-01
Different cultivars/transgenic lines of oilseed rape (Brassica napus) were crossed (as females) with different cultivars/populations of Brassica campestris. All cross combinations produced seed, with an average seed set per pollination of 9.8. Backcrossing of selected interspecific hybrids (as...... females) to B. campestris resulted in a much lower seed set, average 0.7 seed per pollination. In the single backcross progeny where a large enough population (92 plants) was obtained for analysis, 33 B. napus specific RAPD markers were investigated to determine the extent of transfer of oilseed rape...
Directory of Open Access Journals (Sweden)
ZHANG Hong-xiang
2018-02-01
Full Text Available The over-accumulation of arsenic(Asin agricultural soils affects crop growth. Subsequently, the accumulated As can pose risk to human health via food-chain. It is urgent to develop technologies to relief the As exposure stress on crop growth and lower the As uptake by crop. In this study, Trichoderma asperellum SM -12F1, capable of As resistance and speciation transformation was used as experimental material. Pot experiments were conducted to investigate the effects of inoculation on the growth of Brassica campestris L. in As-contaminated soils. The possible mechanisms of inoculation relieving As exposure stress and lowering As uptake were revealed. The results indicated that the growth of Brassica campestris L. was significantly inhibited in soils spiked with As of 120 mg· kg-1. Inoculation could significantly improve the growth of Brassica campestris L. and significantly decreased the As uptake and bioconcentration factor(BCFof Brassica campestris L. Compared with As-contaminated soils without inoculation, the As contents in the over-and under-ground part of Brassica campestris L. declined by 12.4% and 20.2%, respectively, and the BCF declined by 7.8%. Soil available As contents decreased by 15.7% after inoculation. Methylarsonic acid(MMAand dimethylarsinic acid(DMAwere detected in water extraction of soil and the shoot of Brassica campestris L. tissues, which indicated that inoculation could trigger soil As methylation and decrease soil As availability and toxicity. Furthermore, inoculation could effectively relief the As exposure stress on Brassica campestris L. growth by the response of antioxidant enzymes. The enzymes in Brassica campestris L. such as superoxide dismutase(SODand catalase(CAT, and the contents of glutathione(GSH, ascorbic acid(AsAand malondialdehyde(MDA, capable of reactive oxygen elimination, significantly enhanced during soil As exposure. However, inoculation lessened the activities or contents of SOD, CAT, GSH, and MDA
Directory of Open Access Journals (Sweden)
Tingting Liu
2018-05-01
Full Text Available Pectin methylesterase inhibitor genes (PMEIs are a large multigene family and play crucial roles in cell wall modifications in plant growth and development. Here, a comprehensive analysis of the PMEI gene family in Brassica campestris, an important leaf vegetable, was performed. We identified 100 Brassica campestris PMEI genes (BcPMEIs, among which 96 BcPMEIs were unevenly distributed on 10 chromosomes and nine tandem arrays containing 20 BcPMEIs were found. We also detected 80 pairs of syntenic PMEI orthologs. These findings indicated that whole-genome triplication (WGT and tandem duplication (TD were the main mechanisms accounting for the current number of BcPMEIs. In evolution, BcPMEIs were retained preferentially and biasedly, consistent with the gene balance hypothesis and two-step theory, respectively. The molecular evolution analysis of BcPMEIs manifested that they evolved through purifying selection and the divergence time is in accordance with the WGT data of B. campestris. To obtain the functional information of BcPMEIs, the expression patterns in five tissues and the cis-elements distributed in promoter regions were investigated. This work can provide a better understanding of the molecular evolution and biological function of PMEIs in B. campestris.
Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui
2015-01-01
Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous ad...
Li, Dong-Mei; Staehelin, Christian; Zhang, Yi-Shun; Peng, Shao-Lin
2009-09-01
The influence of Cuscuta campestris on its host Mikania micrantha has been studied with respect to biomass accumulation, physiology and ecology. Molecular events of this parasitic plant-plant interaction are poorly understood, however. In this study, we identified novel genes from M. micrantha induced by C. campestris infection. Genes expressed upon parasitization by C. campestris at early post-penetration stages were investigated by construction and characterization of subtracted cDNA libraries from shoots and stems of M. micrantha. Three hundred and three presumably up-regulated expressed sequence tags (ESTs) were identified and classified in functional categories, such as "metabolism", "cell defence and stress", "transcription factor", "signal transduction", "transportation" and "photosynthesis". In shoots and stems of infected M. micrantha, genes associated with defence responses and cell wall modifications were induced, confirming similar data from other parasitic plant-plant interactions. However, gene expression profiles in infected shoots and stems were found to be different. Compared to infected shoots, more genes induced in response to biotic and abiotic stress factors were identified in infected stems. Furthermore, database comparisons revealed a notable number of M. micrantha ESTs that matched genes with unknown function. Expression analysis by quantitative real-time RT-PCR of 21 genes (from different functional categories) showed significantly increased levels for 13 transcripts in response to C. campestris infection. In conclusion, this study provides an overview of genes from parasitized M. micrantha at early post-penetration stages. The acquired data form the basis for a molecular understanding of host reactions in response to parasitic plants.
Helping enhances productivity in campo flicker ( Colaptes campestris) cooperative groups
Dias, Raphael Igor; Webster, Michael S.; Macedo, Regina H.
2015-06-01
Reproductive adults in many bird species are assisted by non-breeding auxiliary helpers at the nest, yet the impact of auxiliaries on reproduction is variable and not always obvious. In this study, we tested Hamilton's rule and evaluated the effect of auxiliaries on productivity in the facultative cooperative breeder campo flicker ( Colaptes campestris campestris). Campo flickers have a variable mating system, with some groups having auxiliaries and others lacking them (i.e., unassisted pairs). Most auxiliaries are closely related to the breeding pair (primary auxiliaries), but some auxiliaries (secondary auxiliaries) are unrelated females that joined established groups. We found no effect of breeder quality (body condition) or territory quality (food availability) on group productivity, but the presence of auxiliaries increased the number of fledglings produced relative to unassisted pairs. Nonetheless, the indirect benefit of helping was small and did not outweigh the costs of delayed breeding and so seemed insufficient to explain the evolution of cooperative breeding in campo flickers. We concluded that some ecological constraints must limit dispersal or independent breeding, making staying in the group a "best-of-a-bad-job" situation for auxiliaries.
Kai-Huai Li; Yong-Hong Yu; Hui-Juan Dong; Wen-Bin Zhang; Jin-Cheng Ma; Hai-Hong Wang
2017-01-01
In bacteria, the metabolism of branched-chain amino acids (BCAAs) is tightly associated with branched-chain fatty acids (BCFAs) synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc) genome. We characte...
A proteomic analysis of seed development in Brassica campestri L.
Directory of Open Access Journals (Sweden)
Wenlan Li
Full Text Available To gain insights into the protein dynamics during seed development, a proteomic study on the developing Brassica campestri L. seeds with embryos in different embryogenesis stages was carried out. The seed proteins at 10, 16, 20, 25 and 35 DAP (days after pollination, respectively, were separated using two-dimensional gel electrophoresis and identities of 209 spots with altered abundance were determined by matrix-assisted laser desorption ionization time-of-flight/time-of-flight mass spectrometry (MALDI-TOF/TOF MS. These proteins were classified into 16 groups according to their functions. The most abundant proteins were related to primary metabolism, indicating the heavy demand of materials for rapid embryo growth. Besides, the high amount of proteins involved in protein processing and destination indicated importance of protein renewal during seed development. The remaining were those participated in oxidation/detoxification, energy, defense, transcription, protein synthesis, transporter, cell structure, signal transduction, secondary metabolism, transposition, DNA repair, storage and so on. Protein abundance profiles of each functional class were generated and hierarchical cluster analysis established 8 groups of dynamic patterns. Our results revealed novel characters of protein dynamics in seed development in Brassica campestri L. and provided valuable information about the complex process of seed development in plants.
International Nuclear Information System (INIS)
Tu, Zhi-Le; Li, Juo-Ning; Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Gao, Fei Philip; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A putative repressor for the multiple antibiotic resistance operon from a plant pathogen X. campestris pv. campestris has been overexpressed in E. coli, purified and crystallized. The crystals diffracted to 2.3 Å with good quality. The multiple antibiotic resistance operon (marRAB) is a member of the multidrug-resistance system. When induced, this operon enhances resistance of bacteria to a variety of medically important antibiotics, causing a serious global health problem. MarR is a marR-encoded protein that represses the transcription of the marRAB operon. Through binding with salicylate and certain antibiotics, however, MarR can derepress and activate the marRAB operon. In this report, the cloning, expression, crystallization and preliminary X-ray analysis of XC1739, a putative MarR repressor protein present in the Xanthomonas campestris pv. campestris, a Gram-negative bacterium causing major worldwide disease of cruciferous crops, are described. The XC1739 crystals diffracted to a resolution of at least 1.8 Å. They are orthorhombic and belong to space group P2 1 2 1 2 1 , with unit-cell parameters a = 39.5, b = 54.2 and c = 139.5 Å, respectively. They contain two molecules in the asymmetric unit from calculation of the self-rotation function
Growth and xanthan production of Xanthomonas campestris depending on the N-source concentration
Energy Technology Data Exchange (ETDEWEB)
Prell, A [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Lasik, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Konicek, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Sobotka, M [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Sys, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology
1995-11-01
Growth of X. campestris and production of xanthan were studied in several batch fermentations with different starting concentrations of N-source. The dependencies of growth, productivity and yields on initial N-source concentration were observed. The maximum yields in the course of cultivations were identified. (orig.)
Ding, Yongzhen; Wang, Yongjiu; Zheng, Xiangqun; Cheng, Weimin; Shi, Rongguang; Feng, Renwei
2017-08-01
This study was conducted to investigate the possibility of using a combined technology to synchronously reduce As and Cd accumulation in the edible parts of Brassica campestris. The results showed that a foliar application of selenite (Se) and silicon (Si) combined with soil ameliorants (including Ca-Mg-P fertilizer, sodium silicate and red mud) showed limited effects on the growth of B. campestris. The As concentration in the leaves of B. campestris in all treatments was below the Chinese safety standard. When sodium silicate and Ca-Mg-P fertilizer were added to the soil, the additional foliar application of Se and Si could in some cases help further reduce the concentrations of As and Cd in the leaves of B. campestris. However, when red mud was applied to the soil, the foliar application of Se and Si enhanced the Cd concentration in the leaves of B. campestris. In most cases, high levels of soil ameliorants plus foliar application of Se and Si significantly enhanced the As concentrations in both the soil solution and the roots of B. campestris but reduced the soil solution Cd concentration and the leaf As concentration. Most of the treatments reduced the thiobarbituric acid reactive substances (TBARS) concentration in the leaves of B. campestris, and the foliar application of Se and Si helped the soil ameliorants alleviate the oxidative stress resulting from As and Cd exposure. In this study, several treatments significantly increased the activities of superoxide dismutase (SOD) and ascorbate peroxidase (APX). However, the enzymes peroxidase (POD) and catalase (CAT) were not induced by most treatments. In summary, the combined treatment of 1gkg -1 Ca-Mg-P fertilizer plus foliar spraying 2mmolL -1 sodium selenite was most effective in reducing the Cd concentration and a rather strong ability to reduce the As concentration and trigger the activities of SOD and APX in the leaves of B. campestris. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Md. Tabibul Islam
2017-12-01
Full Text Available This study aimed to directly elucidate cultivar variation in disease susceptibility and disease responses in relation to hormonal status in the interaction of Brassica napus cultivars and Xanthomonas campestris pv. campestris (Xcc, the causal agent of black rot disease. Fully expanded leaves of six B. napus cultivars (cvs. Capitol, Youngsan, Saturnin, Colosse, Tamra, and Mosa were inoculated with Xcc. At 14 days post-inoculation with Xcc, cultivar variation in susceptibility or resistance was interpreted with defense responses as estimated by redox status, defensive metabolites, and expression of phenylpropanoid synthesis-related genes in relation to endogenous hormonal status. Disease susceptibility of six cultivars was distinguished by necrotic lesions in the Xcc-inoculated leaves and characterized concurrently based on the higher increase in reactive oxygen species and lipid peroxidation. Among these cultivars, as the susceptibility was higher, the ratios of abscisic acid (ABA/jasmonic acid (JA and salicylic acid (SA/JA tended to increase with enhanced expression of SA signaling regulatory gene NPR1 and transcriptional factor TGA1 and antagonistic suppression of JA-regulated gene PDF 1.2. In the resistant cultivar (cv. Capitol, accumulation of defensive metabolites with enhanced expression of genes involved in flavonoids (chalcone synthase, proanthocyanidins (anthocyanidin reductase, and hydroxycinnamic acids (ferulate-5-hydroxylase biosynthesis and higher redox status were observed, whereas the opposite results were obtained for susceptible cultivars (cvs. Mosa and Tamra. These results clearly indicate that cultivar variation in susceptibility to infection by Xcc was determined by enhanced alteration of the SA/JA ratio, as a negative regulator of redox status and phenylpropanoid synthesis in the Brasica napus–Xcc pathosystem.
Directory of Open Access Journals (Sweden)
Tóth Peter
2006-01-01
Full Text Available During 2002-2004, field surveys of field dodder (Cuscuta campestris Yunck e r in croplands were done in southwestern Slovakia. From among 150 localities surveyed, 80 were found infested by the field dodder. Within crop plants, C. campestris infested sugar beet (Beta vulgaris, alfalfa (Medicago sativa tobacco (Nicotiana tabacum, potato (Solanum tuberosum, lentil (Lens esculenta, parsley (Pastinaca sativa and onion (Allium cepa. Besides the crops, 18 weed species were also recorded. The species from the genus Polygonum (Polygonaceae were the most important and acted as a significant reservoir of field dodder in cropland. C. campestris was not found in cold climatic regions with altitude higher than 240 m. The impact of field dodder infestation on sugar beet yield was studied during the year of 2004 in two localities (Šalov and Žitavce in southwestern Slovakia. The presence of field dodder markedly reduced both, quantity and quality of sugar beet yield. Weight of heavily infested beets was reduced from 21.6 to 37.4% and sugar content from 12.0 to 15.2%. Such decline of both parameters was also recorded when field dodder was removed together with leaves of sugar beet during growing season at the end of July. The aim of the infested leaves removal was to decrease mass of field dodder seeds. Although the leaf area of sugar beet regenerates, the decrease of quality and quantity was observed. The decline was the same at both localities, no matter whether the fields were irrigated (Šalov or not (Žitavce.
Wu, Qi; Su, Nana; Chen, Qin; Shen, Wenbiao; Shen, Zhenguo; Xia, Yan; Cui, Jin
2015-01-01
Hydrogen gas (H2) was recently proposed as a therapeutic antioxidant and signaling molecule in clinical trials. However, the underlying physiological roles of H2 in plants remain unclear. In the present study, hydrogen-rich water (HRW) was used to characterize the physiological roles of H2 in enhancing the tolerance of Brassica campestris against cadmium (Cd). The results showed that both 50 μM CdCl2 and 50%-saturated HRW induced an increase of endogenous H2 in Brassica campestris seedlings, and HRW alleviated Cd toxicity related to growth inhibition and oxidative damage. Seedlings supplied with HRW exhibited increased root length and reduced lipid peroxidation, similar to plants receiving GSH post-treatment. Additionally, seedlings post-treated with HRW accumulated higher levels of reduced glutathione (GSH) and ascorbic acid (AsA) and showed increased GST and GPX activities in roots. Molecular evidence illustrated that the expression of genes such as GS, GR1 and GR2, which were down-regulated following the addition of Cd, GSH or BSO, could be reversed to varying degrees by the addition of HRW. Based on these results, it could be proposed that H2 might be an important regulator for enhancing the tolerance of Brassica campestris seedlings against Cd, mainly by governing reduced glutathione homeostasis.
International Nuclear Information System (INIS)
Bokhari, F.S.; Ahmad, S.
1996-01-01
Seed of Brassica campestris (var. Sarson) were used to study the effect of radiation of different morphological and yield parameters. Survival percentage showed drastic decrease at higher doses (75 Kr and 100 Kr). Similarly all characters showed a trend of decrease with increasing dose. LD50 for Brassica was about 50 Kr. (author)
International Nuclear Information System (INIS)
Axelrod, Herbert L.; Kozbial, Piotr; McMullan, Daniel; Krishna, S. Sri; Miller, Mitchell D.; Abdubek, Polat; Acosta, Claire; Astakhova, Tamara; Carlton, Dennis; Caruthers, Jonathan; Chiu, Hsiu-Ju; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Elias, Ylva; Feuerhelm, Julie; Grzechnik, Slawomir K.; Grant, Joanna C.; Han, Gye Won; Jaroszewski, Lukasz; Jin, Kevin K.; Klock, Heath E.; Knuth, Mark W.; Kumar, Abhinav; Marciano, David; Morse, Andrew T.; Murphy, Kevin D.; Nigoghossian, Edward; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Reyes, Ron; Rife, Christopher L.; Tien, Henry J.; Trout, Christina V.; Bedem, Henry van den; Weekes, Dana; White, Aprilfawn; Xu, Qingping; Zubieta, Chloe; Hodgson, Keith O.; Wooley, John; Elsliger, Marc-André; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.
2009-01-01
The crystal structure of an RmlC-type cupin with zinc acetate bound at the putative active site reveals significant differences from a previous structure without any bound ligand. The functional implications of the ligand-induced conformational changes are discussed. In the plant pathogen Xanthomonas campestris pv. campestris, the product of the tcmJ gene, XcTcmJ, encodes a protein belonging to the RmlC family of cupins. XcTcmJ was crystallized in a monoclinic space group (C2) in the presence of zinc acetate and the structure was determined to 1.6 Å resolution. Previously, the apo structure has been reported in the absence of any bound metal ion [Chin et al. (2006 ▶), Proteins, 65, 1046–1050]. The most significant difference between the apo structure and the structure of XcTcmJ described here is a reorganization of the binding site for zinc acetate, which was most likely acquired from the crystallization solution. This site is located in the conserved metal ion-binding domain at the putative active site of XcTcmJ. In addition, an acetate was also bound within coordination distance of the zinc. In order to accommodate this binding, rearrangement of a conserved histidine ligand is required as well as several nearby residues within and around the putative active site. These observations indicate that binding of zinc serves a functional role in this cupin protein
Directory of Open Access Journals (Sweden)
Liliana Andréa dos Santos
2008-12-01
Full Text Available Noventa isolados de Xanthomonas campestris pv. campestris (Xcc de brássicas oriundas de sistemas de produção orgânico das Zonas da Mata e Agreste de Pernambuco foram caracterizados com base na sensibilidade a antibióticos e sulfato de cobre e atividade de esterase. A maioria apresentou alta sensibilidade à tetraciclina (76,6%, eritromicina (63,3% e estreptomicina (63,3%, resistência à amoxicilina (70%, gentamicina (40,0% e norfloxacin (45,5% e média sensibilidade (44,4% ou resistência (44,4% à neomicina. Cinqüenta e cinco isolados de Xcc foram resistentes ao sulfato de cobre na concentração de 50 mg/mL e todos foram sensíveis ao produto na concentração de 200 mg/mL. Atividade de esterase foi apresentada por 92,22% dos isolados. A análise Euclidiana por ligação simples evidenciou variabilidade entre os isolados separando-os em sete grupos de similaridade. Foi estudada também a reação de 14 cultivares de brássicas à podridão-negra, utilizando o isolado "B21" de Xcc. As cultivares diferiram significativamente entre si em relação ao período de incubação, incidência e severidade final da doença. Os maiores valores de severidade final da doença foram verificados em brócolos "Ramoso", couve-flor "Bola de Neve" e "Piracicaba de Verão", e repolho "Chato de Quintal". Os híbridos de couve-chinesa "AF 70", "AF 72", "AF 69" e "AF 66" mostraram-se altamente resistentes à doença, enquanto que brócolos "Ramoso" e "Precoce Piracicaba", couve-flor "Piracicaba de Verão" e "Híbrido Cindy" e repolho "60 Dias" foram medianamente resistentes.Ninety strains of Xanthomonas campestris pv. campestris (Xcc from brassicas grown under organic farming systems in the "Mata" and "Agreste" regions of Pernambuco, Brazil, were characterized based upon sensitivity to antibiotics and copper sulfate, and esterase activity. Most of the strains showed high sensitivity to tetracycline (76.6%, erythromycin (63.3% and streptomycin (63
PECTATE LYASE-LIKE 9 from Brassica campestris is associated with intine formation.
Jiang, Jingjing; Yao, Lina; Yu, Youjian; Liang, Ying; Jiang, Jianxia; Ye, Nenghui; Miao, Ying; Cao, Jiashu
2014-12-01
Brassica campestris pectate lyase-like 9 (BcPLL9) was previously identified as a differentially expressed gene both in buds during late pollen developmental stage and in pistils during fertilization in Chinese cabbage. To characterize the gene's function, antisense-RNA lines of BcPLL9 (bcpll9) were constructed in Chinese cabbage. Self- and cross-fertilization experiments harvested half seed yields when bcpll9 lines were used as pollen donors. In vivo and in vitro pollen germination assays showed that nearly half of the pollen tubes in bcpll9 were irregular with shorter length and uneven surface. Aniline blue staining identified abnormal accumulation of a specific bright blue unknown material in the bcpll9 pollen portion. Scanning electron microscopy observation verified the abnormal outthrust material to be near the pollen germinal furrows. Transmission electron microscopy observation revealed the internal endintine layer was overdeveloped and predominantly occupied the intine. This abnormally formed intine likely induced the wavy structure and growth arrest of the pollen tube in half of the bcpll9 pollen grains, which resulted in less seed yields. Collectively, this study presented a novel PLL gene that has an important function in B. campestris intine formation. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Shikha Chandra
2007-03-01
Full Text Available The bacterial strain Mesorhizobium loti MP6, isolated from root nodules of Mimosa pudica induced growth and yield of Brassica campestris. The isolate MP6 secreted hydroxamate type siderophore in Chrom-Azurol Siderophore (CAS agar medium. Production of hydrocyanic acid (HCN, indole acetic acid (IAA and phosphate solubilizing ability was also recorded under normal growth conditions. Root hair curling was observed through simple glass-slide technique. In vitro study showed a significant increase in population of M. loti MP6 in rhizosphere due to root exudates of B. campestris. In dual culture technique the strain showed a strong antagonistic effect against Sclerotinia sclerotiorum, a white rot pathogen of Brassica campestris. The growth of S. sclerotiorum was inhibited by 75% after prolonged incubation. Efficient root colonization of mustard seedlings was confirmed by using a streptomycin-resistant marker M. loti MP6strep+. The M. loti MP6 coated seeds proved enhanced seed germination, early vegetative growth and grain yield as compared to control. Also, a drastic decline (99% in the incidence of white rot was observed due to application of M. loti MP6.A cepa bacteriana Mesorhizobium loti MP6 isolada de nódulos de raiz de Mimosa pudica induziu o crescimento e o rendimento de Brassica campestris. A cepa MP6 secretou sideróforo do tipo hidroxamato em meio sólido Chrom-Azurol Siderophore (CAS. Em condições normais de crescimento, a cepa foi também capaz de produzir de ácido cianídrico (HCN e acido indolacético (AIA e solubilizar fosfato. O encurvamento do pelo da raiz foi observado usando a simples técnica de lâmina e lamínula. Estudos in vitro mostraram um aumento significativo na população de M. loti MP6 na rizosfera devido aos exsudatos de B. campestris. Empregando-se técnica de co-cultura, a cepa mostrou um grande efeito antagônico contra o fungo Sclerotinia sclerotiorum, o patógeno da podridão branca de Brassica campestris. Ap
DEFF Research Database (Denmark)
Hauser, T.P.; Bagger Jørgensen, Rikke; Østergård, Hanne
1997-01-01
amplified polymorphic DNA analysis. Using data on the proportion of fully developed seeds and the proportion of these seeds that were hybrids, a statistical model was constructed to estimate the fitness of conspecific and heterospecific pollen and the survival of conspecific and heterospecific zygotes...... for competition between male gametophytes and/or seeds within pods. To test whether competition influences the success of hybridization, pollen from the two species was mixed in different proportions and applied to stigmas of both species. The resulting seeds were scored for paternity by isozyme and randomly...... to seeds. B. campestris pollen in B. napus styles had a significantly lower fitness than the conspecific pollen, whereas no difference between pollen types was found in B. campestris styles. Hybrid zygotes survived to significantly lower proportions than conspecific zygotes in both species, with the lowest...
Energy Technology Data Exchange (ETDEWEB)
Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia [Universidade Federal de Pelotas, RS (Brazil). Centro de Biotecnologia]. E-mail: angelita@ufpel.tche.br; claire@ufpel.tche.br; ligia@ufpel.tche.br; Galland, Griselda [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Inst. de Qumica
2001-07-01
In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The {sup 13}C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)
Dib, Ikram; Tits, Monique; Angenot, Luc; Wauters, Jean Noel; Assaidi, Asmae; Mekhfi, Hassane; Aziz, Mohammed; Bnouham, Mohammed; Legssyer, Abdelkhaleq; Frederich, Michel; Ziyyat, Abderrahim
2017-07-12
Artemisia campestris L. (Asteraceae) has many traditional uses, among which treatment of diabetes and hypertension. This study was conducted in order to confirm the antihypertensive and hypotensive effects of A. campestris L. aqueous extract (AcAE) and to explore the underlying mechanism of action of its vasorelaxant effect, besides the acute toxicity. Also, the chemical composition of AcAE was investigated. the chemical content of AcAE was determined by using HPLC and NMR techniques. The antihypertensive effect was assessed indirectly by tail-cuff method on L-NAME induced hypertensive rats, while the hypotensive action was monitored intravenously by invasive method on normotensive rats. The vasorelaxant effect and vascular mechanism of action were studied in the presence of antagonists and blockers on aorta isolated from normotensive rats. On the other side, the acute toxicity was studied by oral feeding of extract to the mice. The global phytochemical profile of AcAE reveals the presence of several polyphenols as main components. A. campestris L. infusion was characterized by mono- and di-cinnamoyl compounds, with 3,5-dicaffeoylquinic (isochlorogenic A) acid being the main compound, followed by 5-caffeoylquinic (chlorogenic) acid. Vicenin-2 (apigenin 6,8-di-C-glucoside) appeared to be the most abundant compound among flavonoids. The daily treatment with AcAE at 150mg/kg/day prevented the installation of hypertension on L-NAME hypertensive rats, and reduced SBP from 172mmHg up to 144mmHg. At the dose 40mg/kg, AcAE provoked reduction of systolic (SBP), diastolic (DBP) and mean arterial pressure (MAP), without affecting the heart rate. Also, AcAE (10 -2 -2mg/ml) relaxed the precontracted aorta by 95.8±1.3%. The denudation and preincubation of aorta with atropine, calmidazolium, L-NAME, hydroxycobalamin, ODQ, 8-RP-Br-PET-cGMP, thapsigargin and verapamil attenuated the vasorelaxant response, while the pre-treatment with 4-AP, TEA, glibenclamide and BaCl 2 did not
Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I
2014-01-01
La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...
Directory of Open Access Journals (Sweden)
Natalia Delbón
Full Text Available En el presente estudio se examinaron y compararon cuantitativamente las epidermis foliares de Flourensia campestris Griseb. y F. oolepis S. F. Blake, especies endémicas que crecen en las sierras de Córdoba, Argentina. Para ello, se seleccionaron cinco variables: número de células epidérmicas propiamente dichas, estomas, tricomas glandulares y eglandulares e índice estomático. Los resultados obtenidos se evaluaron por métodos estadísticos; ellos indican que hay diferencias significativas entre ambas especies en las variables frecuencia de estomas, de células propiamente dichas, de tricomas glandulares e índice estomático. Estos datos podrían ser de interés para su reconocimiento cuando se dispone de muestras pequeñas o fragmentos.This study provides comparative analyses of foliar epidermis in Flourensia campestris Griseb. and F. oolepis S. F. Blake, endemic species that grow in Córdoba, Argentina. Five variables were selected: number of epidermal cells, stomata, glandular and eglandular trichomes and stomatal index. Results were evaluated by statistical methods; they show that there are significant differences between the variables of both species; these data could be of interest for their identification, when only are available small samples and fragments.
Directory of Open Access Journals (Sweden)
Sava Vrbničanin
2013-01-01
Full Text Available The effect of the parasitic flowering plant known as field dodder (Cuscuta campestrisYunck. on morphological and fluorescence parameters of infested giant ragweed(Ambrosia trifida L. plants was examined under controlled conditions. The parameters ofchlorophyll fluorescence (Fo, Fv/Fm, ΦPSII, Fv, Fm, ETR and IF were measured on infested (Iand non-infested (N A. trifida plants over a period of seven days, beginning with the day ofinfestation. Morphological parameters (plant height, dry and fresh weight were measuredon the last day of fluorescence measurements. C. campestris was found to affect the height,fresh and dry weight of the infested A. trifida plants, causing significant reduction in plantheight and dry weight. Field dodder also affected several parameters of chlorophyll fluorescence(Fo, Fv/Fm, ΦPSII and Fv in infested A. trifida plants.
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke; Chen, B.Y.; Cheng, B.F.
1996-01-01
The alien C-genome chromosome in a Brassica campestris-alboglabra monosomic addition line was characterized by random amplified polymorphic DNA (RAPD) analysis. The alien chromosome carried three loci, E(c), W-c and Lap-1C, controlling synthesis of erucic acid, white flower colour and a fast...
Directory of Open Access Journals (Sweden)
Kátia Regina Freitas Schwan-Estrada
2006-06-01
Full Text Available With the use of irrigation and new hybrids of cauliflower, it is possible to get production during all the year with hight yield. However, the crop has been affected by diseases, as the dark rot caused by X. campestris pv. campestris. The objective of this research work was to study the potential of Mikania glomerata for the control of this disease. Alcoholic extract 50 ºGL of M. glomerata was evaluated regarding to: in vitro antimicrobial activity through bacterial growth in 100, 250, 500 and 1000 mg L-1 of the alcoholic extract; induction of local or systemic resistance in 25 days old cauliflower, with spray of alcoholic extract concomitantly and three days before the inoculation with the pathogen (water and bordeau mixture were used as control; peroxidases activity in leaves of cauliflower treated and not treated, and harvested concomitantly, 24, 48 and 72 hours after spraying the alcoholic extract and also after inoculation. The alcoholic extract of M. glomerata showed inhibition of the bacterial growth in vitro at the concentrations of 250, 500 and 1000 mg L-1. The concentrations of 500 mg L-1 and 1000 mg L-1 inhibited 24% and 38% of the bacterial growth. This inhibition could be due to antibacterial compounds in the alcoholic extract. An inhibition of the disease in vivo occurred only in the leaves treated with 100 and 500 mg L-1 of alcoholic extract when applied concomitantly with the bacteria. This result was similar to bordeau mixture, indicating a control by direct antimicrobial activity. There was no systemic resistence induction for all treatments. The peroxidases induction was due to infectious pathogen process and not to the treatments with alcoholic extract. The results indicate the potential of M. glomerata alcoholic extract for the preventive control of cauliflower dark rot disease.Com a prática da irrigação e novos híbridos de couve-flor, é possível produzir durante todo o ano e com alta produtividade. Mas, a cultura tem
PECTATE LYASE-LIKE10 is associated with pollen wall development in Brassica campestris.
Jiang, Jingjing; Yao, Lina; Yu, Youjian; Lv, Meiling; Miao, Ying; Cao, Jiashu
2014-11-01
PECTATE LYASE-LIKE10 (PLL10) was previously identified as one of the differentially expressed genes both in microspores during the late pollen developmental stages and in pistils during the fertilization process in Chinese cabbage (Brassica campestris ssp. chinensis). Here, antisense-RNA was used to study the functions of BcPLL10 in Chinese cabbage. Abnormal pollen was identified in the transgenic lines (bcpll10-4, -5, and -6). In fertilization experiments, fewer seeds were harvested when the antisense-RNA lines were used as pollen donor. In vivo and in vitro pollen germination assays less germinated pollen tubes were observed in bcpll10 lines. Scanning electron microscopy observation verified that the tryphine materials were over accumulated around the pollen surface and sticked them together in bcpll10. Moreover, transmission electron microscopy observation revealed that the internal endintine was overdeveloped and predominantly occupied the intine, and disturbed the normal proportional distribution of the two layers in the non-germinal furrow region; and no obvious demarcation existed between them in the germinal furrow region in the bcpll10 pollen. Collectively, this study presented a novel PLL gene that played an important role during the pollen wall development in B. campestris, which may also possess potential importance for male sterility usage in agriculture. © 2014 Institute of Botany, Chinese Academy of Sciences.
Directory of Open Access Journals (Sweden)
Clemens K. Peterbauer
2013-08-01
Full Text Available Pyranose dehydrogenase (PDH is a flavin-dependent sugar oxidoreductase that is limited to a rather small group of litter-degrading basidiomycetes. The enzyme is unable to utilize oxygen as an electron acceptor, using substituted benzoquinones and (organo metal ions instead. PDH displays a broad substrate specificity and intriguing variations in regioselectivity, depending on substrate, enzyme source and reaction conditions. In contrast to the related enzyme pyranose 2-oxidase (POx, PDHs from several sources are capable of oxidizing α- or β-1→4-linked di- and oligosaccharides, including lactose. PDH from A. xanthoderma is able to perform C-1 and C-2 oxidation, producing, in addition to lactobionic acid, 2-dehydrolactose, an intermediate for the production of lactulose, whereas PDH from A. campestris oxidizes lactose nearly exclusively at the C-1 position. In this work, we present the isolation of PDH-encoding genes from A. campestris (Ac and A. xanthoderma (Ax and a comparison of other so far isolated PDH-sequences. Secretory overexpression of both enzymes in Pichia pastoris was successful when using their native signal sequences with yields of 371 U·L−1 for AxPDH and 35 U·L−1 for AcPDH. The pure enzymes were characterized biochemically and tested for applications in carbohydrate conversion reactions of industrial relevance.
Irradiation of mushrooms (Agaricus campestris L) to extend their shelf-life
International Nuclear Information System (INIS)
Lescano, G.
1990-01-01
Mushrooms (Agaricus campestris L) were irradiated with 1.0; 2.0 and 3.0 kGy, being then stored either at 10 deg C ± 1 deg C or at room temperature (20 deg C ± 2 deg C), with the purpose of determining the most convenient condition to extend their shelf-life. It is concluded that 3.0 kGy and 10 deg C are the most suitable for that, leading to the inhibition of cap opening and stem elongation, less darkening and no evidence of fungal development until 17th day. Subsequentely almost a duplication of their shelf-life was obtained. (Author) [es
Induced polyploidization in Brassica campestris L. (Brassicaceae).
Kumar, G; Dwivedi, K
2014-01-01
Present experimental design has been made up to obtain crop with higher ploidy level via synthetic polyploidization. Since ploidy manipulation is generally associated with the obtainment of some increased enviable traits of the crop and also provides them greater adaptability to unfavorable or harsh circumstances as compared to its diploids counterparts. Thus, herein present research autotetraploids of Brassica campestris L. have been lucratively achieved by the application of colchicine. Two methods of treatment were utilized i.e. seed treatment and seedling treatment. No polyploidy could be obtained through seed treatment while seedling treatment responded well towards polyploidy. However, the status of autotetraploidy has been confirmed by cytomorphological investigations of treated plants as against its diploids counterparts. For the purpose, morphological parameters such as increased stomata size, pollen diameter, flower size, reproductive organs whereas reduction in plant height, leaf length, leaf breadth, stomata frequency, number of flowers/inflorescence etc. were appraised. Further, cytological observations were made that had clearly revealed the doubling of genome in the autotetraploids as compared to diploids. Meanwhile, pollen fertility and size of pollen grains were evaluated as well.
Tranformasi Fragmen Dna Kromosom Xanthomonas Campestris ke dalam Escherichia Coli
Directory of Open Access Journals (Sweden)
Wibowo Mangunwardoyo
2002-04-01
Full Text Available Research on DNA transformation of Xanthomonas campestris into Escherichia coli DH5αα using plasmid vector Escherichia coli (pUC19. was carried out. DNA chromosome was isolated using CTAB method, alkali lysis method was used to isolate DNA plasmid. Both of DNA plasmid and chromosome were digested using restriction enzyme EcoRI. Competent cell was prepared with CaCl2 and heat shock method for transformation procedure. The result revealed transformation obtain 5 white colonies, with transformation frequency was 1,22 x 10-8 colony/competent cell. Electrophoresis analysis showed the DNA fragment (insert in range 0.5 – 7,5 kb. Further research should be carried out to prepare the genomic library to obtain better result of transformant.
Directory of Open Access Journals (Sweden)
Areli Herrera Diaz
Full Text Available Antimicrobial peptides (AMPs are small peptides with less than 50 amino acids and are part of the innate immune response in almost all organisms, including bacteria, vertebrates, invertebrates and plants. AMPs are active against a broad-spectrum of pathogens. The inducible expression of AMPs in plants is a promising approach to combat plant pathogens with minimal negative side effects, such as phytotoxicity or infertility. In this study, inducible expression of the de-novo designed AMP SP1-1 in Micro Tom tomato protected tomato fruits against bacterial spot disease caused by Xanthomonas campestris pv. vesicatoria. The peptide SP1-1 was targeted to the apoplast which is the primary infection site for plant pathogens, by fusing SP1-1 peptide to the signal peptide RsAFP1 of radish (Raphanus sativus. The pathogen inducibility of the expression was enabled by using an optimized inducible 4XW2/4XS promoter. As a result, the tomato fruits of independently generated SP1-1 transgenic lines were significantly more resistant to X. campestris pv. vesicatoria than WT tomato fruits. In transgenic lines, bacterial infection was reduced up to 65% in comparison to the infection of WT plants. Our study demonstrates that the combination of the 4XW2/4XS cis-element from parsley with the synthetic antimicrobial peptide SP1-1 is a good alternative to protect tomato fruits against infections with X. campestris pv. vesicatoria.
Nemeth, J.; Vuurde, van J.W.L.
2006-01-01
Immunofluorescence colony-staining (IFC) is based on sample pour plating in combination with immunofluorescence staining for recognition of the target colony. IFC was optimised for detecting Xanthomonas campestris pv. vesicatoria (Xcv) and Clavibacter michiganensis subsp. michiganensis (Cmm) in
Hozumi, Akitaka; Bera, Subhankar; Fujiwara, Daiki; Obayashi, Takeshi; Yokoyama, Ryusuke; Nishitani, Kazuhiko; Aoki, Koh
2017-11-01
Stem parasitic plants (Cuscuta spp.) develop a specialized organ called a haustorium to penetrate their hosts' stem tissues. To reach the vascular tissues of the host plant, the haustorium needs to overcome the physical barrier of the cell wall, and the parasite-host interaction via the cell wall is a critical process. However, the cell wall components responsible for the establishment of parasitic connections have not yet been identified. In this study, we investigated the spatial distribution patterns of cell wall components at a parasitic interface using parasite-host complexes of Cuscuta campestris-Arabidopsis thaliana and Cuscuta japonica-Glycine max. We focused on arabinogalactan proteins (AGPs), because AGPs accumulate in the cell walls of searching hyphae of both C. campestris and C. japonica. We found more AGPs in elongated haustoria than in pre haustoria, indicating that AGP accumulation is developmentally regulated. Using in situ hybridization, we identified five genes in C. campestris that encode hyphal-expressed AGPs that belong to the fasciclin-like AGP (FLA) family, which were named CcFLA genes. Three of the five CcFLA genes were expressed in the holdfast, which develops on the Cuscuta stem epidermis at the attachment site for the host's stem epidermis. Our results suggest that AGPs are involved in hyphal elongation and adhesion to host cells, and in the adhesion between the epidermal tissues of Cuscuta and its host. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Lettuce yields can be reduced by the disease bacterial leaf spot (BLS) caused by the pathogen Xanthomonas campestris pv. vitians (Xcv) and host resistance is the most feasible method to reduce disease losses. The cultivars La Brillante, Pavane, and Little Gem express an incompatible host-pathogen in...
Directory of Open Access Journals (Sweden)
Kai-Huai Li
2017-12-01
Full Text Available In bacteria, the metabolism of branched-chain amino acids (BCAAs is tightly associated with branched-chain fatty acids (BCFAs synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc genome. We characterized gene functions in BCFAs biosynthesis and production of the diffusible signal factor (DSF family signals. Disruption of ilvC caused Xcc to become auxotrophic for valine and isoleucine, and lose the ability to synthesize BCFAs via carbohydrate metabolism. Furthermore, ilvC mutant reduced the ability to produce DSF-family signals, especially branched-chain DSF-family signals, which might be the main reason for Xcc reduction of pathogenesis toward host plants. In this report, we confirmed that BCFAs do not have major functions in acclimatizing Xcc cells to low temperatures.
International Nuclear Information System (INIS)
Hu, R.-M.; Yang, T.-C.; Yang, S.-H.; Tseng, Y.-H.
2005-01-01
Xanthomonas campestris pv. campestris (Xcc), a close relative to Pseudomonas aeruginosa, is the pathogen causing black rot in cruciferous plants. In P. aeruginosa, FleQ serves as a cognate activator of σ 54 in transcription from several σ 54 -dependent promoters of flagellar genes. These P. aeruginosa promoters have been analyzed for FleQ-binding sequences; however, no consensus was deduced. Xcc, although lacks fleSR, has a fleQ homologue residing among over 40 contiguously clustered flagellar genes. A fleQ mutant, Xc17fleQ, constructed by insertional mutation is deficient in FleQ protein, non-flagellated, and immobile. Transcriptional fusion assays on six putative σ 54 -dependent promoters of the flagellar genes, fliE, fliQ, fliL, flgG, flgB, and flhF, indicated that each of them is also FleQ dependent. Each of these promoters has a sequence with weak consensus to 5'-gaaacCCgccgCcgctTt-3', immediately upstream of the predicted σ 54 -binding site, with an imperfect inverted repeat containing a GC-rich center flanked by several A and T at 5'- and 3'-ends, respectively. Replacing this region in fliE promoter with a HindIII recognition sequence abolished the transcription, indicating that this region responds to transcription activation by FleQ
Piazza, Leonardo A; López, Daniela; Silva, Mariana P; López Rivilli, Marisa J; Tourn, Mónica G; Cantero, Juan J; Scopel, Ana L
2018-03-01
The distribution and ultrastructure of capitate glandular trichomes (GTs) in Flourensia species (Asteraceae) have been recently elucidated, but their metabolic activity and potential biological function remain unexplored. Selective nonvolatile metabolites from isolated GTs were strikingly similar to those found on leaf surfaces. The phytotoxic allelochemical sesquiterpene (-)-hamanasic acid A ((-)-HAA) was the major constituent (ca. 40%) in GTs. Although GTs are quaternary ammonium compounds (QACs)-accumulating species, glycine betaine was not found in GTs; it was only present in the leaf mesophyll. Two (-)-HAA accompanying surface secreted products: compounds 4-hydroxyacetophenone (piceol; 1) and 2-hydroxy-5-methoxyacetophenone (2), which were isolated and fully characterized (GC/MS, NMR), were present in the volatiles found in GTs. The essential oils of fresh leaves revealed ca. 33% monoterpenes, 26% hydrocarbon- and 30% oxygenated sesquiterpenes, most of them related to cadinene and bisabolene derivatives. Present results suggest a main role of GTs in determining the volatile and nonvolatile composition of F. campestris leaves. Based on the known activities of the compounds identified, it can be suggested that GTs in F. campestris would play key ecological functions in plant-pathogen and plant-plant interactions. In addition, the strikingly high contribution of compounds derived from cadinene and bisabolene pathways, highlights the potential of this species as a source of high-valued bioproducts. © 2018 Wiley-VHCA AG, Zurich, Switzerland.
Baby leaf lettuce cultivars with resistance to bacterial leaf spot (BLS) caused by Xanthomonas campestris pv. vitians (Xcv) are needed to reduce crop losses. The objectives of this research were to assess the genetic diversity for BLS resistance in baby leaf lettuce cultivars and to select early gen...
International Nuclear Information System (INIS)
Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia; Galland, Griselda
2001-01-01
In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The 13 C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)
Directory of Open Access Journals (Sweden)
C. D. Borges
2008-06-01
Full Text Available Production, viscosity, and chemical composition of xanthan synthesized by bacterium Xanthomonas campestris pv pruni strain 101 were evaluated in bioreactor systems. During the process, the volumetric oxygen mass transfer coefficient (kLa and the biomass were determined and the pH was monitored. The cultures were grown in a 3 l bioreactor, with aeration and agitation varying as follows: conditions (A 300 rpm, 3 vvm and (B 200 rpm, 2 vvm, at 28 °C. Our results showed that gum production was dependent on kLa, with a maximum yield of 8.15 g/l at 300 rpm, 3 vvm, 54 h of fermentation, kLa 21.4/h, while biomass was not affected. All aqueous solutions of 3% (w/v xanthans synthesized showed a pseudoplastic behavior. The highest viscosity was reached under the strongest aeration/agitation conditions. All xanthan samples contained glucose, mannose, rhamnose, and glucuronic acid as their main components. The highest agitation and aeration rates used under condition A (300 rpm and 3 vvm favorably influenced the yield and viscosity of the xanthan produced by bacterium X. campestris pv pruni 101 at different fermentation times.Se evaluó la producción, viscosidad y composición química del xantano sintetizado por la bacteria Xanthomonas campestris pv. pruni cepa 101 en un fermentador. Durante el proceso se controló el pH y se determinaron el coeficiente de transferencia de masa de oxígeno (kLa y la producción de masa celular seca. Los cultivos se realizaron en un fermentador de 3 l variando la aireación y la agitación, en las siguientes condiciones: (A 300 rpm, 3 vvm y (B 200 rpm, 2 vvm; a 28 °C. Nuestros resultados mostraron que la producción de goma fue dependiente del kLa, con un rendimiento máximo de 8,15 g/l a 300 rpm y 3 vvm a las 54 h de fermentación, kLa de 21,4/h, mientras que la producción de biomasa no se afectó. Todas las soluciones acuosas de xantano al 3% (m/v sintetizadas presentaron comportamiento pseudoplástico. La mayor
Peng, Wen-Huang; Chen, Yi-Wen; Lee, Meng-Shiou; Chang, Wen-Te; Tsai, Jen-Chieh; Lin, Ying-Chih; Lin, Ming-Kuem
2016-12-07
Cuscuta seeds and whole plant have been used to nourish the liver and kidney. This study was aimed to investigate the hepatoprotective activity of the ethanol extract of Cuscuta campestris Yunck. whole plant (CC EtOH ). The hepatoprotective effect of CC EtOH (20, 100 and 500 mg/kg) was evaluated on carbon tetrachloride (CCl₄)-induced chronic liver injury. Serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol were measured and the fibrosis was histologically examined. CC EtOH exhibited a significant inhibition of the increase of serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol. Histological analyses showed that fibrosis of liver induced by CCl₄ were significantly reduced by CC EtOH . In addition, 20, 100 and 500 mg/kg of the extract decreased the level of malondialdehyde (MDA) and enhanced the activities of anti-oxidative enzymes including superoxide dismutase (SOD), glutathione peroxidase (GPx) and glutathione reductase (GRd) in the liver. We demonstrate that the hepatoprotective mechanisms of CC EtOH were likely to be associated to the decrease in MDA level by increasing the activities of antioxidant enzymes such as SOD, GPx and GRd. In addition, our findings provide evidence that C. campestris Yunck. whole plant possesses a hepatoprotective activity to ameliorate chronic liver injury.
Directory of Open Access Journals (Sweden)
Wen-Huang Peng
2016-12-01
Full Text Available Cuscuta seeds and whole plant have been used to nourish the liver and kidney. This study was aimed to investigate the hepatoprotective activity of the ethanol extract of Cuscuta campestris Yunck. whole plant (CCEtOH. The hepatoprotective effect of CCEtOH (20, 100 and 500 mg/kg was evaluated on carbon tetrachloride (CCl4-induced chronic liver injury. Serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol were measured and the fibrosis was histologically examined. CCEtOH exhibited a significant inhibition of the increase of serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol. Histological analyses showed that fibrosis of liver induced by CCl4 were significantly reduced by CCEtOH. In addition, 20, 100 and 500 mg/kg of the extract decreased the level of malondialdehyde (MDA and enhanced the activities of anti-oxidative enzymes including superoxide dismutase (SOD, glutathione peroxidase (GPx and glutathione reductase (GRd in the liver. We demonstrate that the hepatoprotective mechanisms of CCEtOH were likely to be associated to the decrease in MDA level by increasing the activities of antioxidant enzymes such as SOD, GPx and GRd. In addition, our findings provide evidence that C. campestris Yunck. whole plant possesses a hepatoprotective activity to ameliorate chronic liver injury.
New high yielding mutant varieties of mustard (Brassica campestris L. var. yellow sarson)
International Nuclear Information System (INIS)
Rahman, A.; Das, M.L.; Pathan, A.J.
1992-01-01
Mutation breeding work at the Bangladesh Institute of Nuclear Agriculture has been successful with the development of a number of promising mutants and with the release of two mutant varieties of mustard (Brassica campestris L. var. Yellow Sarson), Agrani and Safal, for commercial cultivation in Bangladesh. The mutant varieties have higher seed and oil yield with higher biomass production, tolerance to Alternaria blight and aphid under field conditions. The average seed yield of the varieties is 1726 and 1754 kg/ha as compared to 1447 kg/ha of the best check Sonali. These varieties have 42-43 per cent oil in the seed. (author). 7 refs., 3 tabs
International Nuclear Information System (INIS)
Yousuf, M.; Ajmal, S.U.; Munir, M.; Ghafoor, A.
2011-01-01
One hundred fourteen accessions of rapeseed (Brassica campestris L.) were evaluated at National Agricultural Research Centre, Islamabad, Pakistan using cluster and principal component analyses during 2005 and 2006. Cluster analysis based on fifteen agro-morphological and six seed quality traits, divided 114 accessions into six and five clusters during 2005 and 2006, respectively. The first seven and five PCs with eigenvalues > 1 contributed 74.09% and 66.08% of the variability amongst accessions during 2005 and 2006, respectively. Nine important characters contributed positively to first two PCs during both the years 2005 and 2006. (author)
Behbahani, Mandana
2014-01-01
The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.
Directory of Open Access Journals (Sweden)
Mandana Behbahani
Full Text Available The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231 and normal breast cell line (MCF 10A. The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.
Directory of Open Access Journals (Sweden)
Denis de M. Diniz
2012-01-01
Full Text Available Foi estudada a otimização do processo de produção de goma xantana a partir de casca de cacau ou soro de leite como fonte de carbono, e determinou-se o rendimento da goma obtida pela bioconversão de casca de cacau e soro de leite com a Xanthomonas campestris 1182. A goma foi produzida em meios com potássio e nitrogênio a 25 °C, 250 rpm por 120 horas. Os rendimentos foram: 2,335 g.L-1 para a sacarose; 4,995 g.L-1 para a casca de cacau seca e 12,01 g.L-1 utilizando soro de leite. Portanto, é viável a produção de goma xantana utilizando fontes de carbono como a casca de cacau e o soro de leite.The optimization of the production process of xanthan gum from cocoa husks or milk whey as carbon source was studied, and the production rate of gum obtained by the bioconversion of cocoa pods and whey was determined, using Xanthomonas campestris 1182. The gum was produced in a medium with potassium and nitrogen at 25 °C, 250 rpm for 120 hours. The results were: 2.335 g.L-1 for sucrose; 4.995 g.L-1 for cocoa dry pods and 12.01 g.L-1 using whey. Therefore, the production of xanthan gum is feasible upon using carbon sources such as cocoa hulls and whey.
DEFF Research Database (Denmark)
Chan, JWYF; Maynard, Scott; Goodwin, PH
1998-01-01
A putative two-component signal transduction system was amplified and cloned from the plant pathogenic bacterium Xanthomonas campestris pv. phaseoli var. fuscans isolate BXPF65. The 620 bp amplified fragment was sequenced and analyzed with the BLAST Enhanced Alignment Utility (BEAUTY). BEAUTY...... that the putative histidine kinase has homology with conserved “transmitter” domains of sensor proteins in two-component signal transduction systems. RFLP analysis using the putative signal transduction system showed polymorphisms among the strains....
Directory of Open Access Journals (Sweden)
Adriano Márcio Freire Silva
2013-03-01
Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.Bacterial canker is caused by Xanthomonas campestris pv. viticola (Xcv. In order to eliminate Xcv from 'Red Globe' plants it was studied: optimal size of meristem tips and axillary buds for cultivation in modified Galzy's medium (MGM; effects of thermotherapy (38ºC/30 days; and action of antibiotics in the elimination of Xcv in infected grapevines. The percentages of contamination by Xcv and regeneration were analyzed and plants obtained were indexed using the semi-selective culture medium nutrient agar-dextrose-yeast extract-ampicilin (NYDAM followed by a pathogenicity test. The cultivation of 3 mm explants permitted to obtain plants free of bacteria with regeneration 14.3 times higher than 1 mm explants. The thermotherapy of infected plants associated to the in vitro culture
Directory of Open Access Journals (Sweden)
Rončević Zorana Z.
2014-01-01
Full Text Available The biocontrol agents are a very promising alternative to synthetic pesticides that are presently used to control plant diseases caused by phytopathogenic microorganisms. Members of the Bacillus genera are soil bacteria that produce significant quantities of agriculturally important bioactive compounds. Production of these compounds can be improved by changing the nutritional and environmental conditions. The aim of this study was the optimization of medium composition, using response surface methodology, for the production of compounds effective against Xanthomonas campestris ATCC 13951 by Bacillus subtilis ATCC 6633. To study the production of antimicrobial compounds by selected Bacillus strain, the producing microorganisms were cultivated on nutrient broth. The inhibition zone diameter of 18.0 mm obtained by the diffusion-disc method indicated that the used Bacillus subtilis strain produces compounds with antimicrobial activity against Xanthomonas campestris ATCC 13951. To optimize the composition of the cultivation medium in terms of glycerol, sodium nitrite and phosphates content, experiments were carried out in accordance with Box-Behnken design, and optimization of multiple responses was performed using the concept of desirability function. The developed model predicted that the maximum inhibition zone diameter (26.23 mm against tested phytopathogen is achieved when the initial content of glycerol, sodium nitrite and phosphate were 50.00 g/L, 2.85 g/L and 11.00 g/L, respectively. To minimize the consumption of medium components and costs of effluents processing, additional optimization set was made. The techno-economic analysis of the obtained results has to be done to select optimal medium composition for industrial production of antimicrobial compounds.
Behbahani, Mandana
2014-01-01
The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative ...
extraction of high quality dna from polysaccharides-secreting ...
African Journals Online (AJOL)
cistvr
A DNA extraction method using CTAB was used for the isolation of genomic DNA from ten. Xanthomonas campestris pathovars, ten isolates of Xanthomonas albilineans and one isolate of. Pseudomonas rubrisubalbicans. High quality DNA was obtained that was ideal for molecular analy- ses. Extracellular polysaccharides ...
International Nuclear Information System (INIS)
Lin, Chien-Hung; Chin, Ko-Hsin; Gao, Fei Philip; Lyu, Ping-Chiang; Shr, Hui-Lin; Wang, Andrew H.-J.; Chou, Shan-Ho
2006-01-01
A probable copper-ion tolerance protein from the plant pathogen X. campestris has been overexpressed in E. coli, purified and crystallized. Divalent metal ions play key roles in all living organisms, serving as cofactors for many proteins involved in a variety of electron-transfer activities. However, copper ions are highly toxic when an excessive amount is accumulated in a cell. CutA1 is a protein found in all kingdoms of life that is believed to participate in copper-ion tolerance in Escherichia coli, although its specific function remains unknown. Several crystal structures of multimeric CutA1 with different rotation angles and degrees of interaction between trimer interfaces have been reported. Here, the cloning, expression, crystallization and preliminary X-ray analysis of XC2981, a possible CutA1 protein present in the plant pathogen Xanthomonas campestris, are reported. The XC2981 crystals diffracted to a resolution of 2.6 Å. They are cubic and belong to space group I23, with unit-cell parameters a = b = c = 130.73 Å
International Nuclear Information System (INIS)
Javed, M.A.; Siddiqui, M.A.; Khan, M.K.R.; Khatri, A.; Khan, I.A.; Dahar, N.A.; Khanzada, M.H.; Khan, R.
2003-01-01
Homogeneous seeds of Brassica campestris L. cv. Toria selection were treated with different doses of gamma rays (750, 1000 and 1250 Gy) to induce genetic variability for the selection of new genotypes with improved agronomic traits. After passing through different stages of selection, two promising mutants were selected for further studies. Two selected mutants along with 5 other entries including parent variety were evaluated for yield and yield components in yield trials for two consecutive years. The mutant TS96-752 was significantly (P less than or equal to 0.05) superior to all other entries in grain yield but at par with FSD 86028-3
Biological control of dodder (Cuscuta campestris L. by fungi pathogens
Directory of Open Access Journals (Sweden)
F. Fallahpour
2016-04-01
Full Text Available Parasite weeds are the most important yield reducing factors, and among them dodder (Cuscuta campestris L. is an obligate parasite of many plant families. In order to find a suitable biocontrol agent for dodder a study was conducted based on a randomized complete design with four replications at research greenhouse of Faculty of Agriculture, Ferdowsi University of Mashhad, Iran during 2007-2009. Diseased dodders sampled from sugarbeet farms of Chenaran, Iran. After culturing and isolating exiting fungi from infected tissues of dodder, Fusarium sp., Alternaria sp. and Colletotrichum sp. were recognized. Inoculation of isolates was carried out with concenteration of 1×108 spores per ml sterile water at different growth stages of dodder in labratoary and greenhouse. Among different fungi, isolate of 323 of F. oxysporum showed an effective control on germination of dodder seeds and the highest level of plant pathogencity was before the contact of dodder with host and infection in older plants decreased. Infection of this isolate with crops such as sugarbeet (Beta vulgaris L., alfalfa (Medigago sativa L., basil (Ocimum basilicum L., wheat (Triticum aestivum L. and barley (Hordeum vulgare L. showed no symptoms.
International Nuclear Information System (INIS)
Sarla, N.
1988-01-01
The cross B. campestris ssp. japonica x B. oleracea var. botrytis fails due to incompatibility barrier at the stigma. To realize this cross, irradiated compatible pollen (mentor pollen) was used before the incompatible pollination. The presence of mentor pollen stimulated the incompatible pollen to germinate and effect fertilization and seed set. One hybrid was thus obtained. Most of the seeds were inviable. Of the 5 plants raised one was a hybrid and 4 resembled the female parent. 1 tab., 7 refs
Directory of Open Access Journals (Sweden)
A Ghanbari
2012-10-01
Full Text Available In order to study the germination characteristics of dodder (Cuscuta campestris under drought and salinity stress conditions, two laboratory's experiment were conducted. Experiments were conducted in completely randomized design with 4 replications. The treatments, for salinity and drought stress were six potential levels (0,-3, -6, -9, -12 and -15 bar of NaCl and five potential levels (0, -3, -6, -9 and -12 bar of PEG 6000 respectively. Results showed that increasing drought and salinity stress significantly germination rate and germination percentage, plumule and radicle length, plumule of Dodder and its radicle fresh weight decreased. However ratio of radicle to plumule and root to shoot were increased (P≤0.01. It seems that among the characters, plumule length is more sensitive to drought and salinity stresses. In addition, germination of dodder was tolernt to drought stress more than salinity stresses.
Identification and characterisation of Xanthomonas campestris pv
African Journals Online (AJOL)
Ednar Wulff
2013-02-06
Feb 6, 2013 ... Race type differentiation tests revealed the Xcc strains from Mozambique as members of race 1. ... However, differentiation of Xcc strains from closely related pathovars that are pathogenic on ..... village leadership, extension service officers and the cabbage growers in the survey area. REFERENCES.
Photosynthetic carbon fixation characteristics of fruiting structures of Brassica campestris L
International Nuclear Information System (INIS)
Singal, H.R.; Sheoran, I.S.; Singh, R.
1987-01-01
Activities of key enzymes of the Calvin cycle and C 4 metabolism, rates of CO 2 fixation, and the initial products of photosynthetic 14 CO 2 fixation were determined in the podwall, seed coat (fruiting structures), and the subtending leaf (leaf below a receme) of Brassica campestris L. cv Toria. Compared to activities of ribulose-1,5-bisphosphate carboxylase and other Calvin cycle enzymes, e.g. NADP-glyceraldehyde-3-phosphate-dehydrogenase and ribulose-5-phosphate kinase, the activities of phosphoenol pyruvate carboxylase and other enzymes of C 4 metabolism, viz. NADP-malate dehydrogenase, NADP-malic enzyme, glutamate pyruvate transaminase, and glutamate oxaloacetate transaminase, were generally much higher in seed than in podwall and leaf. Podwall and leaf were comparable to each other. Pulse-chase experiments showed that in seed the major product of 14 CO 2 assimilation was malate (in short time), whereas in podwall and leaf, the label initially appeared in 3-PGA. With time, the label moved to sucrose. In contrast to legumes, Brassica pods were able to fix net CO 2 during light. However, respiratory losses were very high during the dark period
Energy Technology Data Exchange (ETDEWEB)
Yew,W.; Fedorov, A.; Fedorov, E.; Rakus, J.; Pierce, R.; Almo, S.; Gerlt, J.
2006-01-01
Many members of the mechanistically diverse enolase superfamily have unknown functions. In this report the authors use both genome (operon) context and screening of a library of acid sugars to assign the L-fuconate dehydratase (FucD) function to a member of the mandelate racemase (MR) subgroup of the superfamily encoded by the Xanthomonas campestris pv. campestris str. ATCC 33913 genome (GI: 21233491). Orthologues of FucD are found in both bacteria and eukaryotes, the latter including the rTS beta protein in Homo sapiens that has been implicated in regulating thymidylate synthase activity. As suggested by sequence alignments and confirmed by high-resolution structures in the presence of active site ligands, FucD and MR share the same active site motif of functional groups: three carboxylate ligands for the essential Mg2+ located at the ends of th third, fourth, and fifth-strands in the (/)7-barrel domain (Asp 248, Glu 274, and Glu 301, respectively), a Lys-x-Lys motif at the end of the second-strand (Lys 218 and Lys 220), a His-Asp dyad at the end of the seventh and sixth-strands (His 351 and Asp 324, respectively), and a Glue at the end of the eighth-strand (Glu 382). The mechanism of the FucD reaction involves initial abstraction of the 2-proton by Lys 220, acid catalysis of the vinylogous-elimination of the 3-OH group by His 351, and stereospecific ketonization of the resulting 2-keto-3-deoxy-L-fuconate product. Screening of the library of acid sugars revealed substrate and functional promiscuity: In addition to L-fuconate, FucD also catalyzes the dehydration of L-galactonate, D-arabinonate, D-altronate, L-talonate, and D-ribonate. The dehydrations of L-fuconate, L-galactonate, and D-arabinonate are initiated by abstraction of the 2-protons by Lys 220. The dehydrations of L-talonate and D-ribonate are initiated by abstraction of the 2-protons by His 351; however, protonation of the enediolate intermediates by the conjugate acid of Lys 220 yields L
Directory of Open Access Journals (Sweden)
Salik Ram Gupta
2015-12-01
Full Text Available Rapeseed (Brassica campestris L. var toria is the main source of edible oil for Nepalese people. 54 rapeseed lines were collected from different hilly district of Nepal ranging from 987 m to 2550 m altitude. These lines were planted in augmented design for its traits characterization in Khumaltar 2013. Different traits of local rapeseed were characterized, and evaluated. NGRC 02778 performed better followed by SR-02 than local checks Morang-2, Chitwan Local and Unnati in terms of yield, days to maturity and pest infestation. Similarly, genotype SR-18 was late and SR-16 was earlier in terms of days to maturity. In conclusion, SR-02 was found better genotype based on different characteristics measured among all local rapeseeds planted in Khumaltar 2013. Thus SR-2 can be used as parents in crossing material for further breeding purposes and it can also be tested in further trial.
Directory of Open Access Journals (Sweden)
Marcia NITSCHKE
2001-01-01
Full Text Available A goma xantana é um polissacarídeo microbiano de grande significado comercial especialmente para a indústria de alimentos. O objetivo deste trabalho foi avaliar a produção de xantana em diferentes meios de cultura à base de soro de leite utilizando o isolado Xanthomonas campestris C7L. Dentre as formulações testadas o meio de soro de leite integral produziu maior viscosidade e concentração final de xantana. Um sistema combinando soro integral (0,35% de proteína e soro filtrado (0,18%de proteína foi proposto. Na primeira fase em soro integral a produção de xantana foi de 13g/L e 45% de rendimento,enquanto que na segunda fase utilizando-se soro filtrado obteve-se um total de 28g/L de xantana e 75% de rendimento. O rendimento geral do processo foi de 55% e a viscosidade final do meio atingiu 18000cP. As soluções de xantana produzidas em soro de leite apresentaram comportamento pseudoplástico e tixotrópico característicos deste tipo de polímero. O isolado C7L demonstrou capacidade de produzir gomas de alta viscosidade e qualidade em soro de leite, constituindo uma alternativa promissora para a produção industrial de goma xantana a partir deste subproduto.Xanthan gum is a microbial polysaccharide of great commercial interest, especially in the food industry. The aim of this work was the evaluation of xanthan gum production from different whey - based media by a lactose utilizing Xanthomonas campestris C7L isolate. Three whey media formulations were tested: unfiltered whey, filtered whey and hydrolyzed whey. The medium composed of unfiltered whey showed the highest viscosities and xanthan concentrations. A two stage fermentation strategy, combining unfiltered whey (0,35% protein and filtered whey (0,18% protein, was proposed. The first stage, using unfiltered whey medium, showed a xanthan production of 12g/L and a 45% yield. The second stage, with filtered whey addition, gave final xanthan concentration of 28g/L and a 75% yield
International Nuclear Information System (INIS)
Sittolin, I.M.
1982-04-01
A bacteriophage from the cabbage tissue infected with Xanthomonas campestris is described. The infection process is studied through a negative staining technique (PTA) and ultrathin section. The effect of Virazole, an antivirus agent, is tested. Radioautography showed that the phage presented a reasonable domain on the bacterial host genome since the beginning of the treatment. Sorological reactions indicated the induction of specific antibodies for the phage. (M.A.C.) [pt
Producão de goma xantana por X. Campestris ATCC 13951 utilizando soro de queijo desproteinado
Directory of Open Access Journals (Sweden)
Jenny Sobenes G.
2015-12-01
Full Text Available A goma xantana é um biopolímero microbiano producido pela bactéria Xanthomonas. O presente trabalho teve como objetivo estudar a produção de goma xantana por processo fermentativo utilizando a linhagem X. campestris ATCC 13951 e como fonte de carbono: soro de queijo desproteinado suplementado com extrato de levedura e sulfato de amônia como fontes de nitrogênio; soro de queijo desproteinado suplementado só com extrato de levedura como fonte de nitrogênio e só soro de queijo desproteinado sem suplementos, tempo de fermentação de 72h para os três meios. Dos meios em análise aquele constituido apenas por soro de queijo desproteinado, atingiu o maior rendimento com valor de 58% e a melhor qualidade de goma.
Directory of Open Access Journals (Sweden)
L. V. Brandão
2013-12-01
Full Text Available The production and rheological properties of xanthan gum from crude glycerin fermentation, a primary by-product of the biodiesel industry with environmental and health risks, were evaluated. Batch fermentations (28 °C/250 rpm /120 h were carried out using crude glycerin, 0.01% urea and 0.1% KH2PO4, (% w/v, and compared to a sucrose control under the same operational conditions, using Xanthomonas campestris strain 2103 isolate from Brazil. Its maximal production by crude glycerin fermentation was 7.23±0.1 g·L-1 at 120 h, with an apparent viscosity of 642.57 mPa·s, (2 % w/v, 25 °C, 25 s-1, 70% and 30% higher than from sucrose fermentation, respectively. Its molecular weight varied from 28.2 to 36.2×10(6 Da. The Ostwald-de-Waele model parameters (K and n indicated a pseudoplastic behavior at all concentrations (0.5 to 2.0 %, w/v and temperatures (25-85 °C, while its consistency index indicated promising rheological properties for drilling fluid applications. Therefore, crude glycerin has potential as a cost-effective and alternative substrate for non-food grade xanthan production.
International Nuclear Information System (INIS)
Khan, Z. I.; Ahmad, K.; Yasmeen, S.; Ashfaq, A.
2016-01-01
Considering the harmful effects of metal-enriched vegetables a comprehensive study was conducted to appraise the extent of accumulation of different metals in mustard (Brassica campestris L.). The vegetable was treated with ground water, sewage water and canal water irrigation in areas of Punjab, Pakistan. Metals and metalloids observed in all three sites treated with sewage, canal and ground water were As, Cu, Fe, Ni, Pb, Mo, Se and Zn were observed in the sites treated with ground, sewage and canal waters as well as the vegetable grown therein. The metal concentration observed in water samples was: Fe>Zn >Pb> Ni> Mo> Cu> As> Se, the order in the soil was: As >Pb> Fe > Ni > Mo > Cu > Zn > Se, while the order in the vegetable was: Zn > Fe> Cu> Ni> Mo>Pb> As> Se. The values of bio-concentration factor varied from 0.09-15.47 mg kg-1. Correlation was positively significant for Brassica campestris and soil except Ni and Se which showed positive non significant correlation. Pollution load index was observed to be in the following order: As >Pb> Ni > Mo >Fe > Cu > Se > Zn in the sites GWI, CWI and CWI. Fe and Zn (0.169) showed highest value of daily intake of metal (DIM), while Se (0.003) showed lowest value in crop of all three sites GWI, CWI and CWI. The health risk index and EF ranged from 0.24-69.86 mg day/sup -1/and 0.134-14.12 mg day/sup -1/, respectively. Overall, the vegetable treated with sewage water may have considerable impact on food quality and in turn on the health of people consuming it. (author)
Directory of Open Access Journals (Sweden)
R. Monteiro
2011-01-01
Full Text Available A produção de óleos essenciais nas plantas aromáticas é influenciada por fatores bióticos e abióticos. A demanda por esses produtos tem aumentado, sendo os óleos essenciais do gênero Mentha de grande interesse nas indústrias farmacêutica, de cosméticos, alimentícia e agrícola, principalmente em função do composto mentol. Esse trabalho teve como objetivo avaliar o efeito de três espaçamentos de plantio (0,60 x 0,15 m; 0,60 x 0,30 m e 0,60 x 0,45 m e duas épocas de colheita (60 e 90 dias após o plantio na espécie Mentha campestris Schur. O experimento foi conduzido no Centro de Estações Experimentais do Canguiri-UFPR, em Pinhais-PR, no período de janeiro a abril de 2008. O delineamento utilizado foi o de blocos ao acaso em esquema de parcelas subdivididas. Houve diferença significativa para todas as variáveis analisadas. As massas secas de folhas, ramos e total foram maiores que na primeira época. Para a biomassa seca de folhas foram observados maiores valores no menor espaçamento de plantio. O rendimento de óleo essencial foi maior na segunda época de colheita e nos espaçamentos maiores. A produtividade do óleo também foi maior na segunda época de colheita, porém no espaçamento mais adensado. Pode-se concluir como recomendação para M. campestris Schur o espaçamento 0,60 x 0,15 m e colheita aos 90 dias, por terem atingido maior biomassa, rendimento de óleo essencial e produtividade de mentol por hectare.Essential oil production in aromatic plants is influenced by biotic and abiotic factors. The demand for these products has increased, and essential oils from the genus Mentha have been of great interest for pharmaceutical, cosmetic, food and agronomic industries, especially because of the compound menthol. This study aimed to evaluate the effect of three row spaces (0.60 x 0.15 m; 0.60 x 0.30 m and 0.60 x 0.45 m and two harvest times (60 and 90 days after planting on the species Mentha campestris Schur. The
Structure of a Novel N-acetyl-L-citrulline Deacetylase from Xanthomonas campestris
Energy Technology Data Exchange (ETDEWEB)
Shi,D.; Yu, X.; Roth, L.; Tuchman, M.; Allewell, N.
2007-01-01
The structure of a novel acetylcitrulline deacetylase from the plant pathogen Xanthomonas campestris has been solved by multiple-wavelength anomalous dispersion (MAD) using crystals grown from selenomethionine-substituted protein and refined at 1.75 {angstrom} resolution. The asymmetric unit of the crystal contains one monomer consisting of two domains, a catalytic domain and a dimerization domain. The catalytic domain is able to bind a single Co(II) ion at the active site with no change in confirmation. the dimerization domain forms an interface between two monomers related by a crystallographic two-fold symmetry axis. The interface is maintained by hydrophobic interactions between helices and hydrogen bonding between two {beta} strands that form a continuous {beta} sheet across the dimer interface. Because the dimers are also related by two-fold crystallographic axes, they pack together across the crystal via the dimerization domain, suggesting that higher order oligomers may form in solution. The polypeptide fold of the monomer is similar to the fold of Pseudomonas sp. carboxypeptidase G2 and Neisseria meningitidis succinyl diaminopimelate desuccinylase. Structural comparison among these enzymes allowed modeling of substrate binding and suggests a possible catalytic mechanism, in which Glu130 functions as a bifunctional general acid-base catalyst and the metal ion polarizes the carbonyl of the acetyl group.
Xanthan biosynthesis by Xanthomonas campestris ATCC 13951 on wastewaters from white grape processing
Directory of Open Access Journals (Sweden)
Rončević Zorana
2017-01-01
Full Text Available Wastewaters from grape processing in wineries are characterized by large seasonal fluctuations in volume and composition, and are often discarded into environment with little or no treatment. The biotechnological production of valuable products is the most promising alternative for reducing the negative environmental impact and recycling these effluents. Results from previous study show that mixed winery wastewaters, after additional optimization of the medium preparation, may be a suitable raw material for industrial xanthan production. Therefore, the aim of this work was to examine the possibility of xanthan production by Xanthomonas campestris ATCC 13951 on mixed wastewaters from different stages of white grape processing in winery with initial sugars content of 20 g/L. In addition to the media characteristics and indicators of biopolymer quality, raw xanthan yield and degree of sugars conversion into product were determined in order to examine the success of performed bioprocess. The results for biopolymer yield (14.66 g/L and sugars conversion into desired product (70.21% obtained in applied experimental conditions confirm that wastewaters from white grape processing have a great potential to be used as a substrate for xanthan biosynthesis.
International Nuclear Information System (INIS)
Liao Feixiong; Yu Rangcai; Pan Ruichi
2003-01-01
The survival rate in vitro of shoot-tips of Brassica campestris L. var from seeds irradiated by 60 Co γ-rays decreased with the increase of dose. Irradiation inhibited proliferation of shoot-tip, induction of callus from cotyledons and differentiation of the callus. The age of explant contributed to the effect of irradiation in the culture. Irradiation stimulated the proliferation of shoot-tip with dose less than 50 Gy. Based on the effect of irradiation in the tissue culture, the effective dose recommended was about 200 Gy for seeds, 50-100 Gy for pre-soaked germinating seeds and 40-70 Gy for shoot-tips in vitro, respectively
Vattanaviboon, Paiboon; Whangsuk, Wirongrong; Mongkolsuk, Skorn
2003-01-01
We isolated menadione-resistant mutants of Xanthomonas campestris pv. phaseoli oxyR (oxyRXp). The oxyRR2Xp mutant was hyperresistant to the superoxide generators menadione and plumbagin and was moderately resistant to H2O2 and tert-butyl hydroperoxide. Analysis of enzymes involved in oxidative-stress protection in the oxyRR2Xp mutant revealed a >10-fold increase in AhpC and AhpF levels, while the levels of superoxide dismutase (SOD), catalase, and the organic hydroperoxide resistance protein (Ohr) were not significantly altered. Inactivation of ahpC in the oxyRR2Xp mutant resulted in increased sensitivity to menadione killing. Moreover, high levels of expression of cloned ahpC and ahpF in the oxyRXp mutant complemented the menadione hypersensitivity phenotype. High levels of other oxidant-scavenging enzymes such as catalase and SOD did not protect the cells from menadione toxicity. These data strongly suggest that the toxicity of superoxide generators could be mediated via organic peroxide production and that alkyl hydroperoxide reductase has an important novel function in the protection against the toxicity of these compounds in X. campestris. PMID:12591894
Limpeza clonal de mudas de videira infectadas por Xanthomonas campestris pv. viticola
Directory of Open Access Journals (Sweden)
Adriano Márcio Freire Silva
2013-03-01
Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.
Overexpression of stress-related genes in Cuscuta campestris in response to host defense reactions
Directory of Open Access Journals (Sweden)
Hamed Rezaei
2017-07-01
Full Text Available Herb dodder ( Cuscuta spp. is one of the most important parasitic plants that can severely affect crop yields in the world. So far, interactions of this parasitic plant with hosts were not investigated adequately. Here, we conducted a differential expression analyzes and identified a number of genes that were differentially expressed in haustorium tissue compared with the stem of Cuscuta campestris growing on Alfalfa. We obtained 439 cDNA fragments from haustoria (parasite-host connection zone and stems (25 cm away from connections zones using the cDNA-AFLP (Amplified Fragment Length Polymorphism method with eight different primer combinations. Of 439 transcript-derived fragments (TDFs that were detected, 145 fragments were identified as differentially expressed genes. Five TDF sequences were similar to known functional genes involved in signal transduction, metabolism, respiration, and stress responses. Genes encoding DEAD-box ATP-dependent RNA helicase, potential heme-binding protein, lysine-specific demethylase 5A were selected for qRT-PCR. The qRT-PCR analyzes confirmed the results obtained using cDNA-AFLP. Our findings shed light on the elicitation of dodder defense responses in the connection zone to overcome plant defense reactions.
Abutarbush, S M
2013-07-27
The objective of this observational study is to describe clinical, haematological and serum biochemical findings of horses affected with alfalfa dodder (Cuscuta campestris) toxicity. Twenty horses naturally exposed to alfalfa dodder toxicity were examined and information was collected on history and clinical signs. Physical examination was done on horses in the premises (n=20), and venous blood samples of 12 horses were submitted for haematology and serum biochemical examination for each horse. Abnormal clinical signs started around 36 hours after horses were fed the contaminated alfalfa. Abnormal signs were seen in 11 horses and those included diarrhoea (n=8), decreased appetite (n=7), neurological signs (n=4) and abdominal pain (n=1). Some horses had multiple clinical signs of the above. The results of complete blood cell count revealed leukocytopenia, neutropenia and thrombocytopenia. Serum biochemical analysis revealed decreased ALP, AST and CPK levels and increased direct bilirubin level. The used alfalfa was stopped immediately and a different alfalfa from a new container that did not contain any weeds was fed. Horses on the premises were observed closely, and the abnormal clinical signs resolved within three days. No treatment was implemented. Knowledge about toxicity of horses by Cuscuta species is scarce in the English veterinary literature and very limited.
Alleviation of Drought Stress by Nitrogen Application in Brassica campestris ssp. Chinensis L.
Directory of Open Access Journals (Sweden)
Xin Xiong
2018-05-01
Full Text Available To assess the influence of drought stress on the growth and nitrogen nutrition status of pakchoi (Brassica campestris ssp. Chinensis L. at different nitrogen (N levels, the changes in N accumulation and enzyme activities involved in N assimilation were investigated. The drought was induced by adding polyethylene glycol (PEG under hydroponic culture conditions. Pakchoi seedlings were exposed to a modified nutrient solution with different nitrogen concentration (N1, N2, and N3 represent 2, 9 and 18 mM NaNO3, respectively and osmotic potential (W1, W2 and W3 represent 0, 60 and 120 g·L−1 PEG 6000 in a full factorial, replicated randomized block design. A short time (seven days of drought stress caused a significant decline in plant water content, transpiration rate, shoot biomass and shoot nitrogen concentration. Increasing N availability considerably alleviate drought stress by increasing the content of total free amino acids in the roots, promoting the acceleration of root biomass accumulation, and improving the activities of nitrate reductase (NR; EC 1.7.1.1 and glutamine synthetase (GS; EC 6.3.1.2 which would reduce moisture limitations. The results suggested that pakchoi supplied with relative higher N had better growth performance under drought stress.
Salacia campestris root bark extract: peroxidase inhibition, antioxidant and antiradical profile
Directory of Open Access Journals (Sweden)
José Carlos Rebuglio Vellosa
2009-03-01
Full Text Available Reactive oxygen species (ROS and free radical species have been implicated in initiating or accompanying many diseases in living organisms; there is thus, a continual need for antioxidants molecules to inactivate ROS/free radicals. Many studies of plants crude extracts have demonstrated free-radical scavenging and antioxidant action. Salacia species have long been used, in several countries, as traditional medicines against certain diseases and for their anti-inflammatory properties. In this study, Salacia campestris Walp (Hippocrateaceae root bark ethanol extract (ScEtOH was assessed for its ability to scavenge free radicals and reactive oxygen species; the results were expressed as percentage inhibition of the active species. ScEtOH was efficient against studied species: DPPH radical (obtained inhibition = 30%, ABTS•+ (IC50 = 1.8±0.8 μg/mL, HOCl (IC50 = 1.7 ± 0.1 μg/mL, O2•- (obtained inhibition = 32%, and NO• (obtained inhibition = 18 %. Peroxidase activity inhibition was evaluated through the guaiacol oxidation reaction catalyzed by hemin, HRP and myeloperoxidase (MPO; data showed that ScEtOH at 10 μg/mL led to 54 and 51% of inhibition, respectively, for the hemin and HRP systems. In the MPO system, ScEtOH promoted a 50% inhibition at 8.9 μg/mL, whereas quercetin, a powerful MPO inhibitor, inhibited this system at 1.35 μg/mL.Espécies reativas do oxigênio (ERO e radicais livres estão relacionados ao início ou à exacerbação de muitas doenças em organismos vivos; existindo portanto uma necessidade contínua por moléculas antioxidantes que inativem as ERO e radicais livres. Muitos estudos com extratos brutos de plantas têm demonstrado propriedades antioxidantes e seqüestradoras de radicais livres. Espécies de Salacia são utilizadas, em muitos países, como remédio tradicional contra certas doenças e por suas propriedades antiinflamatórias. Neste estudo, o extrato bruto etanólico da casca da raiz da Salacia
International Nuclear Information System (INIS)
Watanabe, Minoru; Samejima, Shin-ichi; Hosokawa, Daijiro
1980-01-01
Accumulation of 14 C-photosynthetic assimilates in rice leaves infected with Xanthomonas campestris pv. oryzae was studied by using autoradiography for the purpose of elucidating the movement of nutrients from healthy tissues to the infected parts. When rice plants were exposed to 14 CO 2 immediately after inoculation, 14 C-photosynthetic assimilates did not accumulate in and around the inoculated spots of leaves until the lesions became visible, i.e., approximately 7 days after inoculation. When the leaves were exposed to 14 CO 2 before visible lesions appeared, 2 and 5 days after inoculation, the assimilates did not accumulate in the inoculated areas, but apparently accumulated in the lesions 24 hr later on from the exposure of leaves with visible lesions. In the newly formed lesions, accumulation site corresponded to the yellow streak parts of lesions along leaf veins. In the large and old lesions, assimilates hardly any accumulated in the center of lesions, grayish-white in color, but accumulated in the border parts of lesions adjacent to healthy tissues which are developing and yellow streak in symptoms. (author)
Directory of Open Access Journals (Sweden)
Yawei Zhang
2016-10-01
Full Text Available The present research investigated the antioxidant effect of rape (Brassica campestris L. bee pollen (RBP on salami during processing. Eight flavonoids in RBP ethanol extract were quantified by high-performance liquid chromatography-mass spectrometry (HPLC-MS analysis, and quercetin, rutin, and kaempferol were the major bioactive compounds. The RBP ethanol extract exhibited higher total antioxidant capacity than 6-hydroxy-2,5,7,8-tertramethylchromancarboxylic acid (trolox at the same concentration. The salami with 0.05% RBP extract had higher catalase (CAT, superoxide dismutase (SOD, and glutathione peroxidase (GSH-Px activities than that of the control throughout the processing time (p < 0.05. Significant decreases in peroxide value (POV and thiobarbituric acid-reactive substances (TBARS were obtained in the final salami product with 0.05% RBP ethanol extract or 1% RBP (p < 0.05. These results suggested that RBP could improve oxidative stability and had a good potential as a natural antioxidant for retarding lipid oxidation.
NITSCHKE,Marcia; RODRIGUES,Vanessa; SCHINATTO,Lisiane Fiorio
2001-01-01
A goma xantana é um polissacarídeo microbiano de grande significado comercial especialmente para a indústria de alimentos. O objetivo deste trabalho foi avaliar a produção de xantana em diferentes meios de cultura à base de soro de leite utilizando o isolado Xanthomonas campestris C7L. Dentre as formulações testadas o meio de soro de leite integral produziu maior viscosidade e concentração final de xantana. Um sistema combinando soro integral (0,35% de proteína) e soro filtrado (0,18%de prote...
Nutritive values of brassica campestris L. oil as affected by growth regulator treatments
International Nuclear Information System (INIS)
Bano, A.; Khan, N.
2009-01-01
The effects of plant growth regulators, viz. Indole acetic acid (IAA), Gibberellic acid (GA) and Abscisic acid (ABA) were studied on fatty acid compositions, glucosinolate content and protein content of Brassica campestris L subsp. Oleifera (common name yellow sarson). Growth regulators were applied in seed soaking solution as well as foliar spray during vegetative phase and at flowering stage. There were reductions in the amount of long chain fatty acids viz erucic acid, eicosenoic acid and increase in the amount of unsaturated fatty acid viz. linoleic acid by lAA applications. The stimulating effect of lAA which reduced amount of unsaturated fatty acid was more pronounced when applied as foliar spray at vegetative stage. But, foliar spray of ABA during flowering increased the concentration of linoleic acid and reduced the eicosenoic acid and erucic acid. The glucosinolate content was greater in seeds soaked in 10/sup -5/ M lAA than that of control but less in 10/sup -5/ M GA treated seeds than that of control. The ABA treatment (10/sup -5/M) increased the concentration of glucosinolates in the seeds IAA treatments (10/sup -5/M) increased the protein percentage in the seeds. Foliar application of GA (10/sup -5/M) during vegetative growth and ABA (10/sup -5/M) as seed soaking prior to sowing as well as foliar spry during flowering decreased the protein content of seeds. (author)
Kocal, Nurcan; Sonnewald, Uwe; Sonnewald, Sophia
2008-11-01
Cell wall-bound invertase (cw-Inv) plays an important role in carbohydrate partitioning and regulation of sink-source interaction. There is increasing evidence that pathogens interfere with sink-source interaction, and induction of cw-Inv activity has frequently been shown in response to pathogen infection. To investigate the role of cw-Inv, transgenic tomato (Solanum lycopersicum) plants silenced for the major leaf cw-Inv isoforms were generated and analyzed during normal growth and during the compatible interaction with Xanthomonas campestris pv vesicatoria. Under normal growth conditions, activities of sucrolytic enzymes as well as photosynthesis and respiration were unaltered in the transgenic plants compared with wild-type plants. However, starch levels of source leaves were strongly reduced, which was most likely caused by an enhanced sucrose exudation rate. Following X. campestris pv vesicatoria infection, cw-Inv-silenced plants showed an increased sucrose to hexose ratio in the apoplast of leaves. Symptom development, inhibition of photosynthesis, and expression of photosynthetic genes were clearly delayed in transgenic plants compared with wild-type plants. In addition, induction of senescence-associated and pathogenesis-related genes observed in infected wild-type plants was abolished in cw-Inv-silenced tomato lines. These changes were not associated with decreased bacterial growth. In conclusion, cw-Inv restricts carbon export from source leaves and regulates the sucrose to hexose ratio in the apoplast. Furthermore, an increased apoplastic hexose to sucrose ratio can be linked to inhibition of photosynthesis and induction of pathogenesis-related gene expression but does not significantly influence bacterial growth. Indirectly, bacteria may benefit from low invertase activity, since the longevity of host cells is raised and basal defense might be dampened.
Energy Technology Data Exchange (ETDEWEB)
Malin, E; Belden, E L; Roth, D
1985-09-01
A radioimmunoassay (RIA), an indirect competitive enzyme-linked immunosorbent assay (ELISA), and a dot-blot modification of the ELISA were evaluated for detection and identification of Xanthomonas campestris pv. phaseoli (X. c. pv. phaseoli). RIA and the dot blot tests were specific for X. c. pv. phaseoli; however, significant cross reactions occurred in the indirect competitive ELISA when using anti-X. c. pv. phaseoli antiserum against other closely related bacteria. The sensitivity level of all procedures for X. c. pv. phaseoli was approximately l0/sup 5/ colony forming unitsmL. All procedures were unsatisfactory in reliably detecting low levels of X. c. pv. phaseoli directly from extracts of bean seed. However when used in conjunction with ilution plating the dot blot assay and the RIA would be useful in specifically identifying X. c. pv. phaseoli. The relative merits of these tests for identification of X. c. pv. phaseoli are discussed.
Directory of Open Access Journals (Sweden)
Nian-Yun Yang
2013-01-01
Full Text Available Ultraperformance liquid chromatography coupled with negative electrospray tandem mass spectrometry (UPLC-ESI-MS/MS was used to determine 7 hydroxy fatty acids in the pollen of Brassica campestris L. var. oleifera DC. All the investigated hydroxy fatty acids showed strong deprotonated molecular ions [M–H]−, which underwent two major fragment pathways of the allyl scission and the β-fission of the alcoholic hydroxyl group. By comparison of their molecular ions and abundant fragment ions with those of reference compounds, they were tentatively assigned as 15,16-dihydroxy-9Z,12Z-octadecadienoic acid (1, 10,11,12-trihydroxy-(7Z,14Z-heptadecadienoic acid (2, 7,15,16-trihydroxy-9Z,12Z-octadecadienoic acid (3, 15,16-dihydroxy-9Z,12Z-octadecadienoic acid (4, 15-hydroxy-6Z,9Z,12Z-octadecatrienoic acid (5, 15-hydroxy-9Z,12Z- octadecadienoic acid (6, and 15-hydroxy-12Z-octadecaenoic acid (7, respectively. Compounds 3, 5, and 7 are reported for the first time.
Directory of Open Access Journals (Sweden)
Sun Cheng-Zhen
2014-03-01
Full Text Available Intergeneric hybrids between non-heading Chinese cabbage (Brassica campestris ssp. chinensis Makino; 2n = 4x = 40 and radish (Raphanus sativus L.; 2n = 4x = 36 were obtained through ovary culture and embryo rescue. Some hybrid embryos (0.11 per ovary were produced, but only 4 of them germinated. As most hybrid embryos failed to develop into plantlets directly, plants were regenerated by inducing shoots on the cultured cotyledon and inducing roots on the root induction medium. All hybrid plants were morphologically uniform. They resembled the non-heading Chinese cabbage in the long-lived habit, the plant status, the vernalization requirement and the petiole color, while the petiole shape, leaf venation pattern and flowers were more similar to those of radish. Upon examination of the flowers, these were found to have normal pistil, but rudimentary anthers with non-functional pollen grains. The somatic chromosome number of F1 plants was 38. Analysis of SSR banding patterns provided additional confirmation of hybridity.
Expression of the Bs2 pepper gene confers resistance to bacterial spot disease in tomato.
Tai, T H; Dahlbeck, D; Clark, E T; Gajiwala, P; Pasion, R; Whalen, M C; Stall, R E; Staskawicz, B J
1999-11-23
The Bs2 resistance gene of pepper specifically recognizes and confers resistance to strains of Xanthomonas campestris pv. vesicatoria that contain the corresponding bacterial avirulence gene, avrBs2. The involvement of avrBs2 in pathogen fitness and its prevalence in many X. campestris pathovars suggests that the Bs2 gene may be durable in the field and provide resistance when introduced into other plant species. Employing a positional cloning strategy, the Bs2 locus was isolated and the gene was identified by coexpression with avrBs2 in an Agrobacterium-mediated transient assay. A single candidate gene, predicted to encode motifs characteristic of the nucleotide binding site-leucine-rich repeat class of resistance genes, was identified. This gene specifically controlled the hypersensitive response when transiently expressed in susceptible pepper and tomato lines and in a nonhost species, Nicotiana benthamiana, and was designated as Bs2. Functional expression of Bs2 in stable transgenic tomatoes supports its use as a source of resistance in other Solanaceous plant species.
Dwivedi, Kshama; Kumar, Girjesh
2015-01-01
We have performed the present piece of work to evaluate the effect of synthetic food coloring azo dye (sunset yellow) on actively dividing root tip cells of Brassica campestris L. Three doses of azo dye were administered for the treatment of actively dividing root tip cells, namely, 1%, 3%, and 5%, for 6-hour duration along with control. Mitotic analysis clearly revealed the azo dye induced endpoint deviation like reduction in the frequency of normal divisions in a dose dependent manner. Mitotic divisions in the control sets were found to be perfectly normal while dose based reduction in MI was registered in the treated sets. Azo dye has induced several chromosomal aberrations (genotoxic effect) at various stages of cell cycle such as stickiness of chromosomes, micronuclei formation, precocious migration of chromosome, unorientation, forward movement of chromosome, laggards, and chromatin bridge. Among all, stickiness of chromosomes was present in the highest frequency followed by partial genome elimination as micronuclei. The present study suggests that extensive use of synthetic dye should be forbidden due to genotoxic and cytotoxic impacts on living cells. Thus, there is an urgent need to assess potential hazardous effects of these dyes on other test systems like human and nonhuman biota for better scrutiny.
Energy Technology Data Exchange (ETDEWEB)
Siman, A; Cradock, F W; Hudson, A W
1974-08-01
Manganese levels and pH in soil were measured on limed and unlimed plots at bi-monthly intervals for two years at five field sites with lucerne (Medicago sativa) and subterranean clover (Trifolium subterraneum) and related to rainfall and temperature. Pot experiments with lucerne, subterranean clover and rape (Brassica campestris) were used to confirm the results of the field experiments. Manganese toxicity developed in lucerne and subterranean clover under waterlogged conditions after heavy rain on the slightly acid soils (pH 4.7-5.5). Lucerne also showed manganese toxicity on the same soils in summer after extended hot, dry conditions. The maximum available manganese was 210 ..mu..g/g in the waterlogged soil (0-15 cm) the 128 ..mu..g/g in the heat affected soil. Lime treatment of 2240 kg/ha reduced the maximum available manganese to 148 ..mu..g/g in waterlogged plots and to 47 ..mu..g/g in the heat affected plots but failed to correct manganese toxicity. However, lime corrected toxicity symptoms under less severe conditions. In the pot experiments, available manganese reached 270 ..mu..g/g after 2 weeks artificial waterlogging and 68 ..mu..g/g after 2 weeks dry heat exposure. 12 references, 4 figures, 3 tables.
GERMINATION TEST IN SEEDS OF MELOTHRIA CAMPESTRIS (NAUDIN H. SCHAEF. & S.S. RENNER
Directory of Open Access Journals (Sweden)
ANA CARINA DA SILVA CÂNDIDO
2016-01-01
Full Text Available The Cerrado occupies 25% of the Brazilian territory and is the second largest biome in South America, second only to the Amazon Rainforest. Hence, studies on the native species of the Cerrado are important for implementing conservation strategies. In this context, knowledge of the requirements and conditions for germination of seeds of these native species is essential. The Cerrado watermelon ( Melothria campestris (Naudin H. Schaef. & S.S. Renner is a plant that is not cultivated, but has been used in revegetation projects in the countryside of the Cerrado because its fruits are fed upon by fauna in times of food shortage. The purpose of this study was to determine the most appropriate methodology for the germination of the Cerrado watermelon, by identifying the best - suited substrate, the optimal temperature, and the corresponding time taken for germination . The treatments consisted of four substrates: in a paper roll, on paper, in sand, and on sand; and four temperatures: 20, 25, and 30 °C (maintained constant, and a fourth temperature treatment that alternated 20 - 30 °C. The effect of the substrates and temperatures on seed performance was evaluated using the germination test, speed index, and average time for germination. The experimental design was fully randomized, with treatments distributed in a 4 × 4 (substrates × temperatures factorial scheme, with four replications. Our results show that the temperature of 20 °C had a negative influence on germination in all substrates. Further, we found that the germination of the Cerrado watermelon seeds was best in a paper roll or on sand substrate, maintained at a constant temperature of 30 °C, or when temperature was alternated 20 - 30 °C, and the time required for germination stabilization was 30 days.
International Nuclear Information System (INIS)
Yoon, Ho-Sung; Lee, In-Ae; Lee, Hyoshin; Lee, Byung-Hyun; Jo, Jinki
2005-01-01
Glutathione reductase (GR) plays an essential role in a cell's defense against reactive oxygen metabolites by sustaining the reduced status of an important antioxidant glutathione. We constructed a recombinant plasmid based on the expression vector pET-18a that overexpresses a eukaryotic GR from Brassica campestris (BcGR) in Escherichia coli. For comparative analyses, E. coli GR (EcGR) was also subcloned in the same manner. The transformed E. coli with the recombinant constructs accumulated a high level of GR transcripts upon IPTG induction. Also, Western blot analysis showed overproduction of the BcGR protein in a soluble fraction of the transformed E. coli extract. When treated with oxidative stress generating reagents such as paraquat, salicylic acid, and cadmium, the BcGR overproducing E. coli exhibited a higher level of growth and survival rate than the control E. coli strain, but it was not as high as the E. coli strain transformed with the inducible EcGR. The translated amino acid sequences of BcGR and EcGR share 37.3% identity but all the functionally known important residues are conserved. It appears that eukaryotic BcGR functions in a prokaryotic system by providing protection against oxidative damages in E. coli
Tripathi, Ruchika; Agrawal, S B
2012-11-01
Tropospheric ozone (O(3)) has become a serious threat to growth and yield of important agricultural crops over Asian regions including India. Effect of elevated O(3) (ambient+10ppb) was studied on Brassica campestris L. (cv. Sanjukta and Vardan) in open top chambers under natural field conditions. Eight hourly mean ambient O(3) concentration varied from 26.3ppb to 69.5ppb during the growth period. Plants under O(3) exposure showed reductions in photosynthetic rate, reproductive parameters, yield as well as seed and oil quality. Cultivar Sanjukta showed more reduction in photosynthetic characteristics, reproductive structures and seed and oil quality. However, total yield was more affected in Vardan. Exposure of O(3) increased the degree of unsaturation and level of PUFA, ω-6fatty acid, linolenic acid and erucic acid in oil indicating the deterioration of its quality. The study further confirmed that there is a correspondence between O(3) induced change in photosynthetic processes, reproductive development and yield and did not find any compensatory response in the final yield. Copyright © 2012 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Rosa Navarrete
2000-01-01
Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas
International Nuclear Information System (INIS)
Fayyaz, L.; Farhatullah, A.; Iqbal, S.; Kanwal, M.; Nawaz, I.
2014-01-01
Genetic diversity and relationship of F2 segregating progenies of interspecific crosses between B. napus N-501/B. campestris C-118 were studied. A set of 90 genotypes (2 parental lines and their 88 F2 progenies) was characterized separately using 24 microsatellite or SSR markers to cover the diversity as broadly as possibly present in them. In initial screening only 12 out of 24 SSR primers combination amplified DNA fragments, while the remaining 12 SSR primers did not amplify DNA fragment therefore those 12 SSR molecular markers were not used for further analysis. The 12 SSR primer combinations generated a total of 33 alleles, of that 32 were polymorphic loci, whereas only one was monomorphic locus. Primers BRMS-19 and BRMS-40 were highly polymorphic producing 4 bands each. Primer Ra2-D04 was less polymorphic and it produced only one band. The proportion of polymorphic loci was 95.83% which indicates high genetic diversity among the progenies. The average number of polymorphic alleles per locus was 2.66. The PIC values ranged from 0.395 for primer Ra2-E03 to 0.726 for primer BRMS-019 with an average genetic diversity (PIC value) of 0.584 per locus. Seven primers showed PIC values above 0.5 (50%) indicating high genetic diversity in the studied plant materials. Pair-wise similarity indices among 90 genotypes ranged from 0.3 to 0.95. Dendrogram obtained through UPGMA clustering of F2 progenies depicted eight main groups using similarity coefficient of 0.70. The progenies could be similar to their parents if they have the same banding patterns as that of the parents and could be distinguished from each other by the combination of fragments which are repeatedly present in one progeny and absent in the other. Considerable genetic diversity has been found among the F2 segregating progenies and their parents using SSR markers thus, SSR analysis proved to be a useful tool. (author)
International Nuclear Information System (INIS)
Watanabe, Minoru; Samejima, Shin-ichi; Hayashi, Nobuo; Hosokawa, Daijiro
1980-01-01
The translocation and accumulation of 14 C-photosynthetic assimilates in rice plants infected with Xanthomonas campestris pv. oryzae were investigated. Approximately the same quantities of assimilates were detected in healthy and infected leaves 1 day after photosynthesis, but 1.7 times as much as healthy leaves assimilates were still remained in infected leaves 7 days after photosynthesis. Much more 14 C-photosynthetic assimilates were generally detected in leaf blade than in leaf sheath or in root within 1 day after photosynthesis, but detected in leaf sheath than in leaf blade later than 2 days after photosynthesis. The rates of translocation of 14 C-assimilates from leaf blade to leaf sheath were lower in inoculated rice plants than in healthy ones. In both healthy and inoculated leaves of susceptible and resistant cultivars, there was a tendency that 14 C-sugar contents decreased, but 14 C-organic acid and -amino acid contents increased gradually after photosynthesis. Incorporation of 14 C-photosynthetic assimilates into invading bacterial cells which were separated from leaf tissues by the methods of leakage and Millipore filtration was not detected immediately after photosynthesis, but became apparent 5 days after photosynthesis. The leakage of 14 C-photosynthetic assimilates from leaf tissues into bathing solution was about 4 times higher in infected leaves than in healthy ones 5 days after photosynthesis, suggesting that the permeability in infected leaf tissues would increase. (author)
International Nuclear Information System (INIS)
Sarwar, M.; Ahmad, N.; Khan, G.Z.; Tofique, M.
2009-01-01
The exploitation of resistant cultivars is an imperative, simple, practical and flexible way to cope with insect pests incidence. Thirty genotypes of mustard (Brassica campestris L.) were tested for their resistance and susceptibility to aphid Myzus persicae (Sulzer) exposed under natural field conditions. Data on pest tolerance of genotypes were judged by quantitative traits such as number of aphids on each infested plant and mean dry weight of seeds per genotype. Studies observed the discrepancy in overall rates of pest invasion and seed yield contained by trailed mustard genotypes. Agati sarson (P), S-9-S-97-100/45 and S-9-S-97-100/45 were the least damaged genotypes showing their moderate resistance. Amongst other genotypes, MM-I/01-5, MM-I285 and MM-I/01-6 were the most damaged showing oversensitive response. Although the majority of genotypes were found vulnerable to pest, Agati sarson (P) and S-9-S-97-100/45 due to their lowest hypersensitive response toward aphid contamination and increased pods yield could be used for the development of essential resistance in mustard plant. A marked mode of damage inflicted by aphid on the crop was noticed and the abiotic factors contributing variations in aphid infestation levels during both growing seasons were determined. Knowledge about the host plant resistance investigated can facilitate growers to choose the most appropriate cultivars as pest control strategy. (author)
International Nuclear Information System (INIS)
Naqvi, S.F.; Haq, M.I.U.; Tahir, M.I.; Khan, M.A.; Ali, Z.
2013-01-01
Isolates of Xanthomonas campestris (Pammel) Dawson pv. sesami (Xcs) were collected from various locations in Pakistan and were characterized using several biochemical tests including; (KOH) string test, gram staining, H/sub 2/S production, catalase activity, oxidation/fermentation of glucose, oxidase activity and nitrate reduction. The isolates were positive in tests for KOH string assay, H/sub 2/S, catalase and showed negative reactions in gram staining, oxidase test and nitrate reduction while oxidative utilization of glucose was observed. To develop biological control for the pathogen we isolated numerous bacteria from the rhizosphere of sesame plants and screened them for antagonism against the pathogen using the zone inhibition method. Out of 87 isolates, 9 isolates were inhibitory to the pathogen in vitro. Pseudomonas fluorescens ID-3 exhibited the highest zone of inhibition i.e. 7.97mm. All antagonistic isolates were tested for disease control under greenhouse conditions. Four sesame lines that were found to be moderately resistant in previous studies (i.e. 95001, 96007, 96019, and 20003) were selected for evaluating biocontrol efficacy. The isolates were found to control the disease and reduced severity to 3% compared to untreated plants. The isolate P. fluorescens ID-3 was considered to provide the best disease control with each cultivar. Average biocontrol efficiency (BE) of ID-3 was 78.25% while the best BE was obtained in line 96019, i.e. 81%. (author)
Directory of Open Access Journals (Sweden)
Janine Kirchberg
Full Text Available The aerobic plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv colonizes the intercellular spaces of pepper and tomato. One enzyme that might contribute to the successful proliferation of Xcv in the host is the iron-sulfur protein aconitase, which catalyzes the conversion of citrate to isocitrate in the tricarboxylic acid (TCA cycle and might also sense reactive oxygen species (ROS and changes in cellular iron levels. Xcv contains three putative aconitases, two of which, acnA and acnB, are encoded by a single chromosomal locus. The focus of this study is aconitase B (AcnB. acnB is co-transcribed with two genes, XCV1925 and XCV1926, encoding putative nucleic acid-binding proteins. In vitro growth of acnB mutants was like wild type, whereas in planta growth and symptom formation in pepper plants were impaired. While acnA, XCV1925 or XCV1926 mutants showed a wild-type phenotype with respect to bacterial growth and in planta symptom formation, proliferation of the acnB mutant in susceptible pepper plants was significantly impaired. Furthermore, the deletion of acnB led to reduced HR induction in resistant pepper plants and an increased susceptibility to the superoxide-generating compound menadione. As AcnB complemented the growth deficiency of an Escherichia coli aconitase mutant, it is likely to be an active aconitase. We therefore propose that optimal growth and survival of Xcv in pepper plants depends on AcnB, which might be required for the utilization of citrate as carbon source and could also help protect the bacterium against oxidative stress.
Qing, Xuejiao; Zhao, Xiaohu; Hu, Chengxiao; Wang, Peng; Zhang, Ying; Zhang, Xuan; Wang, Pengcheng; Shi, Hanzhi; Jia, Fen; Qu, Chanjuan
2015-04-01
The beneficial role of selenium (Se) in alleviation of chromium (Cr)-induced oxidative stress is well established. However, little is known about the underlying mechanism. The impacts of exogenous Se (0.1mg/L) on Cr(1mg/L)-induced oxidative stress and antioxidant systems in leaves of cabbage (Brassica campestris L. ssp. Pekinensis) were investigated by using cellular and biochemical approaches. The results showed that supplementation of the medium with Se was effective in reducing Cr-induced increased levels of lipid peroxides and superoxide free radicals (O(-)2(·)), as well as increasing activities of superoxide dismutase (SOD) and peroxidase (POD). Meanwhile, 1mg/L Cr induced loss of plasma membrane integrity, growth inhibition, as well as ultrastructural changes of leaves were significantly reversed due to Se supplementation in the medium. In addition, Se application significantly altered the subcellular distribution of Cr which transported from mitochondria, nucleus and the cell-wall material to the soluble fraction and chloroplasts. However, Se application did no significant alteration of Cr effects on osmotic adjustment accumulating products. The study suggested that Se is able to protect leaves of cabbage against Cr toxicity by alleviation of Cr induced oxidative stress, and re-distribution of Cr in the subcellular of the leaf. Furthermore, free radicals, lipid peroxides, activity of SOD and POD, and subcellular distribution of Cr can be considered the efficient biomarkers to indicate the efficiency of Se to detoxification Cr. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
S.M Seyyedi
2016-05-01
Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without
International Nuclear Information System (INIS)
Sarwar, M.
2013-01-01
Field evaluation of twenty three Brassica campestris L. genotypes was conducted for aphid (Homoptera: Aphididae) resistance during 2008 crop season. The parameters used to assess tolerance of germplasm lines included pest population during growth season and grain yield at crop maturity. Aphids showed obvious preferences for all of the germplasm investigated; however, the evaluation for resistance to pest identified several genotypes with variable potential for tolerance and sensitivity. Estimated grain yield also varied significantly due to variable pest intensity noted, and seemed to be more appropriately dependent on the pest population conditions at the experimental site. Among the germplasm, the estimation obtained regarding both the parameters sorted out MM-II/02-3 and MM-I285 genotypes as most tolerant due to less pest infestation and damage. Peak infestations by aphid caused severe crop fatalities on S-9-S-97-0.75+75/55 and S-9-1006/95 genotypes, affecting the seed weight and resulting an immense reduction in grain Brassica genotypes appeared to be governed by means of varietals characteristics of diverse germplasms. The result of resistance test conducted under field environment is an effective and consistent approach in the practical selection of crop lines resistant or partially resistant to pests for use in future breeding programs. (author)
Bi, Hongkai; Yu, Yonghong; Dong, Huijuan; Wang, Haihong; Cronan, John E.
2014-01-01
SUMMARY In Xanthomonas campestris pv. campestris (Xcc), the proteins encoded by the rpf (regulator of pathogenicity factor) gene cluster produce and sense a fatty acid signal molecule called diffusible signaling factor (DSF, 2(Z)-11-methyldodecenoic acid). RpfB was reported to be involved in DSF processing and was predicted to encode an acyl-CoA ligase. We report that RpfB activates a wide range of fatty acids to their CoA esters in vitro. Moreover, RpfB can functionally replace the paradigm bacterial acyl-CoA ligase, Escherichia coli FadD, in the E. coli β-oxidation pathway and deletion of RpfB from the Xcc genome results in a strain unable to utilize fatty acids as carbon sources. An essential RpfB function in the pathogenicity factor pathway was demonstrated by the properties of a strain deleted for both the rpfB and rpfC genes. The ΔrpfB ΔrpfC strain grew poorly and lysed upon entering stationary phase. Deletion of rpfF, the gene encoding the DSF synthetic enzyme, restored normal growth to this strain. RpfF is a dual function enzyme that synthesizes DSF by dehydration of a 3-hydroxyacyl-acyl carrier protein (ACP) fatty acid synthetic intermediate and also cleaves the thioester bond linking DSF to ACP. However, the RpfF thioesterase activity is of broad specificity and upon elimination of its RpfC inhibitor RpfF attains maximal activity and its thioesterase activity proceeds to block membrane lipid synthesis by cleavage of acyl-ACP intermediates. This resulted in release of the nascent acyl chains to the medium as free fatty acids. This lack of acyl chains for phospholipid synthesis results in cell lysis unless RpfB is present to counteract the RpfF thioesterase activity by catalyzing uptake and activation of the free fatty acids to give acyl-CoAs that can be utilized to restore membrane lipid synthesis. Heterologous expression of a different fatty acid activating enzyme, the Vibrio harveyi acyl-ACP synthetase, replaced RpfB in counteracting the effects of
Are herbicide-resistant crops the answer to controlling Cuscuta?
Nadler-Hassar, Talia; Shaner, Dale L; Nissen, Scott; Westra, Phill; Rubin, Baruch
2009-07-01
Herbicide-resistant crop technology could provide new management strategies for the control of parasitic plants. Three herbicide-resistant oilseed rape (Brassica napus L.) genotypes were used to examine the response of attached Cuscuta campestris Yuncker to glyphosate, imazamox and glufosinate. Cuscata campestris was allowed to establish on all oilseed rape genotypes before herbicides were applied. Unattached seedlings of C. campestris, C. subinclusa Durand & Hilg. and C. gronovii Willd. were resistant to imazamox and glyphosate and sensitive to glufosinate, indicating that resistance initially discovered in C. campestris is universal to all Cuscuta species. Glufosinate applied to C. campestris attached to glufosinate-resistant oilseed rape had little impact on the parasite, while imazamox completely inhibited C. campestris growth on the imidazolinone-resistant host. The growth of C. campestris on glyphosate-resistant host was initially inhibited by glyphosate, but the parasite recovered and resumed growth within 3-4 weeks. The ability of C. campestris to recover was related to the quality of interaction between the host and parasite and to the resistance mechanism of the host. The parasite was less likely to recover when it had low compatibility with the host, indicating that parasite-resistant crops coupled with herbicide resistance could be highly effective in controlling Cuscuta. (c) 2009 by John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Suresh Shastry
2005-03-01
Full Text Available An extracellular cell lytic enzyme from Pseudomonas sp. was active on heat killed cells of Xanthomonas campestris. The lytic activity caused enzymatic digestion of X.campestris xanthan gum. Digestion was effective for highly viscous native xanthan 2.0% (w/v and 2.5% (w/v commercial Sigma xanthan. Scanning electron microscopy and SDS-PAGE observations confirmed the cell lytic action on X.campestris cells.Uma enzima extracelular celulolítica produzida por Pseudomonas sp. foi ativa sobre células de Xanthomonas campestris mortas pelo calor. A atividade lítica causou a digestão enzimática de goma xantana de X. campestris. A digestão foi eficiente tanto para xantana nativa altamante viscosa (2,0% w/v como para xantana comercial Sigma (2,5% w/v. Observações por microscopia eletrônica de varredura demonstraram a ação celulolítica sobre células de X. campestris.
International Nuclear Information System (INIS)
Singh, Poonam; Agrawal, Madhoolika; Agrawal, Shashi Bhushan
2009-01-01
A field study was conducted to evaluate the impact of ambient ozone on mustard (Brassica campestris L. var. Kranti) plants grown under recommended and 1.5 times recommended NPK doses at a rural site of India using filtered (FCs) and non-filtered open top chambers (NFCs). Ambient mean O 3 concentration varied from 41.65 to 54.2 ppb during the experiment. Plants growing in FCs showed higher photosynthetic rate at both NPK levels, but higher stomatal conductance only at recommended NPK. There were improvements in growth parameters and biomass of plants in FCs as compared to NFCs at both NPK levels with higher increments at 1.5 times recommended. Seed yield and harvest index decreased significantly only at recommended NPK in NFCs. Seed quality in terms of nutrients, protein and oil contents reduced in NFCs at recommended NPK. The application of 1.5 times recommended NPK provided protection against yield loss due to ambient O 3 . - NPK level above recommended alleviates the adverse effects of ambient ozone on a tropical mustard cultivar
Energy Technology Data Exchange (ETDEWEB)
Singh, Poonam [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India); Agrawal, Madhoolika [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India)], E-mail: madhoo58@yahoo.com; Agrawal, Shashi Bhushan [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India)
2009-03-15
A field study was conducted to evaluate the impact of ambient ozone on mustard (Brassica campestris L. var. Kranti) plants grown under recommended and 1.5 times recommended NPK doses at a rural site of India using filtered (FCs) and non-filtered open top chambers (NFCs). Ambient mean O{sub 3} concentration varied from 41.65 to 54.2 ppb during the experiment. Plants growing in FCs showed higher photosynthetic rate at both NPK levels, but higher stomatal conductance only at recommended NPK. There were improvements in growth parameters and biomass of plants in FCs as compared to NFCs at both NPK levels with higher increments at 1.5 times recommended. Seed yield and harvest index decreased significantly only at recommended NPK in NFCs. Seed quality in terms of nutrients, protein and oil contents reduced in NFCs at recommended NPK. The application of 1.5 times recommended NPK provided protection against yield loss due to ambient O{sub 3}. - NPK level above recommended alleviates the adverse effects of ambient ozone on a tropical mustard cultivar.
Directory of Open Access Journals (Sweden)
Sarić-Krsmanović Marija
2017-01-01
Full Text Available Several bacterial cultures: Bacillus licheniformis (MO1, B. pumilus (MO2, and B. amyloliquefaciens (MO3, isolated from manure; B. megatherium ZP6 (MO4 isolated from maize rhizosphere; Azotobacter chroococcum Ps1 (MO5 and Pseudomonas fluorescens (MO6, were used to test the influence of plant growth promoting rhizobacteria (PGPR on seed germination and germination rate of field dodder (Cuscuta campestris Yunk.. Also, to examine the effect of host seeds on germination and initial growth of seedlings of field dodder plants in the dark and under white light, the seeds of four host plants were used (watermelon, red clover, alfalfa and sugar beet. Germinated seeds were counted daily over a ten-day period and the length of seedlings was measured on the final day. The results show that treatments MO3, MO4 and MO6 had inhibitory effects (15%, 65% and 52%, respectively, while treatments MO1, MO2 and MO5 had stimulating effects (3%, 3% and 19%, respectively on seed germination of field dodder. The data for host seeds show that light was a significant initial factor (83-95%, control 95% for stimulating seed germination of field dodder plants, apart from host presence (73-79%, control 80%.
Harbaum, Britta; Hubbermann, Eva Maria; Wolff, Christian; Herges, Rainer; Zhu, Zhujun; Schwarz, Karin
2007-10-03
Twenty-eight polyphenols (11 flavonoid derivatives and 17 hydroxycinnamic acid derivatives) were detected in different cultivars of the Chinese cabbage pak choi ( Brassica campestris L. ssp. chinensis var. communis) by HPLC-DAD-ESI-MS(n). Kaempferol was found to be the major flavonoid in pak choi, glycosylated and acylated with different compounds. Smaller amounts of isorhamnetin were also detected. A structural determination was carried out by (1)H and (13)C NMR spectroscopy for the main compound, kaempferol-3-O-hydroxyferuloylsophoroside-7-O-glucoside, for the first time. Hydroxycinnamic acid derivatives were identified as different esters of quinic acid, glycosides, and malic acid. The latter ones are described for the first time in cabbages. The content of polyphenols was determined in 11 cultivars of pak choi, with higher concentrations present in the leaf blade than in the leaf stem. Hydroxycinnamic acid esters, particularly malic acid derivatives, are present in both the leaf blade and leaf stem, whereas flavonoid levels were determined only in the leaf blade.
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available thomonas ... campestris pv. campestris str. ATCC 33913] ... Length = 247 ... Query: 49 ... LNPFVPVQF...PLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY 108 ... LNPFVPVQFPLKLV...DRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY Sbjct: 1 ... LNPFVPVQFPLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQY
Paz, Tiago Antunes; dos Santos, Vânia A F F M; Inácio, Marielle Cascaes; Pina, Edieidia Souza; Pereira, Ana Maria Soares; Furlan, Maysa
2013-01-01
Establishment of adventitious root cultures of Peritassa campestris (Celastraceae) was achieved from seed cotyledons cultured in semisolid Woody Plant Medium (WPM) supplemented with 2% sucrose, 0.01% PVP, and 4.0 mg L⁻¹ IBA. Culture period on accumulation of biomass and quinone-methide triterpene maytenin in adventitious root were investigated. The accumulation of maytenin in these roots was compared with its accumulation in the roots of seedlings grown in a greenhouse (one year old). A rapid detection and identification of maytenin by direct injection into an atmospheric-pressure chemical ionization ion trap tandem mass spectrometer (APCI-IT-MS/MS) were performed without prior chromatographic separation. In vitro, the greatest accumulation of biomass occurred within 60 days of culture. The highest level of maytenin--972.11 μ g·g⁻¹ dry weight--was detected at seven days of cultivation; this value was 5.55-fold higher than that found in the roots of seedlings grown in a greenhouse.
Directory of Open Access Journals (Sweden)
Tiago Antunes Paz
2013-01-01
Full Text Available Establishment of adventitious root cultures of Peritassa campestris (Celastraceae was achieved from seed cotyledons cultured in semisolid Woody Plant Medium (WPM supplemented with 2% sucrose, 0.01% PVP, and 4.0 mg L−1 IBA. Culture period on accumulation of biomass and quinone-methide triterpene maytenin in adventitious root were investigated. The accumulation of maytenin in these roots was compared with its accumulation in the roots of seedlings grown in a greenhouse (one year old. A rapid detection and identification of maytenin by direct injection into an atmospheric-pressure chemical ionization ion trap tandem mass spectrometer (APCI-IT-MS/MS were performed without prior chromatographic separation. In vitro, the greatest accumulation of biomass occurred within 60 days of culture. The highest level of maytenin—972.11 μg·g−1 dry weight—was detected at seven days of cultivation; this value was 5.55-fold higher than that found in the roots of seedlings grown in a greenhouse.
Falanghe, H.
1962-01-01
Of ten mushroom cultures investigated, only Agaricus campestris, Boletus indecisus, and Tricholoma nudum were capable of growing in submerged culture in medium of vinasse with added salts. Higher fermentative efficiencies were found under these conditions than in medium containing molasses or waste sulfite liquor. A. campestris showed a better capacity to produce protein but, since B. indecisus is capable of developing greater mycelium weight, its fermentative efficiencies are comparable. Both microorganisms could be grown in medium of vinasse with greatly varied amounts, producing higher mycelial weight in media with greater vinasse. The capacity of B. indecisus and A. campestris to utilize the noncarbohydrate fraction in total solids, instead of the total carbohydrates when they are in smaller amount, was observed in medium containing vinasse. B. indecisus and A. campestris were easily separated by filtration from the medium, although T. nudum was difficult to separate by this procedure. In experiments with A. campestris, the adaptative capacity of the organism to vinasse was demonstrated. PMID:13962715
Directory of Open Access Journals (Sweden)
Sriwatapron Sor-suwan
Full Text Available Malaria sporozoites must invade the salivary glands of mosquitoes for maturation before transmission to vertebrate hosts. The duration of the sporogonic cycle within the mosquitoes ranges from 10 to 21 days depending on the parasite species and temperature. During blood feeding salivary gland proteins are injected into the vertebrate host, along with malaria sporozoites in the case of an infected mosquito. To identify salivary gland proteins depleted after blood feeding of female Anopheles campestris-like, a potential malaria vector of Plasmodium vivax in Thailand, two-dimensional gel electrophoresis and nano-liquid chromatography-mass spectrometry techniques were used. Results showed that 19 major proteins were significantly depleted in three to four day-old mosquitoes fed on a first blood meal. For the mosquitoes fed the second blood meal on day 14 after the first blood meal, 14 major proteins were significantly decreased in amount. The significantly depleted proteins in both groups included apyrase, 5'-nucleotidase/apyrase, D7, D7-related 1, short form D7r1, gSG6, anti-platelet protein, serine/threonine-protein kinase rio3, putative sil1, cyclophilin A, hypothetical protein Phum_PHUM512530, AGAP007618-PA, and two non-significant hit proteins. To our knowledge, this study presents for the first time the salivary gland proteins that are involved in the second blood feeding on the day corresponding to the transmission period of the sporozoites to new mammalian hosts. This information serves as a basis for future work concerning the possible role of these proteins in the parasite transmission and the physiological processes that occur during the blood feeding.
Sor-suwan, Sriwatapron; Jariyapan, Narissara; Roytrakul, Sittiruk; Paemanee, Atchara; Phumee, Atchara; Phattanawiboon, Benjarat; Intakhan, Nuchpicha; Chanmol, Wetpisit; Bates, Paul A; Saeung, Atiporn; Choochote, Wej
2014-01-01
Malaria sporozoites must invade the salivary glands of mosquitoes for maturation before transmission to vertebrate hosts. The duration of the sporogonic cycle within the mosquitoes ranges from 10 to 21 days depending on the parasite species and temperature. During blood feeding salivary gland proteins are injected into the vertebrate host, along with malaria sporozoites in the case of an infected mosquito. To identify salivary gland proteins depleted after blood feeding of female Anopheles campestris-like, a potential malaria vector of Plasmodium vivax in Thailand, two-dimensional gel electrophoresis and nano-liquid chromatography-mass spectrometry techniques were used. Results showed that 19 major proteins were significantly depleted in three to four day-old mosquitoes fed on a first blood meal. For the mosquitoes fed the second blood meal on day 14 after the first blood meal, 14 major proteins were significantly decreased in amount. The significantly depleted proteins in both groups included apyrase, 5'-nucleotidase/apyrase, D7, D7-related 1, short form D7r1, gSG6, anti-platelet protein, serine/threonine-protein kinase rio3, putative sil1, cyclophilin A, hypothetical protein Phum_PHUM512530, AGAP007618-PA, and two non-significant hit proteins. To our knowledge, this study presents for the first time the salivary gland proteins that are involved in the second blood feeding on the day corresponding to the transmission period of the sporozoites to new mammalian hosts. This information serves as a basis for future work concerning the possible role of these proteins in the parasite transmission and the physiological processes that occur during the blood feeding.
Zhao, Shuyan; Fan, Ziyan; Sun, Lihui; Zhou, Tao; Xing, Yuliang; Liu, Lifen
2017-03-01
A vegetation study was conducted to investigate the interactive effects of perfluoroalkyl substances (PFASs), including perfluorooctanoic acid (PFOA) and perfluorooctane sulfonate (PFOS), and Cadmium (Cd) on soil enzyme activities, phytotoxicity and bioaccumulation of wheat (Triticum aestivum L.) and rapeseed (Brassica campestris L.) from co-contaminated soil. Soil urease activities were inhibited significantly but catalase activities were promoted significantly by interaction of PFASs and Cd which had few effects on sucrase activities. Joint stress with PFASs and Cd decreased the biomass of plants and chlorophyll (Chl) content in both wheat and rapeseed, and malondialdehyde (MDA) content, superoxide dismutase (SOD) and peroxidase (POD) activities were increased in wheat but inhibited in rapeseed compared with single treatments. The bioconcentration abilities of PFASs in wheat and rapeseed were decreased, and the translocation factor of PFASs was decreased in wheat but increased in rapeseed with Cd addition. The bioaccumulation and translocation abilities of Cd were increased significantly in both wheat and rapeseed with PFASs addition. These findings suggested important evidence that the co-existence of PFASs and Cd reduced the bioavailability of PFASs while enhanced the bioavailability of Cd in soil, which increased the associated environmental risk for Cd but decreased for PFASs. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Bogdanove Adam J
2007-12-01
Full Text Available Abstract Background Lipopolysaccharide (LPS is a pathogen associated molecular pattern (PAMP of animal and plant pathogenic bacteria. Variation at the interstrain level is common in LPS biosynthetic gene clusters of animal pathogenic bacteria. This variation has been proposed to play a role in evading the host immune system. Even though LPS is a modulator of plant defense responses, reports of interstrain variation in LPS gene clusters of plant pathogenic bacteria are rare. Results In this study we report the complete sequence of a variant 19.9 kb LPS locus present in the BXO8 strain of Xanthomonas oryzae pv. oryzae (Xoo, the bacterial blight pathogen of rice. This region is completely different in size, number and organization of genes from the LPS locus present in most other strains of Xoo from India and Asia. Surprisingly, except for one ORF, all the other ORFs at the BXO8 LPS locus are orthologous to the genes present at this locus in a sequenced strain of X. axonopodis pv. citri (Xac; a pathogen of citrus plants. One end of the BXO8 LPS gene cluster, comprised of ten genes, is also present in the related rice pathogen, X. oryzae pv. oryzicola (Xoc. In Xoc, the remainder of the LPS gene cluster, consisting of seven genes, is novel and unrelated to LPS gene clusters of any of the sequenced xanthomonads. We also report substantial interstrain variation suggestive of very recent horizontal gene transfer (HGT at the LPS biosynthetic locus of Xanthomonas campestris pv. campestris (Xcc, the black rot pathogen of crucifers. Conclusion Our analyses indicate that HGT has altered the LPS locus during the evolution of Xanthomonas oryzae pathovars and suggest that the ancestor of all Xanthomonas oryzae pathovars had an Xac type of LPS gene cluster. Our finding of interstrain variation in two major xanthomonad pathogens infecting different hosts suggests that the LPS locus in plant pathogenic bacteria, as in animal pathogens, is under intense
Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena
2014-08-01
Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Suayib Üstün
Full Text Available The phytopathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv requires type III effector proteins (T3Es for virulence. After translocation into the host cell, T3Es are thought to interact with components of host immunity to suppress defence responses. XopJ is a T3E protein from Xcv that interferes with plant immune responses; however, its host cellular target is unknown. Here we show that XopJ interacts with the proteasomal subunit RPT6 in yeast and in planta to inhibit proteasome activity. A C235A mutation within the catalytic triad of XopJ as well as a G2A exchange within the N-terminal myristoylation motif abolishes the ability of XopJ to inhibit the proteasome. Xcv ΔxopJ mutants are impaired in growth and display accelerated symptom development including tissue necrosis on susceptible pepper leaves. Application of the proteasome inhibitor MG132 restored the ability of the Xcv ΔxopJ to attenuate the development of leaf necrosis. The XopJ dependent delay of tissue degeneration correlates with reduced levels of salicylic acid (SA and changes in defence- and senescence-associated gene expression. Necrosis upon infection with Xcv ΔxopJ was greatly reduced in pepper plants with reduced expression of NPR1, a central regulator of SA responses, demonstrating the involvement of SA-signalling in the development of XopJ dependent phenotypes. Our results suggest that XopJ-mediated inhibition of the proteasome interferes with SA-dependent defence response to attenuate onset of necrosis and to alter host transcription. A central role of the proteasome in plant defence is discussed.
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...
Denancé, N.; Ranocha, P.; Oria, N.; Barlet, X.; Rivière, M.P.; Yadeta, K.A.; Hoffmann, L.; Perreau, F.; Clément, G.; Maia-Grondard, A.; Berg, van den G.C.M.; Savelli, B.; Fournier, S.; Aubert, Y.; Pelletier, S.; Thomma, B.P.H.J.; Molina, A.; Jouanin, L.; Marco, Y.; Goffner, D.
2013-01-01
Inactivation of Arabidopsis WAT1 (Walls Are Thin1), a gene required for secondary cell-wall deposition, conferred broad-spectrum resistance to vascular pathogens, including the bacteria Ralstonia solanacearum and Xanthomonas campestris pv. campestris, and the fungi Verticillium dahliae and
Survival of pathogens of Brussels sprouts (Brassica oleracea Gemifera group) in crop residues
Köhl, J.; Vlaswinkel, M.E.T.; Groenenboom-de Haas, B.H.; Kastelein, P.; Hoof, van R.A.; Wolf, van der J.M.; Krijger, M.C.
2011-01-01
Mycosphaerella brassicicola (ringspot), Alternaria brassicicola and A. brassicae (dark leaf spot) and Xanthomonas campestris pv. campestris (black spot) can infect leaves of Brussels sprouts resulting in yield losses. Infections of outer leaves of sprouts cause severe losses in quality. Crop
Directory of Open Access Journals (Sweden)
Carine Rosa Naue
2014-12-01
Full Text Available A disseminação de Xanthomonas campestris pv. viticola (Xcv, agente do cancro bacteriano da videira, ocorre, dentre outras formas, por meio de mudas e bacelos infectados. Foi estudada a obtenção de material propagativo livre do patógeno, testando a eficiência do tratamento de bacelos com termoterapia, bactericidas e sanitizantes. Os isolados de Xcv foram testados quanto à patogenicidade e realizado o teste de sensibilidade in vitro aos produtos, em diferentes concentrações. A erradicação de Xcv em bacelos de videira foi testada em experimentos com termoterapia (50ºC por 30 e 40 min; 53ºC por 5 e 10 min; bactericidas [oxitetraciclina+sulfato de cobre (150+2.000; 165+2.200; 180+2.400 e 195+2.600 mg L-1 de H2O e oxitetraciclina (600; 700; 800 e 900 mg L-1]; e sanitizantes [cloreto de dodecildimetil amônio (600; 1.200; 1.800; 2.400 e 3.000 µL L-1; hipoclorito de sódio (5.000; 10.000; 20.000; 30.000 e 40.000 µL L-1 e cloreto de benzalcônio (125; 167;250; 334 e 500 µL L-1]. Foram avaliados período de incubação, incidência e severidade da doença. O bactericida oxitetraciclina e os sanitizantes cloreto de dodecildimetil amônio e hipoclorito de sódio proporcionaram os maiores halos de inibição de Xcv in vitro. No entanto, apesar dos diversos tratamentos testados, não foi possível recomendar tratamento termoterápico ou produto que erradicasse Xcv de bacelos infectados. Porém, ficou confirmada a grande importância destes na disseminação do agente do cancro bacteriano da videira.
Almeida, Rodrigo P P; Killiny, Nabil; Newman, Karyn L; Chatterjee, Subhadeep; Ionescu, Michael; Lindow, Steven E
2012-04-01
In Xylella fastidiosa the fatty acid signal molecule diffusible signaling factor (DSF) is produced and sensed by components of the regulation of pathogenicity factors (rpf) cluster; lack of DSF production in RpfF mutants results in a non-vector-transmissible phenotype yet cells are hypervirulent to grape. rpfB has not been characterized in Xylella fastidiosa, although its homolog has been suggested to be required for DSF synthesis in Xanthomonas campestris pv. campestris. We show that RpfB is involved in DSF processing in both Xylella fastidiosa and Xanthomonas campestris, affecting the profile of DSF-like fatty acids observed in thin-layer chromatography. Although three fatty acids whose production is dependent on RpfF were detected in Xylella fastidiosa and Xanthomonas campestris wild-type strains, their respective rpfB mutants accumulated primarily one chemical species. Although no quantifiable effect of rpfB on plant colonization by Xylella fastidiosa was found, insect colonization and transmission was reduced. Thus, RpfB apparently is involved in DSF processing, and like Xanthomonas campestris, Xylella fastidiosa also produces multiple DSF molecules. It is possible that Xylella fastidiosa coordinates host vector and plant colonization by varying the proportions of different forms of DSF signals via RpfB.
Anjum, Naser A; Umar, Shahid; Iqbal, Muhammad
2014-09-01
This study, based on a greenhouse pot culture experiment conducted with 15-day-old rapeseed (Brassica campestris L. cv. Pusa Gold; family Brassicaceae) and moong bean (Vigna radiata L. Wilczek cv. Pusa Ratna; family Fabaceae) plants treated with cadmium (Cd) concentrations (0, 50, and 100 mg kg(-1) soil), investigates their potential for Cd accumulation and tolerance, and dissects the underlying basic physiological/biochemical mechanisms. In both species, plant dry mass decreased, while Cd concentration of both root and shoot increased with increase in soil Cd. Roots harbored a higher amount of Cd (vs. shoot) in B. campestris, while the reverse applied to V. radiata. By comparison, root Cd concentration was higher in B. campestris than in V. radiata. The high Cd concentrations in B. campestris roots and V. radiata shoots led to significant elevation in oxidative indices, as measured in terms of electrolyte leakage, H2O2 content, and lipid peroxidation. Both plants displayed differential adaptation strategies to counteract the Cd burden-caused anomalies in their roots and shoots. In B. campestris, increasing Cd burden led to a significantly decreased reduced glutathione (GSH) content but a significant increase in activities of GSH reductase (GR), GSH peroxidase (GPX), and GSH sulfotransferase (GST). However, in V. radiata, increasing Cd burden caused significant increase in GSH content and GR activity, but a significant decline in activities of GPX and GST. Cross talks on Cd burden of tissues and the adapted Cd tolerance strategies against Cd burden-accrued toxicity indicated that B. campestris and V. radiata are good Cd stabilizer and Cd extractor, respectively, wherein a fine tuning among the major components (GR, GPX, GST, GSH) of the GSH redox system helped the plants to counteract differentially the Cd load-induced anomalies in tissues. On the whole, the physiological/biochemical characterization of the B. campestris and V. radiata responses to varying Cd
Top 10 plant pathogenic bacteria in molecular plant pathology.
Mansfield, John; Genin, Stephane; Magori, Shimpei; Citovsky, Vitaly; Sriariyanum, Malinee; Ronald, Pamela; Dow, Max; Verdier, Valérie; Beer, Steven V; Machado, Marcos A; Toth, Ian; Salmond, George; Foster, Gary D
2012-08-01
Many plant bacteriologists, if not all, feel that their particular microbe should appear in any list of the most important bacterial plant pathogens. However, to our knowledge, no such list exists. The aim of this review was to survey all bacterial pathologists with an association with the journal Molecular Plant Pathology and ask them to nominate the bacterial pathogens they would place in a 'Top 10' based on scientific/economic importance. The survey generated 458 votes from the international community, and allowed the construction of a Top 10 bacterial plant pathogen list. The list includes, in rank order: (1) Pseudomonas syringae pathovars; (2) Ralstonia solanacearum; (3) Agrobacterium tumefaciens; (4) Xanthomonas oryzae pv. oryzae; (5) Xanthomonas campestris pathovars; (6) Xanthomonas axonopodis pathovars; (7) Erwinia amylovora; (8) Xylella fastidiosa; (9) Dickeya (dadantii and solani); (10) Pectobacterium carotovorum (and Pectobacterium atrosepticum). Bacteria garnering honourable mentions for just missing out on the Top 10 include Clavibacter michiganensis (michiganensis and sepedonicus), Pseudomonas savastanoi and Candidatus Liberibacter asiaticus. This review article presents a short section on each bacterium in the Top 10 list and its importance, with the intention of initiating discussion and debate amongst the plant bacteriology community, as well as laying down a benchmark. It will be interesting to see, in future years, how perceptions change and which bacterial pathogens enter and leave the Top 10. © 2012 The Authors. Molecular Plant Pathology © 2012 BSPP and Blackwell Publishing Ltd.
EFFICACITE DE L'HYDROXYDE DE CUIVRE CONTRE LA ...
African Journals Online (AJOL)
Repository Agriculture : 70081962. Idrissou-Touré M. 2014. Test d'efficacité du fongi- cide « IDEFIX 40 WP hydroxyde de cuivre. 65,6 g/100 g » contre la nervation noire du chou causée par Xanthomonas campestris pv. campestris. Mémoire de. Master professionnel en Sciences et. Techniques de Production Végétale, Uni-.
Differentiation of Pseudomonas syringae Pathovars Originating from Stone Fruits
Directory of Open Access Journals (Sweden)
Katarina Gašić
2012-01-01
Full Text Available Due to an overlapping host range, similar symptomatology and many common characteristics,Pseudomonas syringae pathovars originating from stone fruits can easily be misidentified.In order to select tests for rapid and efficient differentiation of P. s. pvs. syringae,morsprunorum and persicae, we studied the suitability and differentiating potential ofsome standard bacteriological and molecular methods. Differentiation of the strains wasperformed using LOPAT, GATTa and ice nucleation tests, nutrient sucrose broth growthand utilization of various carbon sources. PCR method enabled the detection of toxin-producinggenes: syrB and syrD in P. s. pv. syringae, and cfl gene in P. s. pv. morsprunorum race1. Syringomycin production by pv. syringae was confirmed in bioassay using Geotrichumcandidum, Saccharomyces cerevisiae and Rhodotorula pilimanae as indicator organisms.Pathogenicity test on lemon and immature nectarine fruits, as well as on string bean pods,showed different intensity of reaction of the inoculated material which could separate pv.syringae from the other two pathovars. PCR-based repetitive sequences, Rep-PCR withREP, ERIC and BOX primers revealed different genetic profiles within P. syringae pathovars.
Yim, W J; Kim, K Y; Lee, Y W; Sundaram, S P; Lee, Y; Sa, T M
2014-07-15
Biotic stress like pathogenic infection increases ethylene biosynthesis in plants and ethylene inhibitors are known to alleviate the severity of plant disease incidence. This study aimed to reduce the bacterial spot disease incidence in tomato plants caused by Xanthomonas campestris pv. vesicatoria (XCV) by modulating stress ethylene with 1-aminocyclopropane-1-carboxylate (ACC) deaminase activity of Methylobacterium strains. Under greenhouse condition, Methylobacterium strains inoculated and pathogen challenged tomato plants had low ethylene emission compared to pathogen infected ones. ACC accumulation and ACC oxidase (ACO) activity with ACO related gene expression increased in XCV infected tomato plants over Methylobacterium strains inoculated plants. Among the Methylobacterium spp., CBMB12 resulted lowest ACO related gene expression (1.46 Normalized Fold Expression), whereas CBMB20 had high gene expression (3.42 Normalized Fold Expression) in pathogen challenged tomato. But a significant increase in ACO gene expression (7.09 Normalized Fold Expression) was observed in the bacterial pathogen infected plants. In contrast, Methylobacterium strains enhanced β-1,3-glucanase and phenylalanine ammonia-lyase (PAL) enzyme activities in pathogen challenged tomato plants. The respective increase in β-1,3-glucanase related gene expressions due to CBMB12, CBMB15, and CBMB20 strains were 66.3, 25.5 and 10.4% higher over pathogen infected plants. Similarly, PAL gene expression was high with 0.67 and 0.30 Normalized Fold Expression, in pathogen challenged tomato plants inoculated with CBMB12 and CBMB15 strains. The results suggest that ethylene is a crucial factor in bacterial spot disease incidence and that methylobacteria with ACC deaminase activity can reduce the disease severity with ultimate pathogenesis-related protein increase in tomato. Copyright © 2014 Elsevier GmbH. All rights reserved.
Zhou, Xue; Liu, Zhiyong; Ji, Ruiqin; Feng, Hui
2017-10-01
We studied the underlying causes of multiple-allele-inherited male sterility in Chinese cabbage (Brassica campestris L. ssp. pekinensis) by identifying differentially expressed genes (DEGs) related to pollen sterility between fertile and sterile flower buds. In this work, we verified the stages of sterility microscopically and then performed transcriptome analysis of mRNA isolated from fertile and sterile buds using Illumina HiSeq 2000 platform sequencing. Approximately 80% of ~229 million high-quality paired-end reads were uniquely mapped to the reference genome. In sterile buds, 699 genes were significantly up-regulated and 4096 genes were down-regulated. Among the DEGs, 28 pollen cell wall-related genes, 54 transcription factor genes, 45 phytohormone-related genes, 20 anther and pollen-related genes, 212 specifically expressed transcripts, and 417 DEGs located on linkage group A07 were identified. Six transcription factor genes BrAMS, BrMS1, BrbHLH089, BrbHLH091, BrAtMYB103, and BrANAC025 were identified as putative sterility-related genes. The weak auxin signal that is regulated by BrABP1 may be one of the key factors causing pollen sterility observed here. Moreover, several significantly enriched GO terms such as "cell wall organization or biogenesis" (GO:0071554), "intrinsic to membrane" (GO:0031224), "integral to membrane" (GO:0016021), "hydrolase activity, acting on ester bonds" (GO:0016788), and one significantly enriched pathway "starch and sucrose metabolism" (ath00500) were identified in this work. qRT-PCR, PCR, and in situ hybridization experiments validated our RNA-seq transcriptome analysis as accurate and reliable. This study will lay the foundation for elucidating the molecular mechanism(s) that underly sterility and provide valuable information for studying multiple-allele-inherited male sterility in the Chinese cabbage line 'AB01'.
JPRS Report, Science & Technology, USSR: Life Sciences.
1987-06-29
MEDITSINSKAYA BIOTEKHNOLOGIYA, No 11, Nov 85) 20 Xanthomonas Campestris Pv. Oryzae, Rice Seed Bacteriosis Pathogen in the Ukraine (I.B, Koroleva...ethylene, and are active in a series of bioassays on auxins, gibberellins and cytokinins. Nevertheless, according to the character of their biological...CAMPESTRIS PV. ORYZAE, RICE SEED BACTERIOSIS PATHOGEN IN THE UKRAINE Kiev MIKROBIOLOGICHESKIY ZHURNAL in Russian Vol 47, No 6, Nov-Dec 85 (manuscript
Directory of Open Access Journals (Sweden)
Juan J. Pierella Karlusich
2017-07-01
Full Text Available Non-host resistance is the most ample and durable form of plant resistance against pathogen infection. It includes induction of defense-associated genes, massive metabolic reprogramming, and in many instances, a form of localized cell death (LCD at the site of infection, purportedly designed to limit the spread of biotrophic and hemibiotrophic microorganisms. Reactive oxygen species (ROS have been proposed to act as signals for LCD orchestration. They are produced in various cellular compartments including chloroplasts, mitochondria and apoplast. We have previously reported that down-regulation of ROS build-up in chloroplasts by expression of a plastid-targeted flavodoxin (Fld suppressed LCD in tobacco leaves inoculated with the non-host bacterium Xanthomonas campestris pv. vesicatoria (Xcv, while other defensive responses were unaffected, suggesting that chloroplast ROS and/or redox status play a major role in the progress of LCD. To better understand these effects, we compare here the transcriptomic alterations caused by Xcv inoculation on leaves of Fld-expressing tobacco plants and their wild-type siblings. About 29% of leaf-expressed genes were affected by Xcv and/or Fld. Surprisingly, 5.8% of them (1,111 genes were regulated by Fld in the absence of infection, presumably representing pathways responsive to chloroplast ROS production and/or redox status during normal growth conditions. While the majority (∼75% of pathogen-responsive genes were not affected by Fld, many Xcv responses were exacerbated, attenuated, or regulated in opposite direction by expression of this protein. Particularly interesting was a group of 384 genes displaying Xcv responses that were already triggered by Fld in the absence of infection, suggesting that the transgenic plants had a larger and more diversified suite of constitutive defenses against the attacking microorganism compared to the wild type. Fld modulated many genes involved in pathogenesis, signal
Embryo Localization Enhances the Survival of Acidovorax citrulli in Watermelon Seeds.
Dutta, Bhabesh; Schneider, Raymond W; Robertson, Clark L; Walcott, Ronald R
2016-04-01
Acidovorax citrulli, the causal agent of bacterial fruit blotch (BFB) of cucurbits has been observed to survive for >34 years in stored melon and watermelon seeds. To better understand this remarkable longevity, we investigated the bacterium's tolerance to desiccation and the effect of bacterial localization in different watermelon seed tissues on its survival. We compared the ability of A. citrulli to tolerate desiccation on filter paper discs and on host (watermelon) and nonhost (cabbage, corn and tomato) seeds to two seedborne (Xanthomonas campestris pv. campestris and Pantoea stewartii subsp. stewartii) and one soilborne (Ralstonia solanacearum) plant-pathogenic bacteria. A. citrulli survival on dry filter paper (>12 weeks) was similar to that of X. campestris pv. campestris but longer than P. stewartii subsp. stewartii. Ralstonia solanacearum survived longer than all other bacteria tested. On all seeds tested, A. citrulli and X. campestris pv. campestris populations declined by 5 orders of magnitude after 12 weeks of incubation at 4°C and 50% relative humidity, while R. solanacearum populations declined by 3 orders. P. stewartii subsp. stewartii was not recovered after 12 weeks of incubation. To determine the effect of tissue localization on bacterial survival, watermelon seeds infested with A. citrulli by flower stigma inoculation (resulting in bacterial localization in the embryo/endosperm) or by ovary pericarp inoculations (resulting in bacterial localization under the testa) were treated with peroxyacetic acid or chlorine (Cl2) gas. Following these treatments, a significantly higher reduction in BFB seed-to-seedling transmission was observed for seeds generated by ovary pericarp inoculation (≥89.5%) than for those generated by stigma inoculation (≤76.5%) (Pseed coat, suggesting that tissue localization is important for bacterial survival in seed. This observation was confirmed when P. stewartii subsp. stewartii survived significantly longer in stigma
Production and certain properties of biopolymers used in drilling
Energy Technology Data Exchange (ETDEWEB)
Dedusenko, G Y; Gvozdyak, R I; Kolodkova, N M; Matyshevskaya, M S; Mayko, I I
1977-01-01
Biopolymers, belonging to modified polysaccharides, obtained by the action of Xanthomonas campestris bacteria on glucose and containing its substances, are used as the main component in clayless polymer muds. As a result of research performed at the laboratory of phytopathogenic bacteria in the IMV AN USSR, the producent strain of polysaccharide has been revealed and the nutritive medium chosen. Results are given of an analysis of the best Soviet samples of biopolymers created in the IMV AN USSR, produced using various strains of Xanthomonas bacteria. Rheological properties of aqueous dispersions of the biopolymer Keltsan are studied. The flow curves are recorded on the Fann rotation viscosimeter. The research performed enables determination that for fermentation can be used the bacteria Xanthomonas campestris, X. begonia, and X. molvacearum; and bacteria belonging to X. Campestris used to produce a sample batch of biopolymer, yielding the greatest amount of polysaccharide. The work results in development of a nutritive medium based on available Soviet materials, promoting formation of polysaccharide.
The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.
Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S
2006-12-01
The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.
Classification of plant associated bacteria using RIF, a computationally derived DNA marker.
Directory of Open Access Journals (Sweden)
Kevin L Schneider
Full Text Available A DNA marker that distinguishes plant associated bacteria at the species level and below was derived by comparing six sequenced genomes of Xanthomonas, a genus that contains many important phytopathogens. This DNA marker comprises a portion of the dnaA replication initiation factor (RIF. Unlike the rRNA genes, dnaA is a single copy gene in the vast majority of sequenced bacterial genomes, and amplification of RIF requires genus-specific primers. In silico analysis revealed that RIF has equal or greater ability to differentiate closely related species of Xanthomonas than the widely used ribosomal intergenic spacer region (ITS. Furthermore, in a set of 263 Xanthomonas, Ralstonia and Clavibacter strains, the RIF marker was directly sequenced in both directions with a success rate approximately 16% higher than that for ITS. RIF frameworks for Xanthomonas, Ralstonia and Clavibacter were constructed using 682 reference strains representing different species, subspecies, pathovars, races, hosts and geographic regions, and contain a total of 109 different RIF sequences. RIF sequences showed subspecific groupings but did not place strains of X. campestris or X. axonopodis into currently named pathovars nor R. solanacearum strains into their respective races, confirming previous conclusions that pathovar and race designations do not necessarily reflect genetic relationships. The RIF marker also was sequenced for 24 reference strains from three genera in the Enterobacteriaceae: Pectobacterium, Pantoea and Dickeya. RIF sequences of 70 previously uncharacterized strains of Ralstonia, Clavibacter, Pectobacterium and Dickeya matched, or were similar to, those of known reference strains, illustrating the utility of the frameworks to classify bacteria below the species level and rapidly match unknown isolates to reference strains. The RIF sequence frameworks are available at the online RIF database, RIFdb, and can be queried for diagnostic purposes with RIF
Chemical cues mediate species recognition in field crickets
Directory of Open Access Journals (Sweden)
Frances eTyler
2015-05-01
Full Text Available Cuticular hydrocarbons (CHCs are important in mate choice in many insects, and may be used for species recognition if CHC profiles differ between potentially hybridizing species. In the sibling field cricket species Gryllus campestris and G. bimaculatus, females of G. bimaculatus are tolerant towards G. campestris males and can mate with them. However, G. campestris females are highly aggressive towards heterospecific G. bimaculatus males, and matings between them never happen. We examined whether cricket females might use CHCs to determine the species identity of their potential mates. We firstly analyzed the cuticular chemical profile by gas chromatography and mass spectrometry to assess the potential of CHCs to be used for species recognition in these crickets. We then manipulated females’ ability to detect chemical cues by carrying out chemical ablation of the antennae, and measured changes in aggressive responses to heterospecific males. We show that there are significant interspecies differences in CHC expression for both sexes, and that females with chemically ablated antennae reduce aggressive behavior towards heterospecific males. Our findings support the prediction that cuticular semiochemicals can play a key role in reproductive isolation between closely related insect species.
Tegli, Stefania; Cerboneschi, Matteo; Libelli, Ilaria Marsili; Santilli, Elena
2010-05-28
Pseudomonas savastanoi pv. savastanoi is the causal agent of olive knot disease. The strains isolated from oleander and ash belong to the pathovars nerii and fraxini, respectively. When artificially inoculated, pv. savastanoi causes disease also on ash, and pv. nerii attacks also olive and ash. Surprisingly nothing is known yet about their distribution in nature on these hosts and if spontaneous cross-infections occur. On the other hand sanitary certification programs for olive plants, also including P. savastanoi, were launched in many countries. The aim of this work was to develop several PCR-based tools for the rapid, simultaneous, differential and quantitative detection of these P. savastanoi pathovars, in multiplex and in planta. Specific PCR primers and probes for the pathovars savastanoi, nerii and fraxini of P. savastanoi were designed to be used in End Point and Real-Time PCR, both with SYBR Green or TaqMan chemistries. The specificity of all these assays was 100%, as assessed by testing forty-four P. savastanoi strains, belonging to the three pathovars and having different geographical origins. For comparison strains from the pathovars phaseolicola and glycinea of P. savastanoi and bacterial epiphytes from P. savastanoi host plants were also assayed, and all of them tested always negative. The analytical detection limits were about 5 - 0.5 pg of pure genomic DNA and about 102 genome equivalents per reaction. Similar analytical thresholds were achieved in Multiplex Real-Time PCR experiments, even on artificially inoculated olive plants. Here for the first time a complex of PCR-based assays were developed for the simultaneous discrimination and detection of P. savastanoi pv. savastanoi, pv. nerii and pv. fraxini. These tests were shown to be highly reliable, pathovar-specific, sensitive, rapid and able to quantify these pathogens, both in multiplex reactions and in vivo. Compared with the other methods already available for P. savastanoi, the identification
Directory of Open Access Journals (Sweden)
Líllian V. Brandão
2010-09-01
Full Text Available Goma xantana é um biopolímero comercial produzido por fermentação de glicose e Xanthomonas com larga aplicação industrial. O objetivo deste trabalho foi estudar a síntese e a viscosidade da goma obtida por cepas nativas de Xanthomonas campestris utilizando soro de mandioca como substrato fermentativo alternativo. Três tipos de Xanthomonas foram utilizados. A maior produção foi de 13,83 g.L-1 obtida do meio fermentativo com X. campestris mangiferaeindicae a 25 ºC, 250 rpm por 120 horas apresentando uma viscosidade aparente de 96,14 cP na concentração de 2,0% de solução de xantana a 25 s-1, 25 ºC. O uso do resíduo industrial de soro de mandioca para biossíntese da xantana é uma alternativa de baixo custo para o processo fermentativo e um destino para esse soro.Xanthan gum is a commercial biopolymer produced by fermentation of glucose and Xanthomonas with many industrial applications. The objective of this work was to study the synthesis and the viscosity of xanthan obtained from native strains of Xanthomonas campestris using cassava as an alternative fermentative substrate. Three kinds of Xanthomonas were used. The highest production was 13.83 g.L-1 obtained with X. campestris mangiferaeindicae fermented at 25 ºC, 250 rpm during 120 hours and presenting apparent viscosity 96.14 cP in the concentration of 2.0% of xanthan solution at 25 s-1, 25 ºC. The use of the industrial residue of cassava serum for biosynthesis of xanthan is a low cost alternative for the fermentation process and a noble use for this waste.
International Nuclear Information System (INIS)
Rhaman, A.
1988-11-01
Germplasm of Brassica campestris and Brassica juncea was collected from various parts of Bangladesh and evaluated for yield, oil content etc. prior to the breeding programme. Seeds of the B. campestris variety YS-52, possessing good agronomic characteristics, were treated with mutagens (gamma rays and sodium azide) to widen the genetic variation. Mutants were selected for higher yield and resistance against Alternaria brassicae. The two mutant lines BINA 1 and BINA 2 were selected exceeding the parent variety considerably in yield and disease resistance. They are candidates for recommended varieties. Brassica juncea variety RCM 625 was treated with gamma rays and EMS. Four higher yielding and earlier maturing mutants are being evaluated further. 6 tabs
Resistance of Newly Introduced Vegetables to Meloidogyne arenaria and M. incognita in Korea
Directory of Open Access Journals (Sweden)
Donggeun Kim
2013-12-01
Full Text Available To select resistant vegetables against two species of root-knot nematodes, M. incognita and M. arenaria, 39 vegetables belongs to 7 families, 13 genera, 25 species were screened in greenhouse pot test. Susceptible vegetables to both nematodes were amarath and leaf beet in Amaranthaceae, Malabar spinach in Basellaceae, Moroheiya in Tiliaceae, and Water-convolvulus in Convolvulaceae, Pak-choi in Brassica campestris var. chinensis, Tah tasai in B. campestris var. narinosa, B. campestris var. chinensis x narinosa, Leaf mustard, Mustard green in B. juncea, Kyona in B. juncea var. laciniate, Choy sum in B. rapa subsp. arachinenesis, Kairan in B. oleracea var. alboglabra, Arugula in Eruca sativa, Garland chrysanthemum in Chrysanthemum coronarium, Endive in Cichorium endivia, Artichoke in Cynara cardunculus var. scolymus, Lettuce in Lactuca sativa. Resistant to M. arenaria but susceptible to M. incognita were B. oleracea cv. Matjjang kale, B. oleracea var. gongyloides cv. Jeok kohlrabi, and C. intybus cv. Radicchio. Resistant vegetables to both nematodes were C. intybus cv. Sugar loaf, Grumoro, Radichio treviso, B. oleracea cv. Manchu collard, Super matjjang, B. oleracea italica, B. oleracea var. botrytis italiana, and Perilla in Lamiaceae. Vegetables resistant to both species of root-knot nematodes could be used as high-valued rotation crops in greenhouses where root-knot nematodes are problem.
In situ immobilisation of toxic metals in soil using Maifan stone and illite/smectite clay.
Ou, Jieyong; Li, Hong; Yan, Zengguang; Zhou, Youya; Bai, Liping; Zhang, Chaoyan; Wang, Xuedong; Chen, Guikui
2018-03-15
Clay minerals have been proposed as amendments for remediating metal-contaminated soils owing to their abundant reserves, high performance, simplicity of use and low cost. Two novel clay minerals, Maifan stone and illite/smectite clay, were examined in the in situ immobilisation of soil metals. The application of 0.5% Maifan stone or illite/smectite clay to field soils significantly decreased the fractions of diethylenetriaminepentaacetic acid (DTPA)-extractable Cd, Ni, Cr, Zn, Cu and Pb. Furthermore, reductions of 35.4% and 7.0% in the DTPA-extractable fraction of Cd were obtained with the Maifan stone and illite/smectite clay treatments, respectively, which also significantly reduced the uptake of Cd, Ni, Cr, Zn, Cu and Pb in the edible parts of Brassica rapa subspecies pekinensis, Brassica campestris and Spinacia oleracea. Quantitatively, the Maifan stone treatment reduced the metal uptake in B. rapa ssp. Pekinensis, B. campestris and S. oleracea from 11.6% to 62.2%, 4.6% to 41.8% and 11.3% to 58.2%, respectively, whereas illite/smectite clay produced reductions of 8.5% to 62.8% and 4.2% to 37.6% in the metal uptake in B. rapa ssp. Pekinensis and B. campestris, respectively. Therefore, both Maifan stone and illite/smectite clay are promising amendments for contaminated soil remediation.
Radunović Dragana; Balaž Jelica
2012-01-01
Brassicas form the most important group of vegetable crops in Montenegro. The cabbage (Brassica oleracea var. capitata) is most commonly grown, although other brassicas, particularly kale, Brussels sprout, cauliflower and broccoli, have been increasingly produced since recently. One of the specialties of vegetable production in Montenegro is growing of collard (Brassica oleracea var. acephala), which is the simplest variety of the Brassica oleracea species ...
Anatomical and nutritional adaptations in African rodents
African Journals Online (AJOL)
Cricetomys gambianus, Mystromys albicaudatus, Thallomys paedulcus and Saccostomus campestris). The stomachs of all species are markedly sac- culated with a highly modified corpus containing either numerous papillae or several diverticula ...
African Journals Online (AJOL)
egyptian hak
campestris var. toria) cultivar RSPT-1 were studied at Jammu (India).Under field ... Honeybees provide pollination services to several cultivated and wild species, thereby, maintaining ..... Ecotoxicology & Environmental Safety 57(3): 410–419.
Energy Technology Data Exchange (ETDEWEB)
Domenech, A M; Bauza de Faliti, M; Bocklet, M F
1991-12-31
In this work, the combined effect of refrigeration and gamma irradiation on diverse physical parameters to be measured in mushrooms was studied. Mushrooms (Agaricus Campestris), `bisporus` variety, of closed cap, were used. From the treatments tested, it was concluded that 0.5 KGy is the most suitable dosis to delay elongation, cap opening, stem length and surface moss growth. (Author). [Espanol] En este trabajo se ha estudiado el efecto combinado de la refrigeracion y la irradiacion gamma sobre los diversos parametros fisicos medibles en el champinon. Se utilizaron hongos del genero Agaricus Campestris, variedad bisporus, de sombrero cerrado. De los tratamientos ensayados, se ha demostrado tener efecto util la dosis de 0,5 KGy ya que se logro retardar crecimiento, apertura del sombrero, largo del pie y desarrollo de mohos en superficie. (Autor).
Influences of food quality and quantity on the male reproductive ...
African Journals Online (AJOL)
DOWNLOAD FULL TEXT Open Access DOWNLOAD FULL TEXT ... Reproduction in the pouched mouse (Saccostomus campestris) is inhibited in winter in the field and this seasonality is not controlled by photoperiod alone. The present study ...
Species-specific detection of Dickeya sp. (Pectobacterium ...
African Journals Online (AJOL)
use
2011-11-23
Nov 23, 2011 ... (Pectobacterium chrysanthemi) in infected banana tissues .... tetraacetic (EDTA) disodium salt pH 8.0, 100 mm NaCl and 1% .... lane 7, Erwinia carotovora subsp. carotovora; lane 8, Xanthomonas campestris pv.musacearum;.
Marginal scorch caused by Alternaria alternata on Purple-Caitai ...
African Journals Online (AJOL)
Marginal scorch caused by Alternaria alternata on Purple-Caitai (Brassia campestris L. ssp. chinensis L.var. utilis Tsen et Lee) in China. Qijun Nie, Zhongjiu Jiao, Fengjuan Zhu, Zhenbiao Jiao, Xiaohui Deng, Zhengming Qiu, Jinping Wu ...
African Journal of Biotechnology - Vol 15, No 8 (2016)
African Journals Online (AJOL)
Codon usage bias analysis for the coding sequences of Camellia sinensis and Brassica campestris · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prosenjit Paul, Supriyo Chakraborty, 236-251 ...
REACTION OF Musa balbisiana TO BANANA BACTERIAL WILT ...
African Journals Online (AJOL)
Prof. Adipala Ekwamu
2Makerere University, Department of Agricultural Production, P. O. Box 7062, Kampala, Uganda. Corresponding author: kumalfred@gmail.com. (Received 7 February, 2012; accepted 3 September, 2013). ABSTRACT. Banana bacterial wilt (Xanthomonas campestris) is an emerging disease of bananas in Uganda.
Coexistence between neighbours
DEFF Research Database (Denmark)
Shenge, K.C.; Mabagala, R.B.; Mortensen, C A Nieves Paulino
2008-01-01
Experiments were conducted under laboratory and screenhouse conditions to study the coexistence between Pseudomonas syringae pv. tomato and Xanthomonas campestris pv. vesicatoria, incitants of bacterial speck and bacterial spot diseases of tomato. Results of in vitro studies showed that when mixe...
González, Ana J.; Landeras, Elena; Mendoza, M. Carmen
2000-01-01
Ribotyping was evaluated as a method to differentiate between Pseudomonas syringae pv. phaseolicola and pv. syringae strains causing bacterial brown spot and halo blight diseases in Phaseolus vulgaris L. Ribotyping, with restriction enzymes BglI and SalI and using the Escherichia coli rrnB operon as the probe, differentiated 11 and 14 ribotypes, respectively, and a combination of data from both procedures yielded 19 combined ribotypes. Cluster analysis of the combined ribotypes differentiated the pathovars phaseolicola and syringae, as well as different clonal lineages within these pathovars. The potential of ribotyping to screen for correlations between lineages and factors such as geographical region and/or bean varieties is also reported. PMID:10653764
Acibenzolar-S-methyl induces lettuce resistance against ...
African Journals Online (AJOL)
... contributing to the enhancement of plant resistance. The effect was comparable with copper treatment. As a marker of resistance, PR protein activity chitinase showed remarkable increase, depending on decreasing bacterial growth in planta. Key words: Acibenzolar-S-methyl, induced resistance, Xanthomonas campestris ...
Antioxidant activity, phenolic and flavonoid contents of some wild ...
African Journals Online (AJOL)
sunny t
2016-03-30
Mar 30, 2016 ... 526. Afr. J. Biotechnol. Table 1. Ethnobotanical data of the investigated wild vegetal species of the regions of the southeastern Algeria. Scientific name. Local name. Used parts. Preparation. Ethnomedical use. References. Artemisia campestris. (Asteraceae). Dgouft. Aerial parts, leaves, flowers. Infusion.
DEFF Research Database (Denmark)
McCarthy, Y.; Yang, Liang; Twomey, K.B.
2010-01-01
Xanthomonas campestris. The mechanism of perception of this signal and the range of functions regulated in B. cenocepacia are, however, unknown. A screen for transposon mutants unable to respond to exogenous signal identified BCAM0227 as a potential BDSF sensor. BCAM0227 is a histidine sensor kinase...... with an input domain unrelated to that of RpfC, the DSF sensor found in xanthomonads. Transcriptome profiling established the scope of the BDSF regulon and demonstrated that the sensor controls expression of a subset of these genes. A chimeric sensor kinase in which the input domain of BCAM0227 replaced...... the input domain of RpfC was active in BDSF signal perception when expressed in X. campestris. Mutation of BCAM0227 gave rise to reduced cytotoxicity to Chinese hamster ovary cells and reduced virulence to Wax moth larvae and in the agar-bead mouse model of pulmonary infection. The findings identify BCAM...
Behdarvandi, Behrang; Guinel, Frédérique C; Costea, Mihai
2015-10-01
Seedlings of parasitic Cuscuta species are autotrophic but can survive only a short period of time, during which they must locate and attach to a suitable host. They have an ephemeral root-like organ considered not a "true" root by most studies. In the present study, two species with contrasting ecology were examined: Cuscuta gronovii, a North American riparian species, and Cuscuta campestris, an invasive dodder that thrives in disturbed habitats. The morphology, structure, and absorptive capability of their root-like organ were compared, their potential for colonization by two species of arbuscular mycorrhizal fungi (AMF) was assessed, and the effect of the AMF on seedling growth and survival was determined. The root of both species absorbed water and interacted with AMF, but the two species exhibited dissimilar growth and survival patterns depending on the colonization level of their seedlings. The extensively colonized seedlings of C. gronovii grew more and survived longer than non-colonized seedlings. In contrast, the scarce colonization of C. campestris seedlings did not increase their growth or longevity. The differential growth responses of the AMF-colonized and non-colonized Cuscuta species suggest a mycorrhizal relationship and reflect their ecology. While C. gronovii roots have retained a higher ability to interact with AMF and are likely to take advantage of fungal communities in riparian habitats, the invasive C. campestris has largely lost this ability possibly as an adaptation to disturbed ecosystems. These results indicate that dodders have a true root, even if much reduced and ephemeral, that can interact with AMF.
2013-01-10
... polysaccharide produced by aerobic fermentation of Xanthomonas campestris. The chemical structure of the repeating pentasaccharide monomer unit consists of a backbone of two P-1,4-D- Glucose monosaccharide units...-D- Mannose monosaccharide units. The terminal mannose may be pyruvylated and the internal mannose...
An amendment of Aspergillus section Candidi based on chemotaxonomical evidence
DEFF Research Database (Denmark)
Rahbaek, L.; Frisvad, Jens Christian; Christophersen, C.
2000-01-01
candidus and therefore a large number of Aspergilli were screened for production of these compounds to see whether they could be regarded as chemotaxonomical indicators of section membership in the monotypic Aspergillus section Candidi. The results indicated that A. campestris and A. taichungensis should...
Indian Academy of Sciences (India)
Madhu
ROS network is essential to induce disease resistance and even to mediate resistance to multiple stresses in ...... campestris and French bean mesophyll cells; Plant J. 15 .... He Y, Tang R H, Hao Y, Stevens R D, Cook C W, Ahn S M, Jing L,.
Evaluation of enset clones against enset bacterial wilt | Welde ...
African Journals Online (AJOL)
A large number of enset clones collected from the Sidama, Gurage, Kembata Tembaro and Hadyia zones were assessed for resistance/tolerance to enset bacterial wilt, Xanthomonas campestris pv. musacearum (Xcm) at the Awassa Agricultural Research Center, Awassa in Ethiopia, during the period 1994 to 2000.
gum production by Xanthomonas campestris pv
African Journals Online (AJOL)
DR TONUKARI NYEROVWO
2012-09-11
Sep 11, 2012 ... 8004) for xanthan gum production in this study. ... strain for xanthan gum production using cassava starch in industrial applications. ... the cassava price is cost-effective relative to other ... For amylase activity determination, a crude enzyme sample (1 ml) .... time point to stop fermentation from an economic.
Exploration of indigenous agrowastes for cellulase production by ...
African Journals Online (AJOL)
admin
2012-05-10
May 10, 2012 ... However, high lignin content of B. campestris made the cellulose inaccessible and resulted in poor yield of enzyme. Therefore, S. spontaneum has a great potential to serve as a cheaper, easily available and reasonable substrate for cellulase production. Key words: Agrowastes, cellulase, indigenous, ...
Bacterial leaf spot of lettuce, caused by Xanthomonas campestris pv. vitians, is a devastating disease of lettuce worldwide. Since there are no chemicals available for effective control of the disease, host-plant resistance is highly desirable to protect lettuce production. A total of 179 lettuce ge...
Exploration of indigenous agrowastes for cellulase production by ...
African Journals Online (AJOL)
Regional agrowastes such as Vigna mungo, Saccharum spontaneum and Brassica campestris were collected and biohydrolysis of these substrates for cellulase production were carried out by Aspergillus niger. Proximate composition of each agrowastes was analyzed based on dry weight, to have an insight view of their ...
Effect of Bacillus spp. on seed germination of selected species of the genus Cuscuta (Convolvulaceae
Directory of Open Access Journals (Sweden)
Fatemeh Hadizadeh
2014-04-01
Full Text Available Species of the genus Cuscuta are annual angiospermic rootless and leafless (achlorophyllous parasitic plants. Bacillus is an example of PGPR bacteria exhibiting plant growth promoting activity. In this study the effects of bacterial suspension on germination of dodder’s seed has been determinated. Seeds of three Cuscuta species were collected from field for evaluating effects of three different Bacillus on its germination. Results show that seed germination of the C. monogyna and C. campestris is inhibited by all three bacterial species. Based on Tukey analysis, the highest inhibitory activity on seed germination of C. monogyna was shown with B. pumilus (68.88%; as well as C. campestris with B. megaterium (95.76% and B. pumilus (91.53%, whilst seed germination of C. europaea was almost identically inhibited by all three bacterial species. This paper reports the variable effects of Bacillus species on the seed germination of selected Cuscuta species.
2013-07-19
..., and salts. Xanthan gum is a polysaccharide produced by aerobic fermentation of Xanthomonas campestris...,4-D- Glucose monosaccharide units, the second with a trisaccharide side chain consisting of P-D-Mannose-(1,4)- P-DGlucuronic acid-(1,2)-a-D- Mannose monosaccharide units. The terminal mannose may be...
African Journal of Biotechnology - Vol 12, No 6 (2013)
African Journals Online (AJOL)
Marginal scorch caused by Alternaria alternata on Purple-Caitai (Brassia campestris L. ssp. chinensis L.var. utilis Tsen et Lee) in China · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL ... S Elayabalan, K Kalaiponmani, Michael Pillay, A Chandrasekar, R Selvarajan, KK Kumar, P Balasubramanian ...
Reaction of Musa balbisiana to Banana bacterial wilt infection ...
African Journals Online (AJOL)
The expression of NPR1, a marker gene of the systemic acquired resistance plant defence system provides preliminary evidence that this may be the major form of resistance in Musa balbisiana to bacterial wilt infection. Keywords: NPR1, PR proteins, Uganda, Xanthomonas campestris. African Crop Science Journal, Vol.
Epiphytic bacteria from various bean genotypes and their potential ...
African Journals Online (AJOL)
Naturally occurring epiphytic non-pathogeni bacteria were isolated from reproductive tissue of various bean genotypes grown in the field and screened for both in vitro and in vivo antagonism to Xanthomonas axonopodis pv. phaseoli (formely X. campestris pv phaseoli). Of the 22 potential bacterial antagonists screened in ...
Ionescu, Michael; Baccari, Clelia; Da Silva, Aline Maria; Garcia, Angelica; Yokota, Kenji; Lindow, Steven E
2013-12-01
Xylella fastidiosa, like related Xanthomonas species, employs an Rpf cell-cell communication system consisting of a diffusible signal factor (DSF) synthase, RpfF, and a DSF sensor, RpfC, to coordinate expression of virulence genes. While phenotypes of a ΔrpfF strain in Xanthomonas campestris could be complemented by its own DSF, the DSF produced by X. fastidiosa (XfDSF) did not restore expression of the XfDSF-dependent genes hxfA and hxfB to a ΔrpfF strain of X. fastidiosa, suggesting that RpfF is involved in XfDSF sensing or XfDSF-dependent signaling. To test this conjecture, rpfC and rpfF of X. campestris were replaced by those of X. fastidiosa, and the contribution of each gene to the induction of a X. campestris DSF-dependent gene was assessed. As in X. fastidiosa, XfDSF-dependent signaling required both X. fastidiosa proteins RpfF and RpfC. RpfF repressed RpfC signaling activity, which in turn was derepressed by XfDSF. A mutated X. fastidiosa RpfF protein with two substitutions of glutamate to alanine in its active site was incapable of XfDSF production yet enabled a response to XfDSF, indicating that XfDSF production and the response to XfDSF are two separate functions in which RpfF is involved. This mutant was also hypervirulent to grape, demonstrating the antivirulence effects of XfDSF itself in X. fastidiosa. The Rpf system of X. fastidiosa is thus a novel example of a quorum-sensing signal synthase that is also involved in the response to the signal molecule that it synthesizes.
Directory of Open Access Journals (Sweden)
Fang-Fang Wang
2017-12-01
Full Text Available Summary: Recognition of the host plant is a prerequisite for infection by pathogenic bacteria. However, how bacterial cells sense plant-derived stimuli, especially chemicals that function in regulating plant development, remains completely unknown. Here, we have identified a membrane-bound histidine kinase of the phytopathogenic bacterium Xanthomonas campestris, PcrK, as a bacterial receptor that specifically detects the plant cytokinin 2-isopentenyladenine (2iP. 2iP binds to the extracytoplasmic region of PcrK to decrease its autokinase activity. Through a four-step phosphorelay, 2iP stimulation decreased the phosphorylation level of PcrR, the cognate response regulator of PcrK, to activate the phosphodiesterase activity of PcrR in degrading the second messenger 3′,5′-cyclic diguanylic acid. 2iP perception by the PcrK-PcrR remarkably improves bacterial tolerance to oxidative stress by regulating the transcription of 56 genes, including the virulence-associated TonB-dependent receptor gene ctrA. Our results reveal an evolutionarily conserved, inter-kingdom signaling by which phytopathogenic bacteria intercept a plant hormone signal to promote adaptation to oxidative stress. : How pathogenic bacteria use receptors to recognize the signals of the host plant is unknown. Wang et al. have identified a bacterial receptor histidine kinase that specifically senses the plant hormone cytokinin. Through a four-step phosphorelay, cytokinin perception triggers degradation of a second messenger, c-di-GMP, to activate the bacterial response to oxidative stress. Keywords: histidine kinase, ligand, cytokinin, autokinase activity, phosphorelay, response regulator, two-component signal transduction system, Xanthomonas campestris pv. campestris, virulence, oxidative stress
Directory of Open Access Journals (Sweden)
Odilon Peixoto de Morais Júnior
2012-11-01
Full Text Available Com o propósito de avaliar o comportamento de seis cultivares de couve-flor de verão, quanto à produção e resistência à podridão negra (Xanthomonas campestris pv. campestris, instalou-se um experimento em campo, em Ipameri-GO, com o delineamento experimental em blocos completos casualizados com seis tratamentos e quatro repetições. Cada parcela experimental, de 10m², constou de 20 plantas distribuídas no espaçamento de 1,0m entre linhas e 0,5m entre plantas. Foram avaliadas as cultivares: híbridos 'Cindy', 'Sarah AF-1169', 'Sharon', 'Verona', 'Lisvera' e a variedade Piracicaba precoce. Os híbridos Verona e Sharon mostraram-se promissores para cultivo nas condições edafoclimáticas em que foram avaliados, com produtividades de 34,17 e 30,64t ha-1, respectivamente, e com moderados níveis de resistência à podridão negra. A variedade Piracicaba precoce apresentou produção inferior às dos melhores híbridos avaliados e moderada resistência à podridão negra. O híbrido Sarah não é recomendado para plantio na região de Ipameri-GO por apresentar baixa produção e baixa resistência à podridão negra.In order to evaluate the behavior of six cultivars of cauliflower summer, as production and resistance to black rot (Xanthomonas campestris pv. campestris, installed a field experiment in Ipameri-GO, with the experimental in randomized complete blocks with six treatments and four replications. Each plot of 10m², consisting of 20 plants distributed at a spacing of 1.0m between rows and 0.5m between plants. We evaluated the cultivars: hybrids 'Cindy', 'Sarah AF-1169', 'Sharon', 'Verona', 'Lisvera' and the variety Piracicaba precoce. Hybrids Verona and Sharon proved promising for cultivation in the environmental conditions that were evaluated, with yields of 34.17 and 30.64t ha-1 respectively, and moderate levels of resistance to black rot. The variety Piracicaba precoce showed lower production of the best hybrids and moderate
Expression analysis of four flower-specific promoters of Brassica spp ...
African Journals Online (AJOL)
The 5'-flanking region of ca. 1200 bp upstream of the translation start site (TSS) of a putative cell wall protein gene was cloned from Brassica campestris, B. chinensis, B. napus and B. oleracea, and transferred to tobacco via Agrobacterium-mediation after fused to promoter-less beta-glucuronidase (GUS) reporter gene.
Cassava bacterial blight in Africa: the state of knowledge and ...
African Journals Online (AJOL)
Introduced to Africa in the 1970s, cassava bacterial blight caused by Xanthomonas campestris pv. manihotis (XCM) is present in almost all cropping areas. In the past fifteen years, advances have been made in knowledge of the biology and molecular genetics of XCM, host-parasite relationships and epidemiology of the ...
Directory of Open Access Journals (Sweden)
Hao Shen
Full Text Available Parasitic plants can adversely influence the growth of their hosts by removing resources and by affecting photosynthesis. Such negative effects depend on resource availability. However, at varied resource levels, to what extent the negative effects on growth are attributed to the effects on photosynthesis has not been well elucidated. Here, we examined the influence of nitrogen supply on the growth and photosynthesis responses of the host plant Mikania micrantha to infection by the holoparasite Cuscuta campestris by focusing on the interaction of nitrogen and infection. Mikania micrantha plants fertilized at 0.2, 1 and 5 mM nitrate were grown with and without C. campestris infection. We observed that the infection significantly reduced M. micrantha growth at each nitrate fertilization and more severely at low than at high nitrate. Such alleviation at high nitrate was largely attributed to a stronger influence of infection on root biomass at low than at high nitrate fertilization. However, although C. campestris altered allometry and inhibited host photosynthesis, the magnitude of the effects was independent of nitrate fertilizations. The infection reduced light saturation point, net photosynthesis at saturating irradiances, apparent quantum yield, CO2 saturated rate of photosynthesis, carboxylation efficiency, the maximum carboxylation rate of Rubisco, and maximum light-saturated rate of electron transport, and increased light compensation point in host leaves similarly across nitrate levels, corresponding to a similar magnitude of negative effects of the parasite on host leaf soluble protein and Rubisco concentrations, photosynthetic nitrogen use efficiency and stomatal conductance across nitrate concentrations. Thus, the more severe inhibition in host growth at low than at high nitrate supplies cannot be attributed to a greater parasite-induced reduction in host photosynthesis, but the result of a higher proportion of host resources
Shen, Hao; Xu, Shu-Jun; Hong, Lan; Wang, Zhang-Ming; Ye, Wan-Hui
2013-01-01
Parasitic plants can adversely influence the growth of their hosts by removing resources and by affecting photosynthesis. Such negative effects depend on resource availability. However, at varied resource levels, to what extent the negative effects on growth are attributed to the effects on photosynthesis has not been well elucidated. Here, we examined the influence of nitrogen supply on the growth and photosynthesis responses of the host plant Mikania micrantha to infection by the holoparasite Cuscuta campestris by focusing on the interaction of nitrogen and infection. Mikania micrantha plants fertilized at 0.2, 1 and 5 mM nitrate were grown with and without C. campestris infection. We observed that the infection significantly reduced M. micrantha growth at each nitrate fertilization and more severely at low than at high nitrate. Such alleviation at high nitrate was largely attributed to a stronger influence of infection on root biomass at low than at high nitrate fertilization. However, although C. campestris altered allometry and inhibited host photosynthesis, the magnitude of the effects was independent of nitrate fertilizations. The infection reduced light saturation point, net photosynthesis at saturating irradiances, apparent quantum yield, CO2 saturated rate of photosynthesis, carboxylation efficiency, the maximum carboxylation rate of Rubisco, and maximum light-saturated rate of electron transport, and increased light compensation point in host leaves similarly across nitrate levels, corresponding to a similar magnitude of negative effects of the parasite on host leaf soluble protein and Rubisco concentrations, photosynthetic nitrogen use efficiency and stomatal conductance across nitrate concentrations. Thus, the more severe inhibition in host growth at low than at high nitrate supplies cannot be attributed to a greater parasite-induced reduction in host photosynthesis, but the result of a higher proportion of host resources transferred to the parasite at
Directory of Open Access Journals (Sweden)
Jeri D Barak
Full Text Available BACKGROUND: In the U.S., tomatoes have become the most implicated vehicle for produce-associated Salmonellosis with 12 outbreaks since 1998. Although unconfirmed, trace backs suggest pre-harvest contamination with Salmonella enterica. Routes of tomato crop contamination by S. enterica in the absence of direct artificial inoculation have not been investigated. METHODOLOGY/PRINCIPAL FINDINGS: This work examined the role of contaminated soil, the potential for crop debris to act as inoculum from one crop to the next, and any interaction between the seedbourne plant pathogen Xanthomonas campestris pv. vesicatoria and S. enterica on tomato plants. Our results show S. enterica can survive for up to six weeks in fallow soil with the ability to contaminate tomato plants. We found S. enterica can contaminate a subsequent crop via crop debris; however a fallow period between crop incorporation and subsequent seeding can affect contamination patterns. Throughout these studies, populations of S. enterica declined over time and there was no bacterial growth in either the phyllosphere or rhizoplane. The presence of X. campestris pv. vesicatoria on co-colonized tomato plants had no effect on the incidence of S. enterica tomato phyllosphere contamination. However, growth of S. enterica in the tomato phyllosphere occurred on co-colonized plants in the absence of plant disease. CONCLUSIONS/SIGNIFICANCE: S. enterica contaminated soil can lead to contamination of the tomato phyllosphere. A six week lag period between soil contamination and tomato seeding did not deter subsequent crop contamination. In the absence of plant disease, presence of the bacterial plant pathogen, X. campestris pv. vesicatoria was beneficial to S. enterica allowing multiplication of the human pathogen population. Any event leading to soil contamination with S. enterica could pose a public health risk with subsequent tomato production, especially in areas prone to bacterial spot disease.
Institute of Scientific and Technical Information of China (English)
Soyoung Park; Ki Seob Kim; Jeong-Tae Kim; Daeseok Kang; Kijune Sung
2011-01-01
The use of humic acid (HA) to enhance the efficiency of phytodegradation of petroleum hydrocarbons in soil contaminated with diesel fuel was evaluated in this study.A sample of soil was artificially contaminated with commercially available diesel fuel to an initial total petroleum hydrocarbons (TPH) concentration of 2300 mg/kg and four heavy metals with concentrations of 400 mg/kg for Pb,200 mg/kg for Cu,12 mg/kg for Cd,and 160 mg/kg for Ni.Three plant species,Brassica campestris,Festuca arundinacea,and Helianthus annuus,were selected for the phytodegradation experiment.Percentage degradation of TPH in the soil in a control pot supplemented with HA increased to 45% from 30% without HA.The addition of HA resulted in an increases in the removal of TPH from the soil in pots planted with B.campestris,F.arundinacea,and H.annuus,enhancing percentage degradation to 86%,64%,and 85% from 45%,54%,and 66%,respectively.The effect of HA was also observed in the degradation of n-alkanes within 30 days.The rates of removal of n-alkanes in soil planted with B.campestris and H.annuus were high for n-alkanes in the range of C11-C28.A dynamic increase in dehydrogenase activity was observed during the last 15 days of a 30-day experimental period in all the pots amended with HA.The enhanced biodegradation performance for TPHs observed might be due to an increase in microbial activities and bioavailable TPH in soils caused by combined effects of plants and HA.The results suggested that HA could act as an enhancing agent for phytodegradation of petroleum hydrocarbons in soil contaminated with diesel fuel and heavy metals.
Identification of three potential insect vectors of Xylella fastidiosa in southern Italy
Directory of Open Access Journals (Sweden)
Toufic ELBEAINO
2014-09-01
Full Text Available In order to identify potential vectors of Xylella fastidiosa in olive orchards in Puglia (southern Italy, Hemiptera insects were collected from October to December, 2013, in olive orchards with high incidences of X. fastidiosa associated with “rapid decline” symptoms. The study focused on species in the Auchenorrhyncha (sharpshooter leafhoppers and froghoppers or spittlebugs, a group that includes known vectors of X. fastidiosa. Adults of three species, i.e. Philaenus spumarius L. (Aphrophoridae, Neophilaenus campestris Fallén (Aphrophoridae and Euscelis lineolatus Brullé (Cicadellidae were captured, from which total DNA was extracted and assayed by PCR using three sets of specific primers designed for X. fastidiosa detection. Results of PCR showed that 38 out of a total of 84 tested insects were positive for X. fastidiosa, i.e. eight (of 20 P. spumarius, 14 (of 18 N. campestris and 16 (of 46 E. lineolatus. PCR amplicons of the RNA polymerase sigma-70 factor gene from six specimens (two of each insect species were sequenced. The sequences obtained were 99.3‒99.4% identical. BlastN analyses demonstrated these sequences to be similar to those of X. fastidiosa isolates from olive OL-X and OL-G reported from Puglia, whereas they displayed distant molecular identity (always less than 98% with X. fastidiosa subspecies from other countries. The detection of X. fastidiosa in P. spumarius and, for the first time, in N. campestris and E. lineolatus (which, unlike the others, is a phloem feeder, indicates potential vectoring roles of these insects for the spread of the bacterium in Puglia. Further investigations and specific infectivity trials are required to definitively determine the roles of these insects as effective vectors of this pathogen.
Directory of Open Access Journals (Sweden)
Lorena Ruiz-Montoya
Full Text Available Host race formation in phytophagous insects can be an early stage of adaptive speciation. However, the evolution of phenotypic plasticity in host use is another possible outcome. Using a reciprocal transplant experiment we tested the hypothesis of local adaptation in the aphid Brevicoryne brassicae. Aphid genotypes derived from two sympatric host plants, Brassica oleracea and B. campestris, were assessed in order to measure the extent of phenotypic plasticity in morphological and life history traits in relation to the host plants. We obtained an index of phenotypic plasticity for each genotype. Morphological variation of aphids was summarized by principal components analysis. Significant effects of recipient host on morphological variation and life history traits (establishment, age at first reproduction, number of nymphs, and intrinsic growth rate were detected. We did not detected genotype × host plant interaction; in general the genotypes developed better on B. campestris, independent of the host plant species from which they were collected. Therefore, there was no evidence to suggest local adaptation. Regarding plasticity, significant differences among genotypes in the index of plasticity were detected. Furthermore, significant selection on PC1 (general aphid body size on B. campestris, and on PC1 and PC2 (body length relative to body size on B. oleracea was detected. The elevation of the reaction norm of PC1 and the slope of the reaction norm for PC2 (i.e., plasticity were under directional selection. Thus, host plant species constitute distinct selective environments for B. brassicae. Aphid genotypes expressed different phenotypes in response to the host plant with low or nil fitness costs. Phenotypic plasticity and gene flow limits natural selection for host specialization promoting the maintenance of genetic variation in host exploitation.
Directory of Open Access Journals (Sweden)
LISDAR IDWAN SUDIRMAN
2010-06-01
Full Text Available Lentinus cladopus LC4 produced at least eight antimicrobial compounds (ACs which are active against plant and human pathogens. Three ACs in its crude mycelial were extracted with methanol and partial purification was carried out with silicic acid column chromatography and by thin layer chromatography (PTLC. The antimicrobial activity was tested by paper disc method and antibiographic method. The chromatography purification eluted with dichloromethane containing 5% methanol gave one active fraction (FII. This fraction which was active against X. campestris pv. glycines and showing two inhibition zones against Bacillus subtilis on bioautographic plates with the Rfs 0.8 and 0.7. FI and FIII fractions eluted with dichloromethane containing 0 and 10% methanol performed one inhibition zone with Rfs 0.8 and 0.7 respectively. However, their activities were lower than that of FII fraction. The PLTC purification gave one separate fraction with Rf value of 0.73 and it was active against X. campestris pv. glycines. The compound of Rf 0.73 fraction should be further studied using TLC and HPLC to obtain the pure substance for molecule characterization.
Field dodder (Cuscuta campestris) control with flumioxazin
Field dodder is an important weed in alfalfa grown for seed production, requiring stringent control to keep the alfalfa seed free of dodder seed contamination. Pendimethalin has been the primary tool used to control dodder in alfalfa seed production for over 25 years. Flumioxazin was recently regis...
Identification and characterisation of Xanthomonas campestris pv
African Journals Online (AJOL)
Ednar Wulff
2013-02-06
Feb 6, 2013 ... strains as Xanthomonas, but only 32 as Xcc. PCR tests with primers targeting a fragment of the hrpF ... Cabbage heads affected by Xcc loose market ..... veins near the leaf margins using a mouse tooth forceps with teeth.
African Journals Online (AJOL)
user
that the bacterium was Xanthomonas campestris pv citri A and the disease was a form of citrus canker. The disease incidence ... declined from 88.3% to 1.7% in six years (2009-2014) without the application of any control measure. It was conjectured that .... on yeast nutrient agar in plates using a heat- sterilized inoculation ...
Fatty Acids from Pool Lipids as Possible Precursors of the Male Marking Pheromone in Bumblebees
Czech Academy of Sciences Publication Activity Database
Kofroňová, Edita; Nekola, Adam; Cvačka, Josef; Kindl, Jiří; Valterová, Irena
2014-01-01
Roč. 19, č. 2 (2014), s. 2330-2343 ISSN 1420-3049 R&D Projects: GA ČR GA203/09/1446; GA TA ČR TA01020969 Institutional support: RVO:61388963 Keywords : Bombus ruderatus * Bombus campestris * Bombus bohemicus * fat body * labial gland secretion * pheromone biosynthesis Subject RIV: CC - Organic Chemistry Impact factor: 2.416, year: 2014
Improvement of xanthan gum production in batch culture using ...
African Journals Online (AJOL)
Yomi
2011-12-21
Dec 21, 2011 ... In this study, the effect of acetic acid on the improvement of xanthan biosynthesis by Xanthomonas campestris b82 was investigated. ... shown that citric acid that is used as a chelating agent in medium to prevent the ... pH value close to the acid pKa) in the medium in one pulse, 30 h after incubation (at the ...
Mushrooms preserved by the combined effect of refrigeration and gamma irradiation
International Nuclear Information System (INIS)
Domenech, A.M.; Bauza de Faliti, M.; Bocklet, M.F.
1990-01-01
In this work, the combined effect of refrigeration and gamma irradiation on diverse physical parameters to be measured in mushrooms was studied. Mushrooms (Agaricus Campestris), 'bisporus' variety, of closed cap, were used. From the treatments tested, it was concluded that 0.5 KGy is the most suitable dosis to delay elongation, cap opening, stem length and surface moss growth. (Author) [es
etude de la résistance au flétrissement bactérien de lignées inter
African Journals Online (AJOL)
Administrator
4p. Mew, T. W., Vera Cruz, C. M. and Reyes, R. C.. 1992. Interaction of Xanthomonas campestris pv. oryzae and a resistance Rice Cultivar. Phytopathology 72: 786-789. Ouedraogo, S. L. Somda, I. Boro, F. et Seré, Y. 2004 Détection et caractérisation des bactéries phytopathogènes transmises par les semences du riz au ...
Bae, Chungyun; Han, Sang Wook; Song, Yu-Rim; Kim, Bo-Young; Lee, Hyung-Jin; Lee, Je-Min; Yeam, Inhwa; Heu, Sunggi; Oh, Chang-Sik
2015-07-01
Disease resistance against xylem-colonizing pathogenic bacteria in crops. Plant pathogenic bacteria cause destructive diseases in many commercially important crops. Among these bacteria, eight pathogens, Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, Erwinia amylovora, Pantoea stewartii subsp. stewartii, Clavibacter michiganensis subsp. michiganensis, Pseudomonas syringae pv. actinidiae, and Xylella fastidiosa, infect their host plants through different infection sites and paths and eventually colonize the xylem tissues of their host plants, resulting in wilting symptoms by blocking water flow or necrosis of xylem tissues. Noticeably, only a relatively small number of resistant cultivars in major crops against these vascular bacterial pathogens except X. oryzae pv. oryzae have been found or generated so far, although these pathogens threaten productivity of major crops. In this review, we summarize the lifestyles of major xylem-colonizing bacterial pathogens and then discuss the progress of current research on disease resistance controlled by qualitative disease resistance genes or quantitative trait loci against them. Finally, we propose infection processes of xylem-colonizing bacterial pathogens as one of possible reasons for why so few qualitative disease resistance genes against these pathogens have been developed or identified so far in crops.
International Nuclear Information System (INIS)
Hogetsu, Daisuke; Koyama, Motoko; Minami, Harufumi
1990-01-01
In the creation of useful mutant plants using cell culture techniques, the examination on the effectiveness of selecting useful mutation at cell level and the possibility of raising the selection efficiency by irradiation was aimed at. The experimental method is described. The young plants which accumulate proline were obtained. The cells which showed the resistance to hydroxyproline also showed the resistance to salt. In the improvement of redifferentiation ability by irradiation, the method of fixing IAA in the tissues of azuki plants was examined. The possibility of examining the change of IAA due to irradiation by microautoradiography was obtained. It is intended to examine the distribution of IAA in the formation of adventitious roots from the epicotyl of azuki plants. In the introduction of cell engineering techniques in radiation breeding, it is the objective to introduce the genes which resist sour rot that Brassica campestris, Brassica napus, Brassica oleracea and so on have by utilizing cell fusion process. The fusion of the reproduction cells of Brassica napus pollens and the cell protoplasts of Brassica campestris was successfully carried out. The possibility of new asymmetric fusion in Brassica napus was shown. (K.I.)
Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop
2015-01-01
Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048
Nissan, Gal; Gershovits, Michael; Morozov, Michael; Chalupowicz, Laura; Sessa, Guido; Manulis-Sasson, Shulamit; Barash, Isaac; Pupko, Tal
2018-02-01
Pantoea agglomerans, a widespread epiphytic bacterium, has evolved into a hypersensitive response and pathogenicity (hrp)-dependent and host-specific gall-forming pathogen by the acquisition of a pathogenicity plasmid containing a type III secretion system (T3SS) and its effectors (T3Es). Pantoea agglomerans pv. betae (Pab) elicits galls on beet (Beta vulgaris) and gypsophila (Gypsophila paniculata), whereas P. agglomerans pv. gypsophilae (Pag) incites galls on gypsophila and a hypersensitive response (HR) on beet. Draft genome sequences were generated and employed in combination with a machine-learning approach and a translocation assay into beet roots to identify the pools of T3Es in the two pathovars. The genomes of the sequenced Pab4188 and Pag824-1 strains have a similar size (∼5 MB) and GC content (∼55%). Mutational analysis revealed that, in Pab4188, eight T3Es (HsvB, HsvG, PseB, DspA/E, HopAY1, HopX2, HopAF1 and HrpK) contribute to pathogenicity on beet and gypsophila. In Pag824-1, nine T3Es (HsvG, HsvB, PthG, DspA/E, HopAY1, HopD1, HopX2, HopAF1 and HrpK) contribute to pathogenicity on gypsophila, whereas the PthG effector triggers HR on beet. HsvB, HsvG, PthG and PseB appear to endow pathovar specificities to Pab and Pag, and no homologous T3Es were identified for these proteins in other phytopathogenic bacteria. Conversely, the remaining T3Es contribute to the virulence of both pathovars, and homologous T3Es were found in other phytopathogenic bacteria. Remarkably, HsvG and HsvB, which act as host-specific transcription factors, displayed the largest contribution to disease development. © 2016 BSPP AND JOHN WILEY & SONS LTD.
Two-dimensional profiling of Xanthomonas campestris pv. viticola ...
African Journals Online (AJOL)
However, the analysis of the 2D-PAGE gel images revealed a larger number of spots in the lysis method when compared to the others. Taking ... Keywords: Bacterial canker, Vitis vinifera, proteomics, sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), two-dimensional gel electrophoresis (2D-PAGE).
Aerial stem and leaf morphoanatomy of some species of Smilax
Directory of Open Access Journals (Sweden)
Aline R. Martins
2013-06-01
Full Text Available This study aimed to describe the morphoanatomy of the aerial vegetative organs of seven Smilax species, used in Brazilian folk medicine. Samples of leaves and stems were fixed with FAA 50, embedded in historesin, sectioned on a rotary microtome, stained and mounted in synthetic resin. Cuticle ornamentation was analyzed with standard scanning electron microscopy. In the frontal view, the walls of the adaxial epidermis are straight in S. brasiliensis, S. cissoides, S. goyazana and sinuous in the other species. The walls of the epidermis on the abaxial surface are straight in S. brasiliensis, S. goyazana, S. rufescens, sinuous in S. campestris, S. fluminensis, S. oblongifolia, and wavy in S. cissoides. The stomata are paracytic in S. brasiliensis, S. goyazana, S. oblongifolia, and S. rufescens, anomocytic in S. cissoides, S. campestris; anisocytic and paracytic in S. fluminensis. The midrib has three vascular bundles that are individually wrapped by lignified cells in S. brasiliensis, S. cissoides, and S. fluminensis. In the other, the three vascular bundles are surrounded by a single lignified sheath. In the stems the vascular cylinder is surrounded by a sclerenchymatous ring with the exception of Smilax fluminensis, which has a starch sheath and internal layers of thin-walled cells.
Antibacterial activity of caffeine against plant pathogenic bacteria.
Sledz, Wojciech; Los, Emilia; Paczek, Agnieszka; Rischka, Jacek; Motyka, Agata; Zoledowska, Sabina; Piosik, Jacek; Lojkowska, Ewa
2015-01-01
The objective of the present study was to evaluate the antibacterial properties of a plant secondary metabolite - caffeine. Caffeine is present in over 100 plant species. Antibacterial activity of caffeine was examined against the following plant-pathogenic bacteria: Ralstonia solanacearum (Rsol), Clavibacter michiganesis subsp. sepedonicus (Cms), Dickeya solani (Dsol), Pectobacterium atrosepticum (Pba), Pectobacterium carotovorum subsp. carotovorum (Pcc), Pseudomonas syringae pv. tomato (Pst), and Xanthomonas campestris subsp. campestris (Xcc). MIC and MBC values ranged from 5 to 20 mM and from 43 to 100 mM, respectively. Caffeine increased the bacterial generation time of all tested species and caused changes in cell morphology. The influence of caffeine on the synthesis of DNA, RNA and proteins was investigated in cultures of plant pathogenic bacteria with labelled precursors: [(3)H]thymidine, [(3)H]uridine or (14)C leucine, respectively. RNA biosynthesis was more affected than DNA or protein biosynthesis in bacterial cells treated with caffeine. Treatment of Pba with caffeine for 336 h did not induce resistance to this compound. Caffeine application reduced disease symptoms caused by Dsol on chicory leaves, potato slices, and whole potato tubers. The data presented indicate caffeine as a potential tool for the control of diseases caused by plant-pathogenic bacteria, especially under storage conditions.
Variation in G lucosinolate C ontents of C ruciferous P lants
Directory of Open Access Journals (Sweden)
Won Park
2017-03-01
Full Text Available Glucosinolates are secondary metabolites of almost all plants of the order Brassicales, and have been known to control nematode populations. In this study, 14 glucosinolates were identified, quantified, and compared in several varieties and cultivars of cruciferous plants including Brassica campestris ssp. pekinensis (Chinese cabbage, Brassica juncea var. crispifolia L. H. Bailey (mustard, Brassica juncea L. Czern. var. juncea (leaf mustard, Brassica oleracea L. var. acephala (kale, Raphanus sativus L. (radish, and Brassica campestris L. ssp. oleifera (winter turnip rape. The most abundant glucosinolate in mustard, leaf mustard, kale, and radish was sinigrin. In leaf mustard, the sinigrin content ranged from 193.05 μmol/g to 215.52 μmol/g, and in mustard, the sinigrin contents of blue mustard and red mustard were 219.08 μmol/g and 215.73 μmol/g, respectively. Kale and radish contained 137.79 μmol/g and 120.25 μmol/g, respectively, of sinigrin. Gluconapin was the most abundant glucosinolate in winter turnip rape, at 121.17 μmol/g. Chinese cabbage contained mostly glucocochlearin (79.88 μmol/g. These results will be useful in the development of environmentally friendly plant-based pesticides by allowing for proper control of glucosinolates based on those present in the chosen plant species.
Bio-pesticidal and Antimicrobial Coumarins from Angelica dahurica (Fisch. Ex Hoffm
Directory of Open Access Journals (Sweden)
Qian Xie
2016-05-01
Full Text Available The air-dried aerial parts of Croton campestris, C. chaetocalyx, C. eriocladus, and C. glandulosus, with occurrence in the Eastern Brazilian Amazon, yielded essential oils, and their volatile constituents were analyzed by GC and GC-MS. Sesquiterpenes, both hydrocarbons and oxygenated, were the most highly represented classes in the oils: the former ranging from 55.3% to 85.1%, and the latter varying from 7.2% to 33.2%. The oils were separated into two groups using hierarchical cluster analysis whose main constituents were β-caryophyllene, germacrene D, γ-elemene, β-elemene, α-humulene and δ-elemene (Group A, C. campestris and C. eriocladus; and spathulenol, bicyclogermacrene, δ-elemene, germacrene D, β-caryophyllene and δ-cadinene (Group B, C. chaetocalyx and C. glandulosus. Percentage of sesquiterpene hydrocarbons was higher in Group A (83-85% than in Group B (55-63%. However, regarding the oxygenated sesquiterpenes, it was reversed, being bigger in Group B (28-33% than in Group A (7-8%. Percentage of similarity in Group A was 92% and in Group B it was 86%. These chemotaxonomic results showed a significant contribution for the better botanical knowledge of these four Croton species occurring in North Brazil.
Sotelo, T; Lema, M; Soengas, P; Cartea, M E; Velasco, P
2015-01-01
Glucosinolates (GSLs) are secondary metabolites found in Brassica vegetables that confer on them resistance against pests and diseases. Both GSLs and glucosinolate hydrolysis products (GHPs) have shown positive effects in reducing soil pathogens. Information about their in vitro biocide effects is scarce, but previous studies have shown sinigrin GSLs and their associated allyl isothiocyanate (AITC) to be soil biocides. The objective of this work was to evaluate the biocide effects of 17 GSLs and GHPs and of leaf methanolic extracts of different GSL-enriched Brassica crops on suppressing in vitro growth of two bacterial (Xanthomonas campestris pv. campestris and Pseudomonas syringae pv. maculicola) and two fungal (Alternaria brassicae and Sclerotinia scletoriorum) Brassica pathogens. GSLs, GHPs, and methanolic leaf extracts inhibited the development of the pathogens tested compared to the control, and the effect was dose dependent. Furthermore, the biocide effects of the different compounds studied were dependent on the species and race of the pathogen. These results indicate that GSLs and their GHPs, as well as extracts of different Brassica species, have potential to inhibit pathogen growth and offer new opportunities to study the use of Brassica crops in biofumigation for the control of multiple diseases. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Phytotoxic potential of celtis australis L. (family ulmaceae) against four crop species
International Nuclear Information System (INIS)
Ahmad, I.; Hussain, F.
2014-01-01
Bioassays were conducted to test the phytotoxic potential of Celtis australis against Trifolium alexandrinum, Brassica campestris, Triticum aestivum and Lactuca sativa under laboratory condition. Aqueous extracts from twigs and leaves were obtained by soaking 5 and 10g plant material in 100 ml distilled water for 24 and 48hr durations. Aqueous extracts significantly delayed/retarded the germination and reduced the plumule and radicle growth of all the four test species. Generally, extracts soaked for 48h especially 10 gm/100ml were inhibitory than 24h extracts of 5 or 10gm material. Extracts from twigs were inhibitory to germination of wheat while same extracts inhibited the plumule growth of B. campestris. Radicle growth of T. alexandrinum was inhibited more by twig extracts. Hot water extracts from twigs were less inhibitory than leaf extracts. Litter and mulch also significantly delayed the seed germination and retarded the overall growth of seedlings of all test species. The number and length of seminal roots of T. aestivum was suppressed by all aqueous extracts, added litter and mulch. The inhibitory response depended upon the test species, concentration, soaking duration and physiological parameters. The results suggested that Celtis australis has strong phytotoxic potential. (author)
Directory of Open Access Journals (Sweden)
Samir Rezki
2016-04-01
Full Text Available Seeds are involved in the vertical transmission of microorganisms from one plant generation to another and consequently act as reservoirs for the plant microbiota. However, little is known about the structure of seed-associated microbial assemblages and the regulators of assemblage structure. In this work, we have assessed the response of seed-associated microbial assemblages of Raphanus sativus to invading phytopathogenic agents, the bacterial strain Xanthomonas campestris pv. campestris (Xcc 8004 and the fungal strain Alternaria brassicicola Abra43. According to the indicators of bacterial (16S rRNA gene and gyrB sequences and fungal (ITS1 diversity employed in this study, seed transmission of the bacterial strain Xcc 8004 did not change the overall composition of resident microbial assemblages. In contrast seed transmission of Abra43 strongly modified the richness and structure of fungal assemblages without affecting bacterial assemblages. The sensitivity of seed-associated fungal assemblage to Abra43 is mostly related to changes in relative abundance of closely related fungal species that belong to the Alternaria genus. Variation in stability of the seed microbiota in response to Xcc and Abra43 invasions could be explained by differences in seed transmission pathways employed by these micro-organisms, which ultimately results in divergence in spatio-temporal colonization of the seed habitat.
International Nuclear Information System (INIS)
Razaq, M.; Farooq, M.; Abbas, G.; Rehman, H. M.; Iqbal, M.
2016-01-01
Aphids cause heavy yield losses to Brassicaceous species by affecting various physiological and biochemical processes including photosynthesis. In the present study, seasonal activity of aphid population and its impact on some brassicaceous species was assessed. Three brassicaceous species (Brassica campestris, Brassica carinata, Eruca sativa) were grown in field following standard agricultural practices. Plants of control plots retained aphid free by insecticide spray, whereas treatment plots were freely allowed for aphid infestation. There was also intermediate treatment of partial aphid infestation where insecticidal spray was applied two times. Peak populations of both aphid species were observed in the 2nd week of March during which plant photosynthetic attributes were recorded. At the time of maturity, yield attributes were also recorded. From the results, it is obvious that application of insecticide significantly reduced the aphid populations on the three brassicaceous species and enhanced the crop yield. Yield losses due to aphid infestation were maximal in Brassica campestris followed by B. carinata whereas it was minimal in Eruca sativa. Yield losses in Brassica campestris and B. carinata were due to reduction in number of pods per plant, number of seeds per pod and size of seeds, whereas yield losses due to aphid infestation in Eruca sativa was mainly attributed to reduction in number of pods per plant. Although insecticidal spray reduced the aphid population and increased growth and productivity of all brassicaceous species, it did not change photosynthetic capacity of all plants except in Eruca sativa. Moreover, growth and yield reduction was not associated with stomatal factors of photosynthesis. Chlorophyll contents measured as SPAD values were reduced due to aphid infestation which is positively associated with yield reduction. Insecticidal spray increased chlorophyll contents in these three brassicaceous species by reducing aphid population
Ibañez, Lucía M.; Girini, Juan M.; Palacio, Facundo X.; Fiorini, Vanina D.; Montalti, Diego
2017-01-01
Resumen: El estornino pinto, Sturnus vulgaris, es un ave introducida en Argentina que nidifica en cavidades y puede desplazar a otras aves de sus nidos. Durante las temporadas reproductivas 2010 y 2011 observamos en el parque Pereyra Iraola 3 intentos de usurpación de nidos de aves nativas, hornero (Furnarius rufus), carpintero real (Colaptes melanochloros) y carpintero campestre (C. campestris). Además, en 2 ocasiones se observaron estorninos nidificando en cavidades que estaban construyendo...
DEFF Research Database (Denmark)
Mbega, Ernest Rashid; Wulff, Ednar Gadelha; Mabagala, R.B.
2012-01-01
of Xanthomonas campestris pv. malvacearum, were pathogenic on tomato and pepper plants. Strains identified by Biolog as Sphingomonas sanguinis and Sphingomonas terrae also incited black rot symptoms on pepper leaves. However, bacterial strains belonging to the genus Stenotrophomonas, Chryseobacterium, Pantoea...... and Flavobacterium were not pathogenic on tomato and pepper. Phylogenetic analysis showed that strains of the genus Xanthomonas are more closely related to Stenotrophomonas and Pantoea compared to the other bacterial genera found in tomato seeds....
Evaluation of Tolerance in Sugarbeet Varieties to Dodder
Directory of Open Access Journals (Sweden)
F Fallahpour
2013-10-01
Full Text Available Dodder is an obligate parasite of many plant families and among dodder species Cuscuta campestris has the most diverse around the world. Extensive infestation to dodder recently has been reported in some sugerbeet production regions of Khorasan provinces. So, in this study greenhouse and field experiments were conducted to test and charachterize the tolerance of commercial sugarbeet varieties to C. campestris. A completely randomized design with five replications and a randomized complete block design with three replications were used for the greenhouse and field experiments, respectively. Treatments were five common varieties of sugarbeet included Castille, Paulina, Brigitta, Flores and Laetitia with dodder infestation and control treatments (sugarbeet varieties without infestation. Traits measured were shoot and root dry weight of sugerbeet, dry weight of dodder, the number of houstorium on shoot of sugerbeet, growth percentage of dodder and sugerbeet. The results indicated that varieties showed different levels of tolerance to dodder infection. The variety of Flores had the most percentage of shoot and root dry weight and Paulina with 13.48% of root dry weight and 31.96% of shoot dry weight compared to control showed the least tolerance. Whereas the number of houstorium and dodder dry weight had the most and the least amount in Castille and Flores, respectively. In this experiment Flores variety exhibited tolerance to dodder and Castille was known as susceptible variety.
Directory of Open Access Journals (Sweden)
Kyusik Jeong
2011-04-01
Full Text Available The aim of this research was to develop specific and sensitive PCR-based procedures for simultaneous detection of economically important plant pathogenic bacteria and seed borne virus in commercial Brassicaceae crop seeds, Xanthomonns campestris pv. campestris (Xcc and Lettuce Mosaic Virus (LMV. Bacterial and virus diseases of Brassicaceae leaves are responsible for heavy losses. PCR with arbitral primers: selection of specific primers, performance of PCR with specific primers and determination of the threshold level for pathogens detection. To detect simultaneously the Xcc and LMV in commercial Brassicaceae crop seeds (lettuce, kohlrabi, radish, chinese cabbage and cabbage, two pairs of specific primer (LMV-F/R, Xcc-F/R were synthesized by using primer-blast program (http://www.ncbi.nlm.nih.gov/tools/ primer-blast/. The multiplex PCR for the two pathogens in Brassicaceae crop seeds could detect specifically without interference among primers and/or cDNA of other plant pathogens. The pathogen detection limit was determined at 1 ng of RNA extracted from pathogens. In the total PCR results for pathogen detection using commercial kohlrabi (10 varieties, lettuce (50 varieties, radish (20 varieties, chinese cabbage (20 varieties and cabbage (20 varieties, LMV and Xcc were detected from 39 and 2 varieties, respectively. In the PCR result of lettuce, LMV and Xcc were simultaneously detected in 8 varieties.
Toxicity of twenty-two plant essential oils against pathogenic bacteria of vegetables and mushrooms.
Todorović, Biljana; Potočnik, Ivana; Rekanović, Emil; Stepanović, Miloš; Kostić, Miroslav; Ristić, Mihajlo; Milijašević-Marčić, Svetlana
2016-12-01
ASBTRACT Toxicity of twenty-two essential oils to three bacterial pathogens in different horticultural systems: Xanthomonas campestris pv. phaseoli (causing blight of bean), Clavibacter michiganensis subsp. michiganensis (bacterial wilt and canker of tomato), and Pseudomonas tolaasii (causal agent of bacterial brown blotch on cultivated mushrooms) was tested. Control of bacterial diseases is very difficult due to antibiotic resistance and ineffectiveness of chemical products, to that essential oils offer a promising alternative. Minimal inhibitory and bactericidal concentrations are determined by applying a single drop of oil onto the inner side of each plate cover in macrodilution assays. Among all tested substances, the strongest and broadest activity was shown by the oils of wintergreen (Gaultheria procumbens), oregano (Origanum vulgare), and lemongrass (Cymbopogon flexuosus. Carvacrol (64.0-75.8%) was the dominant component of oregano oils, while geranial (40.7%) and neral (26.7%) were the major constituents of lemongrass oil. Xanthomonas campestris pv. phaseoli was the most sensitive to plant essential oils, being susceptible to 19 oils, while 11 oils were bactericidal to the pathogen. Sixteen oils inhibited the growth of Clavibacter michiganensis subsp. michiganensis and seven oils showed bactericidal effects to the pathogen. The least sensitive species was Pseudomonas tolaasii as five oils inhibited bacterial growth and two oils were bactericidal. Wintergreen, oregano, and lemongrass oils should be formulated as potential biochemical bactericides against different horticultural pathogens.
Ruminal degradation of aerial biomass and seeds of wild species of Lupinus
Pablo-Pérez, Maricela; Lagunes-Espinoza, Luz del C; Ramos-Juárez, Jesús; López-Upton, Javier; Aranda-Ibáñez, Emilio M; Vargas-Villamil, Luis
2014-01-01
Ruminal degradation of dry matter (DMD) and crude protein (CPD) for aerial biomass at the flowering stage and for the seeds of L. campestris, L. exaltatus, L. hintonii and L. montanus was determined using the nylon bag technique with two fistulated steers in five incubation times (3, 9, 12, 24 and 48 h), including a sample of soybean paste (SP). The data obtained were analyzed using PROC MIXED of SAS for repeated measures. The results showed interactions between species and incubation time fo...
International Nuclear Information System (INIS)
Tong, J.Y.; Sun, N.B.; Wu, H.K.
2013-01-01
A new 1, 3, 4-thiadiazole compound, N-(5-(o-tolyl)-1,3,4-thiadiazol-2-yl) cyclopropanecarboxamide, was synthesized and its structure was confirmed by 1H NMR, MS and HRMS. The single crystal structure of the title compound was determined by X-ray diffraction. The preliminary biological test showed that the synthesized compound has moderate herbicidal activity against Brassica campestris and fungicidal activities against Sclerotinia sclerotiorum(Lib.) de Bary, Rhizoctonia solanii, Fusarium oxysporum, Corynespora cassiicola, and Botrytis cinerea. (author)
Valverde Gómez, José Antonio, 1926-2003
2008-01-01
Listado de las especies observadas durante numerosas salidas de campo a Alceda (Corvera de Toranzo), Obregón y Sel de la Carrera (Luena), en Cantabria, realizadas entre 1942 y 1950, entre las que se incluyen las siguientes aves: Accipiter gentilis (Azor común), Accipiter nisus (Gavilán común, también llamado Astur palumbarius por el autor), Actitis hypoleucos (Andarríos chico, llamado Actynioides hypoleucus por el autor), Aegithalos caudatus (Mito), Anthus campestris (Bisbita campestre), Alce...
SR-XRF imaging of Cs highly accumulated in vegetables
International Nuclear Information System (INIS)
Nakai, Izumi; Oda, Nahoko; Terada, Yasuko
2011-01-01
Accumulation of Cs in vegetables was studied with regard to the remediation of radioactive Cs from a nuclear plant accident in Fukushima. It was found that Brassica oleracea var. capitata, Brassica campestris var. perviridis, and Lactuca sativa accumulated Cs to a level of more than 10000 ppm (dry weight) when they were cultivated in 1 mM Cs solution. Two-dimensional distributions of Cs were revealed by SR-XRF imaging showing a homogeneous distribution of Cs in the plant bodies. (author)
Study on the Occurrence and Epidemic Model of Rape Sclerotinia Stem Rot of ‘Zheyou 50’
Xu Sen-fu; Wang Hui-fu; Yu Shanhong; Wang En-guo
2013-01-01
In order to investigate invading and epidemic rules of rape sclerotinia stem rot of ‘Zheyou 50’ and promote the development of brassica campestris industry, this paper studied the outbreak regularity and epidemic model of rape sclerotinia stem rot according to field investigation and infection. The result showed that machinery direct seeding rape was good for the occurrence of sclerotinia stem rot for the reason of late seeding and high density. The period from water damage appeared to wiltin...
Directory of Open Access Journals (Sweden)
Janice Izabel Druzian
2007-03-01
Full Text Available Goma xantana é um heteropolissacarídeo hidrosolúvel, produzida industrialmente por fermentação da sacarose por Xanthomonas campestris. Suas excelentes propriedades reológicas contribuem para o grande número de aplicações na indústria de alimentos e recuperação terciária de petróleo. Economicamnte a utilização petroquímica não é ainda viável em função do custo da sacarose, o que torna interessante estudar fontes de carbonos alternativas, como é o caso do resíduo do suco de maçã. As cepas de Xanthomonas campestris pv maniothis foram mantidas em agar YM a 4 °C, e o inóculo foi incubado em meio YM. A produção de goma foi realizada nos meios fermentativos I e II, com sacarose como fonte de carbono padrão, e como fonte alternativa o resíduo de maçã fuji. A fermentação em Incubadora/28 °C/150 rpm produziu goma precipitada em álcool. A condição otimizada de 45 g.L-1 de meio II (0,05% uréia, 0,5% de KH2PO4 e 70% de resíduo representou um rendimento 10 vezes maior do que o obtido com sacarose. Por CG-EM obteve-se 44,53% de manose, 34,76% de glicose e 20,71% de ácido glucurônico para a composição desta goma. O uso de resíduo de maçã para produção de goma xantana é viável porque pode ser usado com um substrato suplementar e apresentar rendimento de goma muito superior ao obtido com sacarose.Xanthan gum is heteropolysaccharide aquosoluble produced industrially for fermentation with sucrose by Xanthomonas campestris. Excellent gum rheological properties contribute to the use in a wide range of applications in the food industry and tertiary recovery of oil. Commercially, the use of petrochemical is no longer viable in the cost of sucrose, which makes it interesting to evaluate alternative carbon sources such as the residue from apple juice processing. The Xanthomonas campestris pv maniothis was maintained at 4 °C on YM agar slants and innocuous in a medium of YM. Gum production was carried out in
Lee, Young Hee; Kim, Sang Hee; Yun, Byung-Wook; Hong, Jeum Kyu
2014-09-01
Two cultivars Buram-3-ho (susceptible) and CR-Hagwang (moderate resistant) of kimchi cabbage seedlings showed differential defense responses to anthracnose (Colletotrichum higginsianum), black spot (Alternaria brassicicola) and black rot (Xanthomonas campestris pv. campestris, Xcc) diseases in our previous study. Defense-related hormones salicylic acid (SA), jasmonic acid (JA) and ethylene led to different transcriptional regulation of pathogenesis-related (PR) gene expression in both cultivars. In this study, exogenous application of SA suppressed basal defenses to C. higginsianum in the 1st leaves of the susceptible cultivar and cultivar resistance of the 2nd leaves of the resistant cultivar. SA also enhanced susceptibility of the susceptible cultivar to A. brassicicola. By contrast, SA elevated disease resistance to Xcc in the resistant cultivar, but not in the susceptible cultivar. Methyl jasmonate (MJ) treatment did not affect the disease resistance to C. higginsianum and Xcc in either cultivar, but it compromised the disease resistance to A. brassicicola in the resistant cultivar. Treatment with 1-aminocyclopropane-1-carboxylic acid (ACC) ethylene precursor did not change resistance of the either cultivar to C. higginsianum and Xcc. Effect of ACC pretreatment on the resistance to A. brassicicola was not distinguished between susceptible and resistant cultivars, because cultivar resistance of the resistant cultivar was lost by prolonged moist dark conditions. Taken together, exogenously applied SA, JA and ethylene altered defense signaling crosstalk to three diseases of anthracnose, black spot and black rot in a cultivar-dependent manner.
Antimicrobial constituents of the leaves of Mikania micrantha H. B. K.
Directory of Open Access Journals (Sweden)
Yan Li
Full Text Available BACKGROUND: To isolate plant-derived compounds with antimicrobial activity from the leaves of Mikania micrantha, to determine the compounds configuration, and to evaluate their antimicrobial activity against eight plant pathogenic fungi (Exserohilum turcicum, Colletotrichum lagenarium, Pseudoperonispora cubensis, Botrytis cirerea, Rhizoctonia solani, Phytophthora parasitica, Fusarium solani, and Pythium aphanidermatum, and four plant pathogenic bacteria (gram negative bacteria: Ralstonia dolaanacearum, Xanthomonas oryzae pv. Oryzae, Xanthomonas Campestris pv. Vesicatoria, and Xanthomonas campestris pv. Citri, and four bacteria (gram positive bacteria: Staphyloccocus aureus, Bacillus subtilis, Micrococcus luteus, and Bacillus cereus. METHODS AND RESULTS: Antimicrobial constituents of the leaves of M. micrantha were isolated using bioactivity- guided fractionation. The antifungal activity of the isolated compounds was evaluated by the inhibit hypha growth method and inhibit spore germination method. Characterization of antibacterial activity was carried out using the minimum inhibitory concentrations (MICs and the minimum bactericidal concentrations (MBCs. MIC and MBC were determined by the broth microdilution method. Six compounds - deoxymikanolide, scandenolide, dihydroscandenolide, mikanolide, dihydromikanolide, and m - methoxy benzoic acid - have been isolated from leaves of Mikania micrantha H. B. K. Deoxymikanolide, scandenolide, and dihydroscandenolide were new compounds. The result of bioassay showed that all of isolated compounds were effective against tested strains and deoxymikanolide showed the strongest activity. CONCLUSIONS AND SIGNIFICANCE: The leaves of M. micrantha may be a promising source in the search for new antimicrobial drugs due to its efficacy and the broadest range. Meanwhile, adverse impact of M. micrantha will be eliminated.
Directory of Open Access Journals (Sweden)
Young Hee Lee
2014-09-01
Full Text Available Two cultivars Buram-3-ho (susceptible and CR-Hagwang (moderate resistant of kimchi cabbage seedlings showed differential defense responses to anthracnose (Colletotrichum higginsianum, black spot (Alternaria brassicicola and black rot (Xanthomonas campestris pv. campestris, Xcc diseases in our previous study. Defense-related hormones salicylic acid (SA, jasmonic acid (JA and ethylene led to different transcriptional regulation of pathogenesis-related (PR gene expression in both cultivars. In this study, exogenous application of SA suppressed basal defenses to C. higginsianum in the 1st leaves of the susceptible cultivar and cultivar resistance of the 2nd leaves of the resistant cultivar. SA also enhanced susceptibility of the susceptible cultivar to A. brassicicola. By contrast, SA elevated disease resistance to Xcc in the resistant cultivar, but not in the susceptible cultivar. Methyl jasmonate (MJ treatment did not affect the disease resistance to C. higginsianum and Xcc in either cultivar, but it compromised the disease resistance to A. brassicicola in the resistant cultivar. Treatment with 1-aminocyclopropane-1-carboxylic acid (ACC ethylene precursor did not change resistance of the either cultivar to C. higginsianum and Xcc. Effect of ACC pretreatment on the resistance to A. brassicicola was not distinguished between susceptible and resistant cultivars, because cultivar resistance of the resistant cultivar was lost by prolonged moist dark conditions. Taken together, exogenously applied SA, JA and ethylene altered defense signaling crosstalk to three diseases of anthracnose, black spot and black rot in a cultivar-dependent manner.
Germination and seedling morphology of four South American Smilax (Smilacaceae
Directory of Open Access Journals (Sweden)
Aline Redondo Martins
2012-03-01
Full Text Available Species of Smilax, also known as greenbrier, are widely distributed in Brazil and their commercial trades are carried out by the extractivism of native species. We the aim to provide information about the germination and development of seedlings in four Smilax species, different experiments were developed under controlled conditions. We evaluated two germination treatments: temperature (30ºC and 20-30ºC and light (presence/ absence, and for few cases the tetrazolium treatment was applied. A different treatment response was observed among the studied species. Light had a significant influence in S. brasiliensis, with the highest germination rates at 20-30ºC in dark conditions. S. campestris showed significant differences among temperature treatments, but not to light; while S. cissoides showed high germination rates (66-78%, independently of treatment. However, S. polyantha had low germination rates (19-24%. After one year, the expanded leaves showed different characteristics among the studied species. Leaves of S. brasiliensis were ovate, coriaceous, three main veins and prickle-like structures only on the midrib on abaxial face. S. campestris leaves were oblong, coriaceous and prickle-like structures were located at the leaf midrib and margin. S. cissoides had ovate-elliptic, membranaceous leaves, with three main veins with prickle-like structures on the abaxial face. S. polyantha leaves showed ovateelliptic, coriaceous leaves, with three main veins, translucent secondary veins and no prickle-like structures. A seedling identification key was elaborated based on morphological characteristics.
Germination and seedling morphology of four South American Smilax (Smilacaceae).
Martins, Aline Redondo; Soares, Anielca Nascimento; Bombo, Aline Bertolosi; Fidelis, Alessandra; Novembre, Ana Dionisia da Luz Coelho; da Glória, Beatriz Appezzato
2012-03-01
Species of Smilax, also known as greenbrier, are widely distributed in Brazil and their commercial trades are carried out by the extractivism of native species. We the aim to provide information about the germination and development of seedlings in four Smilax species, different experiments were developed under controlled conditions. We evaluated two germination treatments: temperature (30 degrees C and 20-30 degrees C) and light (presence/ absence), and for few cases the tetrazolium treatment was applied. A different treatment response was observed among the studied species. Light had a significant influence in S. brasiliensis, with the highest germination rates at 20-30 degrees C in dark conditions. S. campestris showed significant differences among temperature treatments, but not to light; while S. cissoides showed high germination rates (66-78%), independently of treatment. However, S. polyantha had low germination rates (19-24%). After one year, the expanded leaves showed different characteristics among the studied species. Leaves of S. brasiliensis were ovate, coriaceous, three main veins and prickle-like structures only on the midrib on abaxial face. S. campestris leaves were oblong, coriaceous and prickle-like structures were located at the leaf midrib and margin. S. cissoides had ovate-elliptic, membranaceous leaves, with three main veins with prickle-like structures on the abaxial face. S. polyantha leaves showed ovate-elliptic, coriaceous leaves, with three main veins, translucent secondary veins and no prickle-like structures. A seedling identification key was elaborated based on morphological characteristics.
Microflora en semillas de frijol
Directory of Open Access Journals (Sweden)
Jos\\u00E9 B. Membre\\u00F1o
2001-01-01
Full Text Available Microflora en semillas de frijol (Phaseolus vulgaris L.. Se estudió la microflora bacteriana presente en semillas de frijol y su relación con Xanthomonas campestris pv. phaseoli (Xcp, en 118 genotipos procedentes de VIDAC-98, INTA- Nicaragua, TARS-USDA e Isabela-P.R. Se utilizaron cinco métodos de aislamiento: semilla desinfectada con hipoclorito de sodio, semilla en caldo nutritivo refrigerada por una hora, dispersión de 0,1 ml de suspensión de semillas en medio sólido, siembra líquida de 1 ml de suspensión y semilla en caldo nutritivo, agitado y refrigerado por 24 horas. Se aislaron 104 colonias amarillas de 41 genotipos. Treinta y seis colonias fueron KOH positivo (Gram negativo, 68 negativo (Gram positivo y 34 hidrolizaron almidón. Las colonias de pigmentación amarilla resultaron no patogénicas bajo condiciones de invernadero. Estas se identificaron con el sistema BIOLOG como: Pantoea agglomerans (25, Xanthomonas campestris (2, Enterobacter agglomerans (2, Sphingomonas paucimobilis (2, Pseudomonas fluorescens y Flavimonas oryzihabitans. En adición, los genotipos portaron colonias con pigmentación distinta a la amarilla. En las pruebas de antagonismo se identificaron colonias con actividad de deoxyribonucleasa y de antibiosis a Xcp. De éstas, 15 colonias inhibieron a Xcp significativamente. Se identificaron los hongos Rhizoctonia solani, Penicillium spp., Fusarium spp., Aspergillus flavus, Rhizopus nigricans y Macrophomina phaseolina en un 52,9 % del total de genotipos evaluados
Ionescu, Michael; Baccari, Clelia; Da Silva, Aline Maria; Garcia, Angelica; Yokota, Kenji; Lindow, Steven E.
2013-01-01
Xylella fastidiosa, like related Xanthomonas species, employs an Rpf cell-cell communication system consisting of a diffusible signal factor (DSF) synthase, RpfF, and a DSF sensor, RpfC, to coordinate expression of virulence genes. While phenotypes of a ΔrpfF strain in Xanthomonas campestris could be complemented by its own DSF, the DSF produced by X. fastidiosa (XfDSF) did not restore expression of the XfDSF-dependent genes hxfA and hxfB to a ΔrpfF strain of X. fastidiosa, suggesting that Rp...
Alternaria resistance of Brassicae campestris L. improved by induced mutations
International Nuclear Information System (INIS)
Das, M.L.; Rahman, A.
1989-01-01
Full text: Seeds of 'YS 52', a cultivar susceptible to Alternaria brassicae (Berk.) Sacc., were exposed to gamma rays (30-90 kR). Eight more resistant mutants were selected in M3 and subjected to further field evaluation. The best mutant '17-5-83' appeared resistant and gave 44% higher yield than the parent, mutant '70-7-82' was found to be moderately resistant and gave a yield 21% higher than the parent. The yield increases seem to be connected with plant architecture changes. (author)
Directory of Open Access Journals (Sweden)
Luiz A M Peruch
2006-12-01
Full Text Available O objetivo deste trabalho foi avaliar a intensidade da alternariose, causada por Alternaria brassicicola e/ou Alternaria brassicae, e da podridão negra, causada por Xanthomonas campestris pv. campestris, em cultivos orgânicos de brássicas em Pernambuco e Santa Catarina. Os levantamentos foram realizados no período de novembro de 2001 a fevereiro de 2002, num total de 103 cultivos orgânicos de várias espécies de brássicas. Foram registradas elevadas prevalências das doenças nos estados, com exceção em couve-chinesa em Santa Catarina. A prevalência da alternariose foi 100% nos cultivos de brócolis em Pernambuco, bem como em couve-flor nos dois estados, enquanto a podridão negra atingiu esse nível nos cultivos de brócolis e couve-flor em Santa Catarina. Na média das diferentes espécies de brássicas, as doenças foram mais prevalentes em Pernambuco que Santa Catarina. Entretanto, as médias de severidade de cada doença no conjunto das brássicas não foram diferentes entre os estados, embora as condições climáticas tenham sido nitidamente distintas. A severidade da alternariose variou entre as espécies de brássicas somente em Pernambuco, com a menor severidade registrada em couve-manteiga. Em relação à podridão negra, apenas em Santa Catarina houve diferença na severidade entre as brássicas, sendo registrados os menores níveis em couve-chinesa. Não foram constatadas correlações significativas entre os níveis de severidade da alternariose e da podridão negra, bem como da severidade destas com o número total de plantas e a idade das plantas nos cultivos.The objective of this research was to evaluate the intensity of Alternaria black spot, caused by Alternaria brassicicola and/or Alternaria brassicae, and black rot, caused by Xanthomonas campestris pv. campestris in organic cultivation of brassicas in Pernambuco and Santa Catarina. The survey was carried aut from November 2001 to February 2002, in 103 fields under
Medicinal significance of vegetables cultivated over minerals supplemented soil
International Nuclear Information System (INIS)
Bangash, J.A.; Arif, M.; Khan, F.; Khan, F.; Khan, A.S.
2010-01-01
Three winter season vegetables Fenugreek/Methi (Trigonella-foenum-graceum), Sarson (Brassica-campestris-var-sarson) and Garlic (Allium-sativum) were included in the present study to determine some of their mineral components and see if some of their mineral (Cr, Zn, Mn, Cu, Mg and Fe) content could be increased by supplementation through their roots. Thus calculated amount of Cr, Zn, Mn, Cu, Mg and Fe salts (as fertilizer) were applied in solution form to the roots of vegetables in different concentration as individual or in combinations. These vegetables were grown from seeds in the soil plot. After harvesting vegetables were dried, acid digested and analyzed for Cr, Mn, Zn, Cu, Fe and Mg on Hitachi Zeeman Japan Z-8000, Atomic Absorption Spectrophotometer. Thus in Fenugreek/Methi (Trigonella-foenum-graceum) total increase of Cr, Zn, Mn, Mg and Fe recorded was (10, 94, 10, 256 and 520) mg/Kg dry weight basis; in Sarson (Brassica-campestris-var-sarson) total increase of Cr, Zn, Mn and Mg recorded was (12, 30, 22 and 424) mg/Kg dry weight basis and ( Garlic) (Allium-sativum) total increase of Cr, Zn, Mn, Cu, Mg and Fe recorded was (14, 28, 4, 4, 116 and 10) mg/Kg dry weight basis. From the present study it can be concluded that by changing the soil minerals environment the uptake of required mineral content of vegetables, perhaps could be enhanced. This could play important role in management of diabetes control and also in the elimination of other deficiency diseases like anemia. (author)
Energy Technology Data Exchange (ETDEWEB)
Boufennara, S.; Lopez, S.; Boussebouna, H.; Bodas, R.; Bouazza, L.
2012-11-01
Many wild browse and bush species are undervalued mainly because of insufficient knowledge about their potential feeding value. The objective was to evaluate some nutritional attributes of various Algerian browse and shub species (Atriplex halimus, Artemisia campestris, Artemisia herba-alba, Astragalus gombiformis, Calobota saharae, Retama raetam, Stipagrostis pungens, Lygeum spartum and Stipa tenacissima). Chemical composition, phenols and tannins concentration, in vitro digestibility, in vitro gas production kinetics and in vitro bio-assay for assessment of tannins using buffered rumen fluid, and in situ disappearence of the edible parts of the plants (leaves, thin twigs and flowers) were determined. In general, protein content in dicotyledon species was always greater than in monocotyledon grasses, these showing higher neutral and acid detergent fibre and lower lignin contents than dicots. The tannin concentrations varied considerably between species, but in general the plants investigated in this study had low tannin contents (except for Artemisia spp. and S. tenacissima). Monocots showed lower in vitro and in situ digestibilities, fermentation rate, cumulative gas production and extent of degradation than dicot species. The plants were clustered by principal components analysis in two groups: poor-quality grasses and the most digestible dicot species. Chemical composition (neutral detergent fibre and protein) and digestibility were the main influential variables determining the ranking. In conclusion, A. halimus, A. campestris, A. herba-alba and A. gombiformis can be considered of greater nutritional value than the highly fibrous and low digestible grasses (S. pungens, L. spartum and S. tenacissima) that should be considered emergency roughages. (Author) 46 refs.
Waterfowl endozoochory: An overlooked long-distance dispersal mode for Cuscuta (dodder).
Costea, Mihai; Stefanović, Saša; García, Miguel A; De La Cruz, Susan; Casazza, Michael L; Green, Andy J
2016-05-01
Dispersal of parasitic Cuscuta species (dodders) worldwide has been assumed to be largely anthropomorphic because their seeds do not match any previously known dispersal syndrome and no natural dispersal vectors have been reliably documented. However, the genus has a subcosmopolitan distribution and recent phylogeographic results have indicated that at least18 historical cases of long-distance dispersal (LDD) have occurred during its evolution. The objective of this study is to report the first LDD biological vector for Cuscuta seeds. Twelve northern pintails (Anas acuta) were collected from Suisun Marsh, California and the contents of their lowest part of the large intestine (rectum) were extracted and analyzed. Seed identification was done both morphologically and using a molecular approach. Extracted seeds were tested for germination and compared to seeds not subjected to gut passage to determine the extent of structural changes caused to the seed coat by passing through the digestive tract. Four hundred and twenty dodder seeds were found in the rectum of four northern pintails. From these, 411 seeds were identified as Cuscuta campestris and nine as most likely C. pacifica. The germination rate of C. campestris seeds after gut passage was 55%. Structural changes caused by the gut passage in both species were similar to those caused by an acid scarification. Endozoochory by waterbirds may explain the historical LDD cases in the evolution of Cuscuta. This also suggests that current border quarantine measures may be insufficient to stopping spreading of dodder pests along migratory flyways. © 2016 Botanical Society of America.
Alves-Silva, Estevão; Del-Claro, Kleber
2013-06-01
Fires in the Cerrado savanna are a severe form of disturbance, but some species are capable of resprouting afterwards. It is unknown, however, how and whether post-fire resprouting represents a stressful condition to plants and how their rapid re-growth influences both the production of biochemical compounds, and interactions with mutualistic ants. In this study, we examined the influence of post-fire resprouting on biotic interactions (ant-plant-herbivore relationships) and on plant stress. The study was performed on two groups of the extrafloral nectaried shrub Banisteriopsis campestris (Malpighiaceae); one group was recovering from fire while the other acted as control. With respect to biotic interactions, we examined whether resprouting influenced extrafloral nectar concentration (milligrams per microliter), the abundance of the ant Camponotus crassus and leaf herbivory rates. Plant stress was assessed via fluctuating asymmetry (FA) analysis, which refers to deviations from perfect symmetry in bilaterally symmetrical traits (e.g., leaves) and indicates whether species are under stress. Results revealed that FA, sugar concentration, and ant abundance were 51.7 %, 35.7 % and 21.7 % higher in resprouting plants. Furthermore, C. crassus was significantly associated with low herbivory rates, but only in resprouting plants. This study showed that post-fire resprouting induced high levels of plant stress and influenced extrafloral nectar quality and ant-herbivore relationships in B. campestris. Therefore, despite being a stressful condition to the plant, post-fire resprouting individuals had concentrated extrafloral nectar and sustained more ants, thus strengthening the outcomes of ant-plant mutualism.
Phasomkusolsil, Siriporn; Pantuwatana, Kanchana; Tawong, Jaruwan; Khongtak, Weeraphan; Kertmanee, Yossasin; Monkanna, Nantaporn; Khaosanorh, Sakon; Wanja, Elizabeth W; Davidson, Silas A
2017-09-01
Successful mating by male mosquitoes is dependent on several factors, with sugar feeding being particularly important. The effect of ingested vitamins on adult male mosquitoes is poorly understood. This laboratory study used 3 anopheline species, Anopheles campestris, An. dirus, and An. sawadwongporni, to study the effect of sugar and vitamins on male longevity, copulation, and fecundity. Males were fed 1 of 5 diets containing different combinations of sugar and vitamins: 10% glucose, 10% sucrose, 10% multivitamin syrup, 10% multivitamin syrup + 10% glucose, and 10% multivitamin syrup + 10% sucrose. The longevity of males was measured for a period of 15 days. Forced mating was used to simulate copulation, and fecundity was measured by counting the number of eggs oviposited and the hatch rate of larvae. The longevity of An. campestris and An. dirus was greatest when fed a diet of 10% multivitamin syrup + 10% glucose, and the longevity of An. sawadwongporni was greatest when fed a diet of 10% multivitamin syrup + 10% sucrose. The 1st mating routinely produced the most viable eggs when males were mated with several females. The diet of 10% multivitamin syrup + 10% sucrose produced numerically greater egg production and larval emergence for all 3 species, although this was not always statistically significant due to variability and small sample size. These results indicate that the addition of multivitamin syrup to sucrose may produce healthier and more fit male anophelines. This has potential implications for increasing insectary operations and improving the fitness of laboratory-reared male mosquitoes that will be released for mosquito and disease-pathogen control studies.
Le Nguyen, Doan Duy; Ducamp, Marie-Noelle; Dornier, Manuel; Montet, Didier; Reynes, Max; Loiseau, Gérard
2005-08-01
The lactoperoxidase system (LPS) was evaluated for the prevention of postharvest diseases caused by Xanthomonas campestris, Botryodiplodia theobromae, and Colletotrichum gloeosporioides in 'Keitt' and 'Kent' mangoes. The LPS treatment significantly reduced the disease development on both cultivars after storage at 12 degrees C for 2 weeks, which was followed by a ripening at 25 degrees C. The LPS treatment did not alter the sensory quality of mango fruits (color, firmness, titrable acidity, and total soluble solids) when compared to untreated fruits. The LPS thus presents good potential alternative to the chemical fungicides traditionally used to improve the shelf life of mangoes.
International Nuclear Information System (INIS)
Kuraishi, Susumu; Ishikawa, Fumio
1977-01-01
Both cytokinins and fusicoccin (FC) stimulated the transpiration and the amino acid accumulation in leaf discs of Brassica campestris var. komatsuna. Enhancement effects were of the same magnitude. Both the accumulation and the transpiration were similarly inhibited when vaseline was smeared on the leaf surface. Abscisic acid (ABA) also inhibited those cytokinin-induced effects. The accumulation of amino acid- 14 C was at the cytokinin- or FC-treated site unless the leaf surface was smeared with vaseline. These facts suggest that cytokinin- or FC-induced amino acid accumulation in leaf is caused by the stimulation of transpiration. (auth.)
International Nuclear Information System (INIS)
Gagnaire, J.; Gerard, J.M.
1963-01-01
The concentration power of plant tissues and the translocation speed of mineral salts are considerably varying with the absorbed salt, the botanical species, the considered tissue and the part of the vegetative cycle. In Grenoble, with Picea excelsa, the 'true dormancy' is short (half-november, end of december). It is accompanied by a pre-dormancy period (October, half-november) and a post dormancy period (January, february, march). In vegetative period, Picea excelsa leaves are less concentrating mineral salt than Acer campestris leaves (coefficient 2 for calcium - 3 for phosphates) and Populus nigra leaves (coefficient 3 for calcium, coefficient 5 for phosphates). (author) [fr
Proietti, S; Giangrande, C; Amoresano, A; Pucci, P; Molinaro, A; Bertini, L; Caporale, C; Caruso, C
2014-01-01
Plants lack the adaptive immunity mechanisms of jawed vertebrates, so they rely on innate immune responses to defense themselves from pathogens. The plant immune system perceives the presence of pathogens by recognition of molecules known as pathogen-associated molecular patterns (PAMPs). PAMPs have
Brassia campestris L. ssp. chinensis L.var. utilis Tsen et Lee
African Journals Online (AJOL)
omodibo
2012-12-31
Dec 31, 2012 ... The pathogens were isolated by tissue segment method (Fang,. 1996) on potato ... Genomic DNA was extracted from a suspension culture of A. alter- nata by the cetyltrimethyl ... sample of orchid tissue. Biotechniques.
Brassia campestris L. ssp. chinensis L.var. utilis Tsen et Lee
African Journals Online (AJOL)
omodibo
2012-12-31
Dec 31, 2012 ... On the basis of morphological and cultural features, the pathogen ... Alternaria isolate from Purple-Caitai showed 99% identity with other ITS sequences of .... Cho KH, Park SH, Kim KT, Kim S, Kim JS, Park BS, Woo JG, Lee HJ.
Ben Moussa, Issam Eddine; Mazzoni, Valerio; Valentini, Franco; Yaseen, Thaer; Lorusso, Donato; Speranza, Stefano; Digiaro, Michele; Varvaro, Leonardo; Krugner, Rodrigo; D'Onghia, Anna Maria
2016-08-01
A study on seasonal abundance of Auchenorrhyncha species and their infectivity by Xylella fastidiosa in the Apulia region of Italy was conducted to identify ideal periods for monitoring and adoption of potential control measures against insect vectors. Adult populations of Auchenorrhyncha species were monitored monthly over a 2-yr period from five olive groves. A total of 15 species were captured, identified, and tested for presence of X. fastidiosa by polymerase chain reaction (PCR). For three species, Philaenus spumarius L., Neophilaenus campestris (Fallèn), and Euscelis lineolatus Brullé, positive reactions to X. fastidiosa were obtained, on average, in 16.3, 15.9 and 18.4% of adult insects, respectively. Philaneous spumarius was the dominant species (39.8% of total Auchenorrhyncha captured) with the highest adult abundance in summer months. Adult P. spumarius and N. campestris were first detected between March and May in both years, and all insects tested during these periods (year 1: n = 42, year 2: n = 132) gave negative reactions to X. fastidiosa by PCR. Similarly, first adults of E. lineolatus that appeared from October to November (year 1: n = 20, year 2: n = 15) tested negative for presence of X. fastidiosa Given the lack of transstadial and transovarial transmission of X. fastidiosa and considering that P. spumarius is univoltine, control measures against nymphal stages of P. spumarius should be investigated as means of population suppression to reduce spread of X. fastidiosa in olive groves. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Особливості накопичення важких металів їстівними грибами
Білявський, Ю. А.; Bilyavskyj, Yu.
2013-01-01
The level of maintenance of heavy metals (Cu, Pb, Cd and Zn) in edible mushrooms which grow on the territory of Polissya part of the Zhytomyr oblast is investigated. The features of migration of pollutants in the system «soil - forest bedding - mushroom» are set. It was measured that the least heavy metals contamination is in the fruit bodies of Boletus edulis Bull. ех Fr., and the most heavy metals contamination is in the fruit bodies of Agaricus campestris Fr. Досліджений рівень вмісту в...
Directory of Open Access Journals (Sweden)
Uppalapati Srinivasa R
2011-10-01
Full Text Available Abstract Background The Arabidopsis thaliana-Pseudomonas syringae model pathosystem is one of the most widely used systems to understand the mechanisms of microbial pathogenesis and plant innate immunity. Several inoculation methods have been used to study plant-pathogen interactions in this model system. However, none of the methods reported to date are similar to those occurring in nature and amicable to large-scale mutant screens. Results In this study, we developed a rapid and reliable seedling flood-inoculation method based on young Arabidopsis seedlings grown on MS medium. This method has several advantages over conventional soil-grown plant inoculation assays, including a shorter growth and incubation period, ease of inoculation and handling, uniform infection and disease development, requires less growth chamber space and is suitable for high-throughput screens. In this study we demonstrated the efficacy of the Arabidopsis seedling assay to study 1 the virulence factors of P. syringae pv. tomato DC3000, including type III protein secretion system (TTSS and phytotoxin coronatine (COR; 2 the effector-triggered immunity; and 3 Arabidopsis mutants affected in salicylic acid (SA- and pathogen-associated molecular pattern (PAMPs-mediated pathways. Furthermore, we applied this technique to study nonhost resistance (NHR responses in Arabidopsis using nonhost pathogens, such as P. syringae pv. tabaci, pv. glycinea and pv. tomato T1, and confirmed the functional role of FLAGELLIN-SENSING 2 (FLS2 in NHR. Conclusions The Arabidopsis seedling flood-inoculation assay provides a rapid, efficient and economical method for studying Arabidopsis-Pseudomonas interactions with minimal growth chamber space and time. This assay could also provide an excellent system for investigating the virulence mechanisms of P. syringae. Using this method, we demonstrated that FLS2 plays a critical role in conferring NHR against nonhost pathovars of P. syringae, but not to
Directory of Open Access Journals (Sweden)
Maria Eugênia Silva Cruz
2007-07-01
Full Text Available The aim of this work was to evaluate the antifungical, antibacterial and phytoalexins elicitors activities of hydrolates, for using in the alternative control of plant diseases. The hydrolates of Helietta apiculata (HA, Conyza canadensis (CC and Cymbopogon nardus (CN were used in the concentrations of 1, 5, 10, 15, 20 and 25%. In the phytoalexins assay, sorghum etiolated mesocotyls were used. The antibacterial effect was evaluated on the growth of the bacterium Xanthomonas campestris pv. campestris in liquid nutrient medium and antibiotic (oxytetraciclin 22.5 mg/L + streptomycin 225 mg/L was used as control treatment. The antifungical effect was evaluated on the micelial growth, esporulation, conidia germination and development of germinative tubes of Alternaria brassicae. The fungicide azoxystrobin (0.08 g a.i./ L was used as control treatment. There was increment in the phytoalexins synthesis with the increase in hydrolates concentration. The better result was obtained with CN that promoted increase 4.3 times larger in relation to the value of the control treatment with water, followed by HA (2.5 times and CC (2.1 times. Similar results were obtained to the antibacterial activity with the following inhibition results (% in the development of the bacterium: CN: 29.8, HA: 14.9, CC: 14.6 and antibiotic: 97.7. The main antifungical effect was observed on the development of the germinative tubes. Hydrolates of CC and HA showed inhibition of up to 69.2 and 56.2%, respectively, being similar to the fungicide azoxystrobin. The hydrolate of CN did not show antifungical effect. These results indicate the presence of phytoalexins elicitors, and antibacterial and antifungical compounds in those hydrolates, however in low concentrations.O objetivo do trabalho foi avaliar a atividade como antifúngico, antibacteriano e indutor da produção de fitoalexinas dos hidrolatos de Helietta apiculata (canela-de-veado (HA, Conyza canadensis (buva (CC e Cymbopogon
Directory of Open Access Journals (Sweden)
João Augusto Alves Meira Neto
2002-10-01
Full Text Available A riqueza de espécies e os fatores determinantes da ocorrência da vegetação de cerrado há muito têm despertado o interesse de pesquisadores. Muitos cerrados protegidos em unidades de conservação ainda não foram investigados florística e estruturalmente. Neste trabalho foi realizado um levantamento florístico e fitossociológico no Parque Nacional da Serra do Cipó (19º22'01''S e 43º37'10''W. Foram instaladas 12 parcelas de 150 m² e foram amostrados todos os indíviduos lenhosos com circunferência do caule à altura do solo maior ou igual a 10 cm. Foram relacionadas 44 espécies de 37 gêneros e 30 famílias. Entre estas, Leguminosae Caesalpinioideae, Leguminosae Mimosoideae e Guttiferae, com três espécies cada, foram as mais ricas. As espécies mais importantes (VI foram Hymenaea stigonocarpa, Allagoptera campestris, Diospyros hispida, Rapanea guianensis e Piptocarpha rotundifolia.The diversity of species and the factors determining the occurrence of cerrado vegetation have long called the attention of researchers. Many protected cerrados in Conservation Units have not been floristically and structurally studied. This work conducted a floristic and phytosociological survey of the Parque Nacional da "Serra do Cipó" ("Serra do Cipó" National Park (19º22'01''S and 43º37'10''W. Twelve quadrats of 150 m² were established and all individuals with a stem circumference at ground level larger than or equal to 10 cm were sampled. A total of 44 species of 37 genera and 30 families were found. The richest families were Leguminosae Caesalpinioideae, Leguminosae Mimosoideae and Guttiferae, with three species each. The most important species (VI were Hymenaea stigonocarpa, Allagoptera campestris, Diospyros hispida, Rapanea guianensis and Piptocarpha rotundifolia.
Hussain Lahori, Altaf; Zhang, Zengqiang; Guo, Zhanyu; Mahar, Amanullah; Li, Ronghua; Kumar Awasthi, Mukesh; Ali Sial, Tanveer; Kumbhar, Farhana; Wang, Ping; Shen, Feng; Zhao, Junchao; Huang, Hui
2017-11-01
This explorative study was aimed to assess the efficiency of lime alone and in combined with additives to immobilize Pb, Cd, Cu and Zn in soil and reduce their phytoavailability for plant. A greenhouse pot experiment was performed by using low and heavily contaminated top soils viz. Tongguan contaminated (TG-C); Fengxian heavily contaminated (FX-HC) and Fengxian low contaminated (FX-LC). The contaminated soils were treated with lime (L) alone and in combined with Ca-bentonite (CB), Tobacco biochar (TB) and Zeolite (Z) at 1% and cultivated by Chinese cabbage (Brassica campestris L). Results revealed that all amendments (plime alone and in combined with additives were drastically decreased the dry biomass yield of Brassica campestris L. as compared with control. Thus, these feasible amendments potentially maximum reduced the uptake by plant shoots upto Pb 53.47 and Zn 67.93% with L+Z and L+TB in FX-LC soil, while Cd 68.58 and Cu 60.29% with L+TB, L+CB in TG-C soil but Cu uptake in plant shoot was observed 27.26% and 30.17% amended with L+TB and L+Z in FX-HC and FX-LC soils. On the other hand, these amendments were effectively reduced the potentially toxic metals (PTMs) in roots upto Pb77.77% L alone in FX-HC, Cd 96.76% with L+TB in TG-C, while, Cu 66.70 and Zn 60.18% with L+Z in FX-LC. Meanwhile, all amendments were responsible for increasing soil pH and CEC but decreased soils EC level. Based on this result, these feasible soil amendments were recommended for long term-study under field condition to see the response of another hyper accumulator crop. Copyright © 2017. Published by Elsevier Inc.
Novel cyclic di-GMP effectors of the YajQ protein family control bacterial virulence.
Directory of Open Access Journals (Sweden)
Shi-qi An
2014-10-01
Full Text Available Bis-(3',5' cyclic di-guanylate (cyclic di-GMP is a key bacterial second messenger that is implicated in the regulation of many critical processes that include motility, biofilm formation and virulence. Cyclic di-GMP influences diverse functions through interaction with a range of effectors. Our knowledge of these effectors and their different regulatory actions is far from complete, however. Here we have used an affinity pull-down assay using cyclic di-GMP-coupled magnetic beads to identify cyclic di-GMP binding proteins in the plant pathogen Xanthomonas campestris pv. campestris (Xcc. This analysis identified XC_3703, a protein of the YajQ family, as a potential cyclic di-GMP receptor. Isothermal titration calorimetry showed that the purified XC_3703 protein bound cyclic di-GMP with a high affinity (K(d∼2 µM. Mutation of XC_3703 led to reduced virulence of Xcc to plants and alteration in biofilm formation. Yeast two-hybrid and far-western analyses showed that XC_3703 was able to interact with XC_2801, a transcription factor of the LysR family. Mutation of XC_2801 and XC_3703 had partially overlapping effects on the transcriptome of Xcc, and both affected virulence. Electromobility shift assays showed that XC_3703 positively affected the binding of XC_2801 to the promoters of target virulence genes, an effect that was reversed by cyclic di-GMP. Genetic and functional analysis of YajQ family members from the human pathogens Pseudomonas aeruginosa and Stenotrophomonas maltophilia showed that they also specifically bound cyclic di-GMP and contributed to virulence in model systems. The findings thus identify a new class of cyclic di-GMP effector that regulates bacterial virulence.
The cultural significance of wild mushrooms in San Mateo Huexoyucan, Tlaxcala, Mexico
2014-01-01
Background We performed an ethnomycological study in a community in Tlaxcala, Central Mexico to identify the most important species of wild mushrooms growing in an oak forest, their significance criteria, and to validate the Cultural Significance Index (CSI). Methods Thirty-three mestizo individuals were randomly selected in San Mateo Huexoyucan and were asked seven questions based on criteria established by the CSI. Among the 49 mushroom species collected in the oak forest and open areas, 20 species were mentioned most often and were analyzed in more detail. Ordination and grouping techniques were used to determine the relationship between the cultural significance of the mushroom species, according to a perceived abundance index, frequency of use index, taste score appreciation index, multifunctional food index, knowledge transmission index, and health index. Results The mushrooms with highest CSI values were Agaricus campestris, Ramaria spp., Amanita aff. basii, Russula spp., Ustilago maydis, and Boletus variipes. These species were characterized by their good taste and were considered very nutritional. The species with the lowest cultural significance included Russula mexicana, Lycoperdon perlatum, and Strobylomyces strobilaceus. The ordination and grouping analyses identified four groups of mushrooms by their significance to the people of Huexoyucan. The most important variables that explained the grouping were the taste score appreciation index, health index, the knowledge transmission index, and the frequency of use index. Conclusions A. aff. basii and A. campestris were the most significant wild mushrooms to the people of San Mateo. The diversity of the Russula species and the variety of Amanita and Ramaria species used by these people was outstanding. Environments outside the forest also produced useful resources. The CSI used in Oaxaca was useful for determining the cultural significance of mushrooms in SMH, Tlaxcala. This list of mushrooms can be used in
International Nuclear Information System (INIS)
Islam, R.; Ahmed, J.; Al-Reza, S. M.; Rahman, M. M.; Nyme, Z.; Lisa, L. A.; Yousaf, M.; Alam, M. N.
2015-01-01
In this study, we characterized some Xanthomonas sp. from rice rhizosphere soil by 16S rDNA sequence analysis and the potentiality tested of oil and extracts of Clerodendrum viscosum Vent. leaves against those isolated bacteria. The essential oil compositions were evaluated by GC-MS analysis and identified twenty four compounds as 94.37% of the total essential oil, where cyclohepta-1,3,5,-triene (16.07%), 2H-1,4-pyridoxazin-3(4H)-one (12.27%), L-carvenol (8.04%), p-cymene (9.15%), alpha-terpineol (7.98%), beta-sitosterol (6.76%), tyranton (6.42%), mesityl oxide (6.34%), gamma-terpinene (5.42%) and beta-linalool (3.74%) were the major constituents. According to the 16S rDNA sequences analysis, Hb28 and Xb43 isolates have shown the 100% similarity for Xanthomonas retroflexus and Xanthomonas theicola. In addition, isolates Ha18, Xb33 and Jb30 also have shown the maximum similarity of 98% for Xanthomonas sp. TB8-9-II, Xanthomonas campestris and Xanthomonas sp. BBCT38. Furthermore, in vitro studies showed that the oil have the inhibitory effect on Xanthomonas sp. TB8-9-II, X. campestris, X. retroflexus, Xanthomonas sp. BBCT38, and X. theicola, where the zone of inhibition and MIC values were 18.8 to 25.9 mm and 62.5 to 125 meu g ml/sup -1/, respectively. However, organic extracts showed the zone of inhibition and MIC values were 13.4 to 22.9 and 62.5 to 500 meu g ml-1, respectively. Our findings suggested that the essential oil and extracts of C. viscosum Vent. leaves might be the effective source to control Xanthomonas sp. biologically. (author)
Sharma, Brij B; Kalia, Pritam; Singh, Dinesh; Sharma, Tilak R
2017-01-01
Black rot caused by Xanthomonas campestris pv. campestris ( Xcc ) is a very important disease of cauliflower ( Brassica oleracea botrytis group) resulting into 10-50% yield losses every year. Since there is a dearth of availability of resistance to black rot disease in B. oleracea (C genome), therefore exploration of A and B genomes was inevitable as they have been reported to be potential reservoirs of gene(s) for resistance to black rot. To utilize these sources, interspecific hybrid and backcross progeny (B 1 ) were generated between cauliflower "Pusa Sharad" and Ethiopian mustard "NPC-9" employing in vitro embryo rescue technique. Direct ovule culture method was better than siliqua culture under different temperature regime periods. Hybridity testing of F 1 inter-specific plants was carried out using co-dominant SSR marker and Brassica B and C genome-specific (DB and DC) primers. Meiosis in the di-genomic (BCC) interspecific hybrid of B. oleracea botrytis group (2 n = 18, CC) × B. carinata (2 n = 4x = 34, BBCC) was higly disorganized and cytological analysis of pollen mother cells revealed chromosomes 2 n = 26 at metaphase-I. Fertile giant pollen grain formation was observed frequently in interspecific F 1 hybrid and BC 1 plants. The F 1 inter-specific plants were found to be resistant to Xcc race 1. Segregation distortion was observed in BC 1 generation for black rot resistance and different morphological traits. The At1g70610 marker analysis confirmed successful introgression of black rot resistance in interspecific BC 1 population. This effort will go a long way in pyramiding gene(s) for resistance against black rot in Cole crops, especially cauliflower and cabbage for developing durable resistance, thus minimize dependency on bactericides.
Sharma, Brij B.; Kalia, Pritam; Singh, Dinesh; Sharma, Tilak R.
2017-01-01
Black rot caused by Xanthomonas campestris pv. campestris (Xcc) is a very important disease of cauliflower (Brassica oleracea botrytis group) resulting into 10–50% yield losses every year. Since there is a dearth of availability of resistance to black rot disease in B. oleracea (C genome), therefore exploration of A and B genomes was inevitable as they have been reported to be potential reservoirs of gene(s) for resistance to black rot. To utilize these sources, interspecific hybrid and backcross progeny (B1) were generated between cauliflower “Pusa Sharad” and Ethiopian mustard “NPC-9” employing in vitro embryo rescue technique. Direct ovule culture method was better than siliqua culture under different temperature regime periods. Hybridity testing of F1 inter-specific plants was carried out using co-dominant SSR marker and Brassica B and C genome-specific (DB and DC) primers. Meiosis in the di-genomic (BCC) interspecific hybrid of B. oleracea botrytis group (2n = 18, CC) × B. carinata (2n = 4x = 34, BBCC) was higly disorganized and cytological analysis of pollen mother cells revealed chromosomes 2n = 26 at metaphase-I. Fertile giant pollen grain formation was observed frequently in interspecific F1 hybrid and BC1 plants. The F1 inter-specific plants were found to be resistant to Xcc race 1. Segregation distortion was observed in BC1 generation for black rot resistance and different morphological traits. The At1g70610 marker analysis confirmed successful introgression of black rot resistance in interspecific BC1 population. This effort will go a long way in pyramiding gene(s) for resistance against black rot in Cole crops, especially cauliflower and cabbage for developing durable resistance, thus minimize dependency on bactericides. PMID:28769959
Directory of Open Access Journals (Sweden)
Brij B. Sharma
2017-07-01
Full Text Available Black rot caused by Xanthomonas campestris pv. campestris (Xcc is a very important disease of cauliflower (Brassica oleracea botrytis group resulting into 10–50% yield losses every year. Since there is a dearth of availability of resistance to black rot disease in B. oleracea (C genome, therefore exploration of A and B genomes was inevitable as they have been reported to be potential reservoirs of gene(s for resistance to black rot. To utilize these sources, interspecific hybrid and backcross progeny (B1 were generated between cauliflower “Pusa Sharad” and Ethiopian mustard “NPC-9” employing in vitro embryo rescue technique. Direct ovule culture method was better than siliqua culture under different temperature regime periods. Hybridity testing of F1 inter-specific plants was carried out using co-dominant SSR marker and Brassica B and C genome-specific (DB and DC primers. Meiosis in the di-genomic (BCC interspecific hybrid of B. oleracea botrytis group (2n = 18, CC × B. carinata (2n = 4x = 34, BBCC was higly disorganized and cytological analysis of pollen mother cells revealed chromosomes 2n = 26 at metaphase-I. Fertile giant pollen grain formation was observed frequently in interspecific F1 hybrid and BC1 plants. The F1 inter-specific plants were found to be resistant to Xcc race 1. Segregation distortion was observed in BC1 generation for black rot resistance and different morphological traits. The At1g70610 marker analysis confirmed successful introgression of black rot resistance in interspecific BC1 population. This effort will go a long way in pyramiding gene(s for resistance against black rot in Cole crops, especially cauliflower and cabbage for developing durable resistance, thus minimize dependency on bactericides.
Directory of Open Access Journals (Sweden)
Verloove, F.
2013-12-01
Full Text Available Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum chrysotrichum, Tecoma stans, Tipuana tipu, Urochloa mutica, U. plantaginea y Washingtonia se citan por primera vez para las Islas Canarias, mientras que Alopecurus myosuroides, Amaranthus blitoides, Bothriochloa ischaemum var. songarica, Cardamine flexuosa subsp. debilis, Heliotropium curassavicum, Leonotis nepetifolia, Medicago lupulina, Parkinsonia aculeata, Physalis peruviana, Phytolacca americana y Turnera ulmifolia son nuevas para la flora de la isla de Gran Canaria. Finalmente, se confirma la presencia de Paspalum vaginatum, P. distichum y Cortaderia selloana en Gran Canaria.Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum
Mutagenesis of Xanthomonas campestris and selection of strains with enhanced Xanthan production
International Nuclear Information System (INIS)
Kamal, F.; Mehrgan, H.; Mazaheri, M.; Mortazavi, A. R.
2003-01-01
Xanthan gum is microbial polysaccharide of great commercial importance as it has been unusual rheological properties in solution and consequent range of applications. In this study, a series of mutants were isolated from Xanthomonas PTSS 1473 by ethyl methanesulfonate mutagenesis. The polysaccharide yield of one mutant, XC1473E 2 , was 30% better than that of the parent strain. It also showed higher xanthan formation of glucose consumption rates compared to the parent strain. xanthan produced by the mutant and enhanced viscosity, higher pseudo plasticity and larger molecular weight. Since mutant XC1473E 2 appeared white on agar plates, it underwent pigment extraction with methanol. Contrary to the parent strain, the mutant showed no absorption at 443 nm, i.e. the wavelength related to yellow pigment. This finding suggested that yellow pigmentation and normal xanthan biosynthesis are not necessarily concurrent. In general, mutant ZC1473e 2 seems to be a strain with interesting characteristics for use in commercial production of Xanthan
Abnormal spindles in second meiosis in canola (Brassica napus and Brassica campestris
Directory of Open Access Journals (Sweden)
Alice Maria de Souza
1999-01-01
Full Text Available Studies were carried out on the occurrence of abnormal spindles in the second meiotic division in some canola cultivars recently introduced in Brazil. Fusion of spindles was observed in metaphase II rejoining the two sets of chromosomes segregated in anaphase I and also sequential and tripolar spindles were discovered rejoining two sets of chromatids segregated in anaphase II. The frequency of cells with abnormal spindles ranged from 3.18 to 8.10%. The results suggested that this abnormality was caused by environmental stress that affected the plants during the blooming period.O presente estudo descreve a ocorrência de fusos anormais na segunda divisão meiótica em algumas cultivares da canola recentemente introduzidas no Brasil. Fusão de fusos foi observada em metáfase II reunindo os dois conjuntos cromossômicos segregados na anáfase I; fusos sequenciais e tripolares reunindo cromátides segregadas na anáfase II também foram observados. A frequência de células com fusos anormais variou de 3,18 a 8,10% entre as variedades. Os resultados sugerem que estas anormalidades foram causadas por condições climáticas adversas que afetaram as plantas no período de florescimento. As implicações genéticas destas anormalidades são descritas.
White blister rusts and downy mildews from bajaur agency fata, with some new records from pakistan
International Nuclear Information System (INIS)
Haq, M.A.; Shahzad, S.
2015-01-01
In a species diversity study of Oomycyctes of Bajaur Agency FATA, Pakistan, infection of white blister rusts and downy mildews recorded on three cultivated and four wild plants. Capsella bursa-pastoris showed mixed infection of Albugo candida and Hyaloperonospora parasitica (syn: Peronospora parasitica). Similarly, A. candida and H. brassicae (syn: P. brassicae) parasitized Brassica campestris. Wilsoniana portulacae (syn: Albugo portulacae) and W. occidentalis com. nov. (syn: Albugo occidentalis) recovered from Portulaca oleracea and Spinacia oleracea, respectively. Bremia taraxaci, B. sonchicola and B. saussureae recorded on Taraxicum officinale, Sonchus sp., and Saussurea sp., respectively. All these obligate parasites are new records from Bajaur Agency, while H. parasitica, W. occidentalis, B. taraxaci, and B. saussureae on the mentioned hosts are new records from Pakistan. (author)
Morphological Observation on Floral Variations of the Genus Cuscuta in Taiwan
Directory of Open Access Journals (Sweden)
Gwo-Ing Liao
2005-06-01
Full Text Available The variations in floral structure of Cuscuta in Taiwan were studied with special reference to C. campestris. The variations of the floral structure were described and illustrated by using light and scanning electron microscopy. The variations including the following: (1 the absence of floral organs; (2 the abnormal fusion of floral organs; (3 petaloid stamens; (4 the lack of distinctive anther lobes; (5 the unusual protrusions on ovaries; and (6 the extrusion of ovule on ovary surfaces. The variations occur in early developmental stages when the primordia of floral organ were initiated. The findings that the abnormal position of the ovule and the lateral fusion of the scale with the filament or the petal in the species of Cuscuta are first time reported here.
Directory of Open Access Journals (Sweden)
Carlos R. Echandi
2005-01-01
Full Text Available Se realizaron 3 experimentos durante la época lluviosa de los años 2001 al 2003, para evaluar la productividad, adaptación y estabilidad fenotípica de 25 líneas de chile en Sabanilla, Poás y Sarchí Norte, Provincia de Alajuela, respectivamente. Los genotipos junto con 2 testigos se dispusieron en un diseño de bloques completos al azar con 3 repeticiones en una plantación de renovación de café. Las variables evaluadas fueron el peso y número de frutos tipo A, B y C, el rendimiento total de frutos y la incidencia e índice de daño de la mancha bacteriana (Xanthomonas campestris. El análisis combinado permitió identificar la interacción línea por localidad en las variables de respuesta, por lo que se recurrió al análisis de estabilidad propuesto por Eberhart y Russell (1966, en el caso del rendimiento total de frutos comerciales. Las líneas 2 y 3 sobresalieron por su rendimiento promedio de frutos comerciales en las 3 localidades, con 10,57 y 12,38 t ha-1, respectivamente. La línea 21 junto a las anteriores resultó ser una de las más aptas para la producción de chile jalapeño en la localidad más desfavorable de Poás. Las líneas 15 y 18, junto con la 2 y 3, incrementarían significativamente el ingreso del productor de café, en relación con los comparadores, en los ambientes más favorables de producción. La reacción promedio de los genotipos al daño foliar por X. campestris en las 3 localidades fue de baja intensidad (20,3%. Este nivel de daño foliar no afectó el rendimiento de frutos; por lo que se recomienda evaluar la respuesta de estos materiales a presiones mayores de inóculo.
Directory of Open Access Journals (Sweden)
Li Wang
2016-12-01
Full Text Available Both iron starvation and excess are detrimental to cellular life, especially for animal and plant pathogens since they always live in iron-limited environments produced by host immune responses. However, how organisms sense and respond to iron is incompletely understood. Herein, we reveal that in the phytopathogenic bacterium Xanthomonas campestris pv. campestris, VgrS (also named ColS is a membrane-bound receptor histidine kinase that senses extracytoplasmic iron limitation in the periplasm, while its cognate response regulator, VgrR (ColR, detects intracellular iron excess. Under iron-depleted conditions, dissociation of Fe3+ from the periplasmic sensor region of VgrS activates the VgrS autophosphorylation and subsequent phosphotransfer to VgrR, an OmpR-family transcription factor that regulates bacterial responses to take up iron. VgrR-VgrS regulon and the consensus DNA binding motif of the transcription factor VgrR were dissected by comparative proteomic and ChIP-seq analyses, which revealed that in reacting to iron-depleted environments, VgrR directly or indirectly controls the expressions of hundreds of genes that are involved in various physiological cascades, especially those associated with iron-uptake. Among them, we demonstrated that the phosphorylated VgrR tightly represses the transcription of a special TonB-dependent receptor gene, tdvA. This regulation is a critical prerequisite for efficient iron uptake and bacterial virulence since activation of tdvA transcription is detrimental to these processes. When the intracellular iron accumulates, the VgrR-Fe2+ interaction dissociates not only the binding between VgrR and the tdvA promoter, but also the interaction between VgrR and VgrS. This relieves the repression in tdvA transcription to impede continuous iron uptake and avoids possible toxic effects of excessive iron accumulation. Our results revealed a signaling system that directly senses both extracytoplasmic and intracellular
Directory of Open Access Journals (Sweden)
Sheo Shankar Pandey
2016-11-01
Full Text Available Abilities of bacterial pathogens to adapt to the iron limitation present in hosts is critical to their virulence. Bacterial pathogens have evolved diverse strategies to coordinately regulate iron metabolism and virulence associated functions to maintain iron homeostasis in response to changing iron availability in the environment. In many bacteria the ferric uptake regulator (Fur functions as transcription factor that utilize ferrous form of iron as cofactor to regulate transcription of iron metabolism and many cellular functions. However, mechanisms of fine-tuning and coordinated regulation of virulence associated function beyond iron and Fur-Fe2+ remain undefined. In this study, we show that a novel transcriptional regulator XibR (named Xanthomonas iron binding regulator of the NtrC family, is required for fine-tuning and co-coordinately regulating the expression of several iron regulated genes and virulence associated functions in phytopathogen Xanthomonas campestris pv. campestris (Xcc. Genome wide expression analysis of iron-starvation stimulon and XibR regulon, GUS assays, genetic and functional studies of xibR mutant revealed that XibR positively regulates functions involved in iron storage and uptake, chemotaxis, motility and negatively regulates siderophore production, in response to iron. Furthermore, chromatin immunoprecipitation followed by quantitative real-time PCR indicated that iron promoted binding of the XibR to the upstream regulatory sequence of operon's involved in chemotaxis and motility. Circular dichroism spectroscopy showed that purified XibR bound ferric form of iron. Electrophoretic mobility shift assay revealed that iron positively affected the binding of XibR to the upstream regulatory sequences of the target virulence genes, an effect that was reversed by ferric iron chelator deferoxamine. Taken together, these data revealed that how XibR coordinately regulates virulence associated and iron metabolism functions in
Pandey, Sheo Shankar; Patnana, Pradeep Kumar; Lomada, Santosh Kumar; Tomar, Archana; Chatterjee, Subhadeep
2016-01-01
Abilities of bacterial pathogens to adapt to the iron limitation present in hosts is critical to their virulence. Bacterial pathogens have evolved diverse strategies to coordinately regulate iron metabolism and virulence associated functions to maintain iron homeostasis in response to changing iron availability in the environment. In many bacteria the ferric uptake regulator (Fur) functions as transcription factor that utilize ferrous form of iron as cofactor to regulate transcription of iron metabolism and many cellular functions. However, mechanisms of fine-tuning and coordinated regulation of virulence associated function beyond iron and Fur-Fe2+ remain undefined. In this study, we show that a novel transcriptional regulator XibR (named X anthomonas iron binding regulator) of the NtrC family, is required for fine-tuning and co-coordinately regulating the expression of several iron regulated genes and virulence associated functions in phytopathogen Xanthomonas campestris pv. campestris (Xcc). Genome wide expression analysis of iron-starvation stimulon and XibR regulon, GUS assays, genetic and functional studies of xibR mutant revealed that XibR positively regulates functions involved in iron storage and uptake, chemotaxis, motility and negatively regulates siderophore production, in response to iron. Furthermore, chromatin immunoprecipitation followed by quantitative real-time PCR indicated that iron promoted binding of the XibR to the upstream regulatory sequence of operon’s involved in chemotaxis and motility. Circular dichroism spectroscopy showed that purified XibR bound ferric form of iron. Electrophoretic mobility shift assay revealed that iron positively affected the binding of XibR to the upstream regulatory sequences of the target virulence genes, an effect that was reversed by ferric iron chelator deferoxamine. Taken together, these data revealed that how XibR coordinately regulates virulence associated and iron metabolism functions in Xanthomonads in
Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.
Directory of Open Access Journals (Sweden)
Charlotte Rehm
Full Text Available In prokaryotes simple sequence repeats (SSRs with unit sizes of 1-5 nucleotides (nt are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4 structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc, Xanthomonas axonopodis pv. citri str. 306 (Xac, and Nostoc sp. strain PCC7120 (Ana. In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.
Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.
Rehm, Charlotte; Wurmthaler, Lena A; Li, Yuanhao; Frickey, Tancred; Hartig, Jörg S
2015-01-01
In prokaryotes simple sequence repeats (SSRs) with unit sizes of 1-5 nucleotides (nt) are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4) structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc), Xanthomonas axonopodis pv. citri str. 306 (Xac), and Nostoc sp. strain PCC7120 (Ana). In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs) and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.
Directory of Open Access Journals (Sweden)
Cabrera-Luque Juan
2008-09-01
Full Text Available Abstract Background The efficient conversion of ammonia, a potent neurotoxin, into non-toxic metabolites was an essential adaptation that allowed animals to move from the aquatic to terrestrial biosphere. The urea cycle converts ammonia into urea in mammals, amphibians, turtles, snails, worms and many aquatic animals and requires N-acetylglutamate (NAG, an essential allosteric activator of carbamylphosphate synthetase I (CPSI in mammals and amphibians, and carbamylphosphate synthetase III (CPSIII in fish and invertebrates. NAG-dependent CPSI and CPSIII catalyze the formation of carbamylphosphate in the first and rate limiting step of ureagenesis. NAG is produced enzymatically by N-acetylglutamate synthase (NAGS, which is also found in bacteria and plants as the first enzyme of arginine biosynthesis. Arginine is an allosteric inhibitor of microbial and plant NAGS, and allosteric activator of mammalian NAGS. Results Information from mutagenesis studies of E. coli and P. aeruginosa NAGS was combined with structural information from the related bacterial N-acetylglutamate kinases to identify four residues in mammalian NAGS that interact with arginine. Substitutions of these four residues were engineered in mouse NAGS and into the vertebrate-like N-acetylglutamate synthase-kinase (NAGS-K of Xanthomonas campestris, which is inhibited by arginine. All mutations resulted in arginine losing the ability to activate mouse NAGS, and inhibit X. campestris NAGS-K. To examine at what point in evolution inversion of arginine effect on NAGS occur, we cloned NAGS from fish and frogs and examined the arginine response of their corresponding proteins. Fish NAGS were partially inhibited by arginine and frog NAGS were activated by arginine. Conclusion Difference in arginine effect on bacterial and mammalian NAGS most likely stems from the difference in the type of conformational change triggered by arginine binding to these proteins. The change from arginine
Biochemical and molecular tools reveal two diverse Xanthomonas groups in bananas
DEFF Research Database (Denmark)
Adriko, John; Aritua, V.; Mortensen, Carmen Nieves
2016-01-01
Xanthomonas campestris pv. musacearum (Xcm) causing the banana Xanthomonas wilt (BXW) disease has been the main xanthomonad associated with bananas in East and Central Africa based on phenotypic and biochemical characteristics. However, biochemical methods cannot effectively distinguish between...... pathogenic and non-pathogenic xanthomonads. In this study, gram-negative and yellow-pigmented mucoid bacteria were isolated from BXW symptomatic and symptomless bananas collected from different parts of Uganda. Biolog, Xcm-specific (GspDm), Xanthomonas vasicola species-specific (NZ085) and Xanthomonas genus......-specific (X1623) primers in PCR, and sequencing of ITS region were used to identify and characterize the isolates. Biolog tests revealed several isolates as xanthomonads. The GspDm and NZ085 primers accurately identified three isolates from diseased bananas as Xcm and these were pathogenic when re...
Photosynthetic pathway types of evergreen rosette plants (Liliaceae) of the Chihuahuan desert.
Kemp, Paul R; Gardetto, Pietra E
1982-11-01
Diurnal patterns of CO 2 exchange and titratable acidity were monitored in six species of evergreen rosette plants growing in controlled environment chambers and under outdoor environmental conditions. These patterns indicated that two of the species, Yucca baccata and Y. torreyi, were constituitive CAM plants while the other species, Y. elata, Y. campestris, Nolina microcarpa and Dasylirion wheeleri, were C 3 plants. The C 3 species did not exhibit CAM when grown in any of several different temperature, photoperiod, and moisture regimes. Both photosynthetic pathway types appear adapted to desert environments and all species show environmentally induced changes in their photosynthetic responses consistent with desert adaptation. The results of this study do not indicate that changes in the photosynthetic pathway type are an adaptation in any of these species.
International Nuclear Information System (INIS)
Inagaki, N.; Maekawa, S.; Terabun, M.
1986-01-01
Two experimental plots were prepared to investigate the effect of near-ultraviolet (UV) radiation on the growth and photosynthesis of turnip (Brassica cam pestris L.). They were treated by covering with UV-transmitting vinyl film (UVT) or UV-eliminating vinyl film (UVE) (Fig.1). The results were summarized as follows. 1. UV energy in UVE plot was 3 to 4% of that in UVT plot (Table 1). The temperature of UVE plot was similar to that of UVT plot throughout the growth period (Fig.2). The daily mean temperature throughout the growth period was about 19°C. 2. UVE plot was superior to UVT plot in all the characters investigated on growth (Table 2). Particularly plant length and fresh weight were significant at 5% level throughout the growth period. The growth pattern of each character was almost common to each other between the two experimental plots, except that the relative growth rate during exponential growth period of UVE plot was higher than that of UVT plot (Fig.3-1-Fig.6). 3. Apparent photosynthesis rate per unit of leaf area in UVE plot was higher than that in UVT plot at 24 days after sowing, but at 42, 48 and 70 days of after sowing the result was reversed (Fig.8). From this experiment, the effect UV on photosynthesis was not clearly observed. (author)
Energy Technology Data Exchange (ETDEWEB)
Inagaki, N.; Maekawa, S.; Terabun, M.
1986-07-01
Two experimental plots were prepared to investigate the effect of near-ultraviolet (UV) radiation on the growth and photosynthesis of turnip (Brassica cam pestris L.). They were treated by covering with UV-transmitting vinyl film (UVT) or UV-eliminating vinyl film (UVE) (Fig.1). The results were summarized as follows. 1. UV energy in UVE plot was 3 to 4% of that in UVT plot (Table 1). The temperature of UVE plot was similar to that of UVT plot throughout the growth period (Fig.2). The daily mean temperature throughout the growth period was about 19°C. 2. UVE plot was superior to UVT plot in all the characters investigated on growth (Table 2). Particularly plant length and fresh weight were significant at 5% level throughout the growth period. The growth pattern of each character was almost common to each other between the two experimental plots, except that the relative growth rate during exponential growth period of UVE plot was higher than that of UVT plot (Fig.3-1-Fig.6). 3. Apparent photosynthesis rate per unit of leaf area in UVE plot was higher than that in UVT plot at 24 days after sowing, but at 42, 48 and 70 days of after sowing the result was reversed (Fig.8). From this experiment, the effect UV on photosynthesis was not clearly observed. (author)
Small mammals of the Addo Elephant National Park
Directory of Open Access Journals (Sweden)
P. Swanepoel
1975-07-01
Full Text Available A survey of the small mammals of the Addo Elephant National Park resulted in a checklist, as well as information on relative numbers, distribution within the Park, reproductive activity, sex ratios, and body measurements. Forty mammals species occur in the Park, while three re-introduced species probably do not occur any longer. Of the 40 species 28 are considered small mammals comprising 13 rodent, eight carnivore, two shrew, two bat, one primate and one lagomorph species, as well as the aardvark: Crociduraflavescens, C. cyanea infumata, Rousettus aegyptiacus, Eptesicus capensis, Cercopithecus pygerythrus, Canis mesomelas, Ictonyx striatus, Poecilogale albinucha, Genetta sp., Herpestes pulverulentus, Suricata suricatta, Proteles cristatus, Felis caracal, Orycteropus afer, Lepus saxatilis, Cryptomys hottentotus, Hystrix africae-australis, Pedetes capensis, Graphiurus murinus, Aethomys namaquensis, Praomys natalensis, Rhabdomys pumilio, Mus minutoides, Rattus rattus, Saccostomys campestris, Desmodillus auricularis, Otomys irroratus and 0. unisulcatus.
Antibacterial activity of combined medicinal plants extract against multiple drug resistant strains
Directory of Open Access Journals (Sweden)
Rafiqul Islam
2015-06-01
Full Text Available Objective: To find out the combined antibacterial efficacy of Aegle marmelos, Aphanamixis polystachya, Cuscuta reflexa and Aesclynomene indica against bacterial pathogens. Methods: Antibacterial potency of combined plant extracts has been tested against Bacillus subtilis IFO 3026, Sarcina lutea IFO 3232, Xanthomonas campestris IAM 1671, Escherichia coli IFO 3007, Klebsiella pneumoniae ATTC 10031, Proteus vulgaris MTCC 321 and Pseudomonas denitrificans KACC 32026 by disc diffusion assay. Commercially available standard antibiotic discs were also used to find out antibiotic resistance pattern of test organisms. Results: Among the test organisms, Escherichia coli, Proteus vulgaris, Klebsiella pneumoniae and Proteus denitrificans showed resistance against multiple commercially available antibiotics. On the other hand, these multiple drug resistant organisms showed susceptibility against combined plant extracts. Conclusions: These combined plants extracts showed synergistic antibacterial activity and could lead to new antibacterial drug designing.
Directory of Open Access Journals (Sweden)
Renato Carrer Filho
2009-09-01
Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested
Oxygen and air nanobubble water solution promote the growth of plants, fishes, and mice.
Directory of Open Access Journals (Sweden)
Kosuke Ebina
Full Text Available Nanobubbles (<200 nm in diameter have several unique properties such as long lifetime in liquid owing to its negatively charged surface, and its high gas solubility into the liquid owing to its high internal pressure. They are used in variety of fields including diagnostic aids and drug delivery, while there are no reports assessing their effects on the growth of lives. Nanobubbles of air or oxygen gas were generated using a nanobubble aerator (BUVITAS; Ligaric Company Limited, Osaka, Japan. Brassica campestris were cultured hydroponically for 4 weeks within air-nanobubble water or within normal water. Sweetfish (for 3 weeks and rainbow trout (for 6 weeks were kept either within air-nanobubble water or within normal water. Finally, 5 week-old male DBA1/J mice were bred with normal free-chaw and free-drinking either of oxygen-nanobubble water or of normal water for 12 weeks. Oxygen-nanobubble significantly increased the dissolved oxygen concentration of water as well as concentration/size of nanobubbles which were relatively stable for 70 days. Air-nanobubble water significantly promoted the height (19.1 vs. 16.7 cm; P<0.05, length of leaves (24.4 vs. 22.4 cm; P<0.01, and aerial fresh weight (27.3 vs. 20.3 g; P<0.01 of Brassica campestris compared to normal water. Total weight of sweetfish increased from 3.0 to 6.4 kg in normal water, whereas it increased from 3.0 to 10.2 kg in air-nanobubble water. In addition, total weight of rainbow trout increased from 50.0 to 129.5 kg in normal water, whereas it increased from 50.0 to 148.0 kg in air-nanobubble water. Free oral intake of oxygen-nanobubble water significantly promoted the weight (23.5 vs. 21.8 g; P<0.01 and the length (17.0 vs. 16.1 cm; P<0.001 of mice compared to that of normal water. We have demonstrated for the first time that oxygen and air-nanobubble water may be potentially effective tools for the growth of lives.
The genus Cuscuta L. in East Asia
Directory of Open Access Journals (Sweden)
E. V. Aistova
2015-07-01
Full Text Available On the basis of published data, herbarium collections and our own research the overview of the spread of 7 dodder species (genus Cuscuta on the territory of of the Russian Far East and East Asia is given. The history of research dodders on the territory of the Russian Far East, ecological and spreading peculiarities are described. Certain eurytopic species (C. campestris Yunck., C. japonica Choisy and C. europaea L. growing on the territory of the Russian Far East have plasticity and rapid adaptive response for changing ecological and geographical conditions. C. epilinum Weihe, C. epithymum (L. Nathh., C. tinei Insenga have not been naturalized in the Russian Far East.
Hernández-Montelongo, Jacobo; Nascimento, Vicente F; Murillo, Duber; Taketa, Thiago B; Sahoo, Prasana; de Souza, Alessandra A; Beppu, Marisa M; Cotta, Monica A
2016-01-20
In this work, nanofilms of hyaluronan/chitosan (HA/CHI) assembled layer by layer were synthesized; their application as a potential antimicrobial material was demonstrated for the phytopathogen Xylella fastidiosa, a gram-negative bacterium, here used as a model. For the synthesis, the influence of pH and ionic strength of these natural polymer stem-solutions on final characteristics of the HA/CHI nanofilms was studied in detail. The antibacterial effect was evaluated using widefield fluorescence microscopy. These results were correlated with the chemical properties of the nanofilms, studied by FTIR and Raman spectroscopy, as well as with their morphology and surface properties characterized using SEM and AFM. The present findings can be extended to design and optimize HA/CHI nanofilms with enhanced antimicrobial behavior for other type of phytopathogenic gram-negative bacteria species, such as Xanthomonas citri, Xanthomas campestri and Ralstonia solanacearum. Copyright © 2015 Elsevier Ltd. All rights reserved.
Induced mutagenesis for the development of high yielding varieties in mustard
International Nuclear Information System (INIS)
Das, M.L.; Rahman, A.
1988-01-01
Variation for resistance to Alternaria brassicae (Berk.) Sacc. was induced in the oleiferous Brassica campestris cultivar yellow sarson, 'YS 52' using gamma rays. Variations were identified and isolated from the M 2 population. Screening in the subsequent generations (M 3 -M 4 ) confirmed the varying degrees of field resistance of the mutants. A total of 8 mutants of mustard developed by gamma irradiation was compared with the parental line and a released variety 'Sampad' as a check. Maximum plant height, highest number of pods and primary branches/plant were recorded in mutant '17-5-83'. The mutants '17-5-83' and '70-7-82' gave 45 and 21 per cent more grain yield respectively than the parent cultivar 'YS 52'. The mutant '17-5-83' appeared resistant while the mutants '70-7-82' and '53-11-82' were found to be moderately resistant against the disease. (author). 6 refs., 2 tables
High Quality Rapeseed Products as Feed for Sensitive Monogastrics
DEFF Research Database (Denmark)
Frandsen, Heidi Blok
in plants of the order Brassicales (former known as Capparales), which include rapeseed, rype (Brassica campestris L.) Indian mustard (Brassica juncea L.), broccoli (Brassica oleracea L.var. italica) and many other plants. Glucosinolates have been studied widely for their biologic effects ranging from...... by xenobiotica enzymes in the liver. The last study (manuscript IV) deals with the novel processing techniques, pulsed electric field (PEF) and high pressure treatment (HPT) and the processing effects on glucosinolates in broccoli. The largest effects were observed to be a result of the different handling...... of the plant materials prior to the process treatment. It was thus found that a great amount of the glucosinolate loss has occurred in the broccoli juice and purée prior to PEF processing. Only a minor loss was observed in broccoli flowers prior to processing, and HP treatment at 700 MPa for 10 min. was found...
2010-07-01
... and Pseudomonas syringae pv. tomato specific Bacteriophages. 180.1261 Section 180.1261 Protection of.... vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages. An exemption from the requirement of... syringae pv. tomato specific bacteriophages in or on pepper and tomato. [74 FR 26536, June 3, 2009] ...
Yaseen, Muhammad; Aziz, Muhammad Zahir; Komal, Aqleema; Naveed, Muhammad
2017-09-02
Disposal of industrial wastewater is a current issue of urbanization. However, this problem can be sorted out by using wastewater as an alternate source of irrigation after the addition of some amendment. In this way, the problem of disposal of wastewater not only will be resolved but also scarcity of irrigation water can be kept off in the future. The current research study was performed to evaluate the influence of different concentrations of wastewater along with canal water for enhancing growth and yield of field mustard. Plants were irrigated with different mixtures of canal water and wastewater (75:25, 50:50, 25:75, and 00:100) in addition to canal water as control. The results revealed that application of 50:50% waste and canal water improved plant height, the number of pods plant -1 , pod length, root length, root dry weight, shoot dry weight, 100 grain weight, grain and biomass yield plant -1 , and nitrogen, phosphorus, and potassium concentration in grain and straw up to 16%, 15%, 17%, 29%, 15%, 56%, 25%, 41%, 35%, 20%, 52%, 45%, 20%, 44%, and 42%, respectively, over positive control treatment. While, nutrient uptakes and agronomic efficiency of fertilizers also improved by the application of 50:50% canal and wastewater compared to positive control treatment. Furthermore, the concentration of heavy metals, predominantly Cr, Cu, Cd, and Pb, was reduced in grains by application of 50% canal water and 50% wastewater. The outcomes suggest that wastewater utilization along with canal water mixing might be an effective approach for enhancing growth and yield of field mustard.
Heritability studies for seed quality traits in introgressed segregating populations of brassica
International Nuclear Information System (INIS)
Farhatullah, S.; Nasim, A.; Fayyaz, L.
2014-01-01
Estimation of genetic parameters in the context of trait characterization is an essential component of future targeted crop improvement programs. Collection of knowledge about genetic behavior such as genetic variability and heritability etc., of the germplasm is the basic step for initiation of any breeding program. Genetic variability and Broad sense heritability for various seed quality traits in 10 brassica genotypes and their 12 F2 progenies comprising of introgressed hybrids were studied. The genotypes had highly significant variation for oil content, protein, glucosinolates contents, oleic, linolenic and erucic acid contents. Glucosinolates content and erucic acid showed high heritability in all F2 populations, while rest of the traits showed variable trends. The cross combination 547 x 118 (B. napus x B. campestris) proved to be a good interspecific hybrid that had high proportion of introgression and has high heritability for beneficial traits. The individual plants having combination of desirable traits were also identified from the F2 populations. (author)
Field dodder – How to control it?
Directory of Open Access Journals (Sweden)
Marija Sarić-Krsmanović
2015-04-01
Full Text Available Broad geographic distribution and spectrum of hosts make field dodder, Cuscuta campestris, one of the most widespread and most harmful pests among flowering parasitic plants. Field dodder may become a problem in vegetable nurseries (e.g. tomato, sweet pepper and cabbage or in potato or some other crop grown in plastic greenhouses. However, the most devastating damage comes from field dodder outbreaks in newly-established perennial legume crops (alfalfa, clover, etc., which are generally the preferred hosts of this parasitic flowering species. Apart from alfalfa and clover, an expansion of field dodder has been observed in recent years in sugar beet, too. Different measures are available for controlling field dodder, from preventive (pure seeding material, tolerant cultivars, etc., to mechanical removal (mowing and hand weeding to herbicide treatments. The most successful control of field dodder requires a systematic approach ensured through integrated protection, which contributes to a more effective control of parasitic flowering plants.
Development of drilling fluids based on polysaccharides and natural minerals
Directory of Open Access Journals (Sweden)
Zhanar Nurakhmetova
2016-03-01
Full Text Available The technology of oil well drilling in complex geological conditions by applying the drilling muds based on the polysaccharides – gellan, xanthan and their mixture which potentially possess a good flocculation properties and the ability to reversible sol-gel transition in dependence of temperature and concentration of low molecular weight cations in water has been justified in this work. For the preparation of drilling muds, gellan and xanthan were used, these polymers were obtained from biomass by an aerobic fermentation using microorganisms Sphingomonas elodea and Xanthomonas campestris. Bentonite was used as a natural mineral. Physical and chemical characteristics of aqueous and aqueous-salt solutions of natural polysaccharide gellan including: density, intrinsic and effective viscosity, static shear stress, dynamic shear stress, sedimentation stability and other parameters were determined while varying polymer compositions and concentrations, ionic strength of the solution, nature of low molecular weight salts, concentration of dispersion phase, pH of the medium and temperature.
Directory of Open Access Journals (Sweden)
Teguh Pratama
2017-03-01
Full Text Available Cruciferous vegetables are very important agricultural commodities for increasing farmers income. The main obstacles in their cultivation involved among others high level of pathogen infestation that may cause reduction in farmer’s income. This research was conducted to determine the main pathogens and their impact on farmer income in Agropolitan area of Cianjur Regency, West Java Province. The research was conducted through three activities, i.e. farmer survey, identification of the main pathogens, and measurement of disease intensity. The results showed that there were three main pathogens on assessed cruciferous vegetables, i.e. Alternaria brassiccicola (alternaria leaf spot, Plasmodiophora brassicae (clubroot, and Xanthomonas campestris (black rot, with disease intensity of 16.7%, 18.7%, and 15.1%, respectively. Clubroot disease was the most affecting disease in decreasing the production of cruciferous vegetables and the farmer income. Incidence of clubroot disease with an average disease intensity of 16.67% might lead to the decrease of farming income about 24%–28%.
ANALYSIS OF SLG GENE – THE MOLECULAR MARKER IN HYBRID BREEDING OF OIL SEED RAPE
Directory of Open Access Journals (Sweden)
L DOLANSKÁ
2004-07-01
Full Text Available Oil seed rape (Brassica napus L. cultivars, donors of quality (SC and self-incompatible (SI lines have been analysed using identification of S-locus. In several Brassica napus cultivars one S-locus SLG gene was detected as dominant and the second S-locus as recessive. Amplification class II SLG gene screened recessive gene in all analysed samples (SC and SI. The DNA fragment of recessive gene corresponded to SLG gene W found in cv. Westar. S-haplotypes were analysed by PCR-RFLP. Different Brassica napus cultivars had an identical electrophoretic profile conforming with nonfunctional A10 allele in B. campestris. In B. napus A10 allele is localised in genome A. The functional recessive SLG gene is probably localised in genome C. Model of their segregation was suggested. SC and SI plants segregated in F2 generation at the ratio of approximately 3:1. This indicates a recessive monogenic disposition of SI in the experimental population.
Synthesis and biological evaluations of a series of thaxtomin analogues.
Zhang, Hongbo; Wang, Qingpeng; Ning, Xin; Hang, Hang; Ma, Jing; Yang, Xiande; Lu, Xiaolin; Zhang, Jiabao; Li, Yonghong; Niu, Congwei; Song, Haoran; Wang, Xin; Wang, Peng George
2015-04-15
Thaxtomins are a unique family of phytotoxins with unique 4-nitroindole and diketopiperazine fragments possessing potential herbicidal activities. This work presents the total synthesis of natural product thaxtomin C and its analogues. The extensive structure-activity relationship study screens four effective compounds, including thaxtomin A and thaxtomin C. It is indicated that 4-nitro indole fragment is essential for phytotoxicity, while benzyl and m-hydroxybenzyl substituents on the diketopiperazine ring are favorable for the efficacy. The N-methylations on indole and diketopiperazine show weak influence on the herbicidal activities. The four selected compounds show effective herbicidal activities against Brassica campestris, Amaranthus retroflexus, and Abutilon theophrasti, which are comparable or better than dichlobenil, even at a dosage of 187.5 g ha(-1). Moreover, these four compounds show good crop-selective properties to different crops and exhibit moderate protoporphyrinogen oxidase (PPO) enzyme inhibition. The antifungal results indicate that thaxtomin C displays inhibition to a wide range of fungi.
Effect of biochar and humic acid on the copper, lead, and cadmium passivation during composting.
Zhou, Haibin; Meng, Haibo; Zhao, Lixin; Shen, Yujun; Hou, Yueqing; Cheng, Hongsheng; Song, Liqiu
2018-06-01
In this study, two different biochars (sawdust charcoal (SDC) and wheat straw charcoal (WSC)) and biological humic acid (BHA) were used with different addition rates in pig manure composting to illustrate the effect on heavy metals passivation. And the composts were applied to rape (Brassica campestris L.) growth to illustrate the stability of the passivation. Results showed the concentration of Cu, Cd, and Pb increased after composting, whereas the passivation rates of Cu, Pb, and Cd reached a maximum of 94.98%, 65.55%, and 68.78%, respectively. When the composts were applied to rape growth, the exchangeable fraction of Cu, Pb, and Cd in the soil further decreased and reduced the accumulation of heavy metals in the rape plant. The rape yield increased by 19.39%-34.35%. The optimal addition ratios of the three passivators were SDC 5%, WSC 7.5% and BHA 2.5% to reduce the health risk of heavy metals in rape products. Copyright © 2018 Elsevier Ltd. All rights reserved.
Microwave Irradiated Copolymerization of Xanthan Gum with Acrylamide for Colonic Drug Delivery
Directory of Open Access Journals (Sweden)
Fozia Anjum
2015-01-01
Full Text Available Xanthan gum (XG is a polysaccharide produced by Xanthomonas campestris. The aim of the present study was to modify the xanthan by hydrolysis and grafting with acrylamide through microwave irradiation for different time intervals. Pure xanthan was partially hydrolyzed via enzymatic and chemical treatments followed by optional grafting. Proximate composition analysis, moisture content, and carbohydrate, protein, lipid, and fiber contents were determined. The morphological characteristics, structural composition, functional groups, and heat resistance of the crude, hydrolyzed, and grafted gum were evaluated using SEM, XRD, FTIR spectroscopy, and TGA. Morphological studies revealed that xanthan was broken down into smaller fragments as a result of hydrolysis and became somewhat smoother. Thermal analysis studies indicated a larger heat tolerance in the grafted xanthan relative to that of the native and hydrolyzed gums. Xanthan bound to a triamcinolone drug was evaluated in the context of controlled drug release. Controlled drug release correlated well with the exposure time to microwaves used to graft the gum.
Susceptibility of Postharvest Pathogens to Esential Oils
Directory of Open Access Journals (Sweden)
Božik M.
2017-09-01
Full Text Available Antimicrobial volatile substances from plants represent alternatives to synthetic pesticides and food preservatives. In this study, the compositions of some essential oils were determined by gas chromatography with mass spectrometry, and the inhibitory properties of the essential oils and their components against the bacterial postharvest pathogens Pectobacterium carotovorum subsp. carotovorum (CCM 1008, Pseudomonas syringae (CCM 7018, Xanthomonas campestris (CCM 22 were determined by the microdilution method. Essential oils from oregano, cinnamon, lemongrass, lavender, clove, rosemary, tea tree, eucalyptus, garlic, and ginger and their components cinnamaldehyde, eugenol, thymol, and carvacrol were used in the tests. The essential oil components exhibited strong antibacterial activity against all tested bacteria. The oregano and cinnamon essential oils were most effective. The rosemary, lavender, tea tree, eucalyptus, garlic, and ginger oils were not effective at the tested concentrations. In conclusion, certain essential oils, particularly their components, are highly effective and could be used for the control of postharvest bacterial pathogens.
Directory of Open Access Journals (Sweden)
Messias Gonzaga Pereira
2009-01-01
Full Text Available This study aimed to advance generations and select superior sweet pepper genotypes with resistance tobacterial spot, using the breeding method Single Seed Descent (SSD based on the segregating population derived from thecross between Capsicum annuum L. UENF 1421 (susceptible, non-pungent and UENF 1381 (resistant, pungent. Thesegregating F3 generation was grown in pots in a greenhouse until the F5 generation. The F6 generation was grown in fieldconditions. The reaction to bacterial spot was evaluated by inoculation with isolate ENA 4135 of Xanthomonas campestris pv.vesicatoria, based on a score scale and by calculating the area under the disease progress curve (AUDPC. The presence orabsence of capsaicin was also assessed. Eighteen F6 lines were bacterial leaf spot-resistant. Since no capsaicin was detectedin the F6 lines 032, 316, 399, 434, and 517, these will be used in the next steps of the sweet pepper breeding program.
Directory of Open Access Journals (Sweden)
Xuan Chen
2016-01-01
Full Text Available MicroRNAs (miRNAs are a class of small noncoding RNA that, through mediating posttranscriptional gene regulation, play a critical role in nearly all biological processes. Over the last decade it has become apparent that plant miRNAs may serve as a novel functional component of food with therapeutic effects including anti-influenza and antitumor. Rapeseed bee pollen has good properties in enhancing immune function as well as preventing and treating disease. In this study, we identified the exogenous miRNAs from rapeseed bee pollen in mice blood using RNA-seq technology. We found that miR-166a was the most highly enriched exogenous plant miRNAs in the blood of mice fed with rapeseed bee pollen, followed by miR-159. Subsequently, RT-qPCR results confirmed that these two miRNAs also can be detected in rapeseed bee pollen. Our results suggested that food-derived exogenous miRNAs from rapeseed bee pollen could be absorbed in mice and the abundance of exogenous miRNAs in mouse blood is dependent on their original levels in the rapeseed bee pollen.
Directory of Open Access Journals (Sweden)
Heloísa Monteiro de Andrade
2009-01-01
Full Text Available Metabótitos secundários produzidos em algumas plantas podem provocar alterações no desenvolvimento de outras plantas ou até mesmo de outros organismos. Neste trabalho, objetivou-se identificar possíveis efeitos alelopáticos de extratos aquosos de folhas de Cyperus rotundus na germinação e no crescimento de plântulas de Brassica campestris, Brassica oleracea var. botrytis, Brassica oleracea var. capitata, Brassica oleracea var. italica, Brassica rapa, Lactuca sativa cv. Grand rapids, Lycopersicum esculentum e Raphanus sativus. Foram utilizadas sete concentrações do extrato aquoso (0, 10, 30, 50, 70, 90 e 100%. Os tratamentos foram arranjados em delineamento inteiramente casualizado, com cinco repetições de dez sementes das espécies cultivadas, constituindo a unidade amostral. Os extratos aquosos de C. rotundus evidenciaram potencialidades alelopáticas na germinação das sementes e no crescimento das duas partes vegetais (raiz e parte aérea, de todas as espécies testadas, exceto na germinação de sementes de tomate e de alface, sendo que a redução aumentou com o aumento das concentrações dos extratos aquosos utilizados. A estrutura vegetal mais afetada em presença dos extratos aquosos foi o sistema radicular das plântulas.Secondary metabolites produced in some plant species may promote changes in the development of other plants or even in other organisms. The aim of this work was to identify the possible allelopathic effects of aqueous extracts of Cyperus rotundus leaves on germination and growth of Brassica campestris, Brassica oleracea var. botrytis, Brassica oleracea var. capitata, Brassica oleracea var. italica, Brassica rapa, Lactuca sativa cv. Grand rapids, Lycopersicum esculentum and Raphanus sativus seedlings. Seven aqueous extract concentrations were used (0, 10, 30, 50, 70, 90, and 100%. The treatments were arranged in a completely randomized desing, with five replications of ten seeds of each cultivated species
Directory of Open Access Journals (Sweden)
Elif Çepni
2012-01-01
Full Text Available In this study, Pseudomonas syringe pathovars isolated from olive, tomato and bean were identified by species-specific PCR and their genetic diversity was assessed by repetitive extragenic palindromic (REP-PCR. Reverse universal primers for REP-PCR were designed by using the bases of A, T, G or C at the positions of 1, 4 and 11 to identify additional polymorphism in the banding patterns. Binding of the primers to different annealing sites in the genome revealed additional fingerprint patterns in eight isolates of P. savastanoi pv. savastanoi and two isolates of P. syringae pv. tomato. The use of four different bases in the primer sequences did not affect the PCR reproducibility and was very efficient in revealing intra-pathovar diversity, particularly in P. savastanoi pv. savastanoi. At the pathovar level, the primer BOX1AR yielded shared fragments, in addition to five bands that discriminated among the pathovars P. syringae pv. phaseolicola, P. savastanoi pv. savastanoi and P. syringae pv. tomato. REP-PCR with a modified primer containing C produced identical bands among the isolates in a pathovar but separated three pathovars more distinctly than four other primers. Although REP-and BOX-PCRs have been successfully used in the molecular identification of Pseudomonas isolates from Turkish flora, a PCR based on inter-enterobacterial repetitive intergenic concensus (ERIC sequences failed to produce clear banding patterns in this study.
Bolos, C A; Nikolov, G S; Ekateriniadou, L; Kortsaris, A; Kyriakidis, D A
1998-01-01
Ethylenediamine (en), putrescine (pu), diethylenetriamine (dien), dipropylenetriamine (dpta), spermidine (spmd) and their Cu(II) compounds as well as the Schiff bases with 2-furaldehyde (dienOO), 2- thiophenecarboxaldehyde (dienSS) and pyrrole-2-carboxaldehyde (dienNN) of dien and that of dpta with 2- thiophenecarboxaldehyde (dptaSS), were prepared and characterised. They were tested against Bacillus substilis, Bacillus cereus, Staphylococcus aureus, Escherichia coli, Proteus vulgaris and Xanthomonas campestris as antibacterial reagents, the highest activity being exhibited by Cu(dptaSS)(NO(3))(2) complex, which acts as antibiotic. In the antiproliferative tests (vs. T(47)D,L(929) and BHK(21/c13) cell lines) the best results were obtained with Cu(dptaSS)(2+) and Cu(dienSS)(2+). Electronic structure calculations gave for dptaSS and dienSS the higher negative charges on the N atoms. The counter-ions (Br(-), NO(3) (-) and SO(4) (2-)) play an important role by modulating the reagent's selectivity versus the bacteria [Gram(+) or Gram(-)], but they have no effect on the antiproliferative activity.
Reducing plant uptake of PAHs by cationic surfactant-enhanced soil retention
Energy Technology Data Exchange (ETDEWEB)
Lu Li, E-mail: ll19840106@zju.edu.c [Department of Environmental Science, Zhejiang University, Hangzhou, Zhejiang 310028 (China); Zhu Lizhong, E-mail: zlz@zju.edu.c [Department of Environmental Science, Zhejiang University, Hangzhou, Zhejiang 310028 (China); Ministry of Education Key Laboratory of Environmental Remediation and Ecological Health, Zhejiang University, Hangzhou, Zhejiang 310029 (China)
2009-06-15
Reducing the transfer of contaminants from soils to plants is a promising approach to produce safe agricultural products grown on contaminated soils. In this study, 0-400 mg/kg cetyltrimethylammonium bromide (CTMAB) and dodecylpyridinium bromide (DDPB) were separately utilized to enhance the sorption of PAHs onto soils, thereby reducing the transfer of PAHs from soil to soil solution and subsequently to plants. Concentrations of phenanthrene and pyrene in vegetables grown in contaminated soils treated with the cationic surfactants were lower than those grown in the surfactant-free control. The maximum reductions of phenanthrene and pyrene were 66% and 51% for chrysanthemum (Chrysanthemum coronarium L.), 62% and 71% for cabbage (Brassica campestris L.), and 34% and 53% for lettuce (Lactuca sativa L.), respectively. Considering the impacts of cationic surfactants on plant growth and soil microbial activity, CTMAB was more appropriate to employ, and the most effective dose was 100-200 mg/kg. - Cationic surfactants could enhance the retention of PAHs in soil, and reduce PAH transfer to and accumulation in vegetables.
Synthesis, crystal structure and biological activity of a novel 1,2,3-thidiazole compound
International Nuclear Information System (INIS)
Ke, W.
2013-01-01
A new 1,2,3-thiadiazole compound was synthesized and characterized by 1H NMR, MS and HRMS. The crystal structure of the title compound (C/sub 12/H/sub 11/ClN/sub 2/O/sub 4/S/sub 2/, Mr = 346.80) has been determined by single-crystal X-ray diffraction. The crystal is of triclinic, space group P-1 with a = 8.4425(17) A, b = 8.9801(18) A, c = 9.859(2) A, alpha = 84.36(3) degree, beta = 86.71(3)degree, lambda = 83.25(3) degree, V = 737.9(3)A3, Z 2, F(000) = 356, Dc = 1.561 g/cm/sup 3/, mu = 0.557 mm-1, the final R1 0.0380 and wR2 = 0.0982 for 2160 observed reflections with I > 2sigma(I). A total of 12585 reflections were collected, of which 2601 were independent (Rint 0.0364). The herbicidal activity of title compound was determined, the results showed the title compound displayed excellent herbicidal activity against Brassica campestris. (author)
Effect of plant species on nitrogen recovery in aquaponics.
Hu, Zhen; Lee, Jae Woo; Chandran, Kartik; Kim, Sungpyo; Brotto, Ariane Coelho; Khanal, Samir Kumar
2015-01-01
Nitrogen transformations in aquaponics with different edible plant species, i.e., tomato (Lycopersicon esculentum) and pak choi (Brassica campestris L. subsp. chinensis) were systematically examined and compared. Results showed that nitrogen utilization efficiencies (NUE) of tomato- and pak choi-based aquaponic systems were 41.3% and 34.4%, respectively. The abundance of nitrifying bacteria in tomato-based aquaponics was 4.2-folds higher than that in pak choi-based aquaponics, primarily due to its higher root surface area. In addition, tomato-based aquaponics had better water quality than that of pak choi-based aquaponics. About 1.5-1.9% of nitrogen input were emitted to atmosphere as nitrous oxide (N2O) in tomato- and pak choi-based aquaponic systems, respectively, suggesting that aquaponics is a potential anthropogenic source of N2O emission. Overall, this is the first intensive study that examined the role plant species played in aquaponics, which could provide new strategy in designing and operating an aquaponic system. Copyright © 2015 Elsevier Ltd. All rights reserved.
Ishibashi, Naoki; Himeno, Kohei; Fujita, Koji; Masuda, Yoshimitsu; Perez, Rodney Honrada; Zendo, Takeshi; Wilaipun, Pongtep; Leelawatcharamas, Vichien; Nakayama, Jiro; Sonomoto, Kenji
2012-01-01
Enterocins NKR-5-3A, B, C, and D were purified from the culture supernatant of Enterococcus faecium NKR-5-3 and characterized. Among the four purified peptides, enterocin NKR-5-3A (5242.3 Da) was identical to brochocin A, produced by Brochothrix campestris ATCC 43754, in mature peptides, and its putative synergistic peptide, enterocin NKR-5-3Z, was found to be encoded in ent53Z downstream of ent53A, encoding enterocin NKR-5-3A. Enterocin NKR-5-3B (6316.4 Da) showed a broad antimicrobial spectrum, and enterocin NKR-5-3C (4512.8 Da) showed high activity against Listeria. Enterocin NKR-5-3D (2843.5 Da), showing high homology to an inducing peptide produced by Lactobacillus sakei 5, induced the production of the enterocins. The enterocins showed different antimicrobial spectra and intensities. E. faecium NKR-5-3 concomitantly produced enterocins NKR-5-3A, B, C, and D which probably belong to different classes of bacteriocins. Furthermore, NKR-5-3 production was induced by enterocin NKR-5-3D.
Determination of the contents and distribution characteristics of REE in natural plants by NAA
International Nuclear Information System (INIS)
Wang, Y.Q.; Sun, J.X.; Chen, H.M.; Guo, F.Q.
1997-01-01
The concentration of 8 REEs (La, Ce, Nd, Sm, Eu, Tb, Yb and Lu) in 17 species of plants and their host soil, which were collected from a rare earth ore area located in the south of China, have been determined by INAA. The chondritic normalized REE patterns for different parts of plants (e.g., leaf, stem and root) and their host soils were studied. The results showed that the concentration levels of REE for most plants in the sampling area were elevated. Particularly, the leaves of the fern (Dicranopteris dichotoma) contain extremely high concentration of the total REE (675-3358 μg/g). Generally, these REE distribution patterns in every part of plants were very similar and reflected the characteristics of their host soils. However, the chondritic normalized REE patterns in some plants relative to the host soil revealed obvious fractionation, such as the depletion of the heavy REE (for fern, Citrus reticulata and Brassia campestris), the heavy REE enrichment (for Camellia sinensis, Camellia oleifera and Ziziphus) and the Ce positive anomaly (for Gardenia jasminoides). (author)
International Nuclear Information System (INIS)
Bakht, J.; Panni, M. K.; Shafi, M.
2017-01-01
Investigation of susceptibility of medicinal plants for bacterial pathogens is significant for suitable choice of treatment. Different solvent extracted samples of Viola pilosa shoots were investigated for their antibacterial and phytochemical activities using 0.5, 1 and 2 mg disc-1 concentrations. The antibacterial bioassay was assayed by disc diffusion method against six microbes. The studies revealed that ethyl acetate extracted fractions resulted in maximum growth inhibition of Pseudomonas aeruginosa and Staphylococcus aureus at 2000 mu g disc-1 concentration. Similarly, Xanthomonas campestris and Klebsiella pneumonia were found more susceptible to n-butanol extract. Maximum reduction in the activity of B. subtilis and E. coli was recorded by n-hexane fractions at two mg per disc. The most susceptible microbe was Pseudomonas aeruginosa. The results further revealed that all the tested microbes were found completely resistant to water extracted fractions at all the tested concentrations measuring 0% ZI. Phytochemical analysis showed the presence of various bioactive compounds including flavonoids, glycosides, proteins, fats, alkaloids, steroids, saponins, carbohydrates and tannins. (author)
Mud-plastered granary-baskets at a Celtic Oppidum near Čarnok (Vojvodina, Serbia
Directory of Open Access Journals (Sweden)
Medović Aleksandar
2011-01-01
Full Text Available In the Celtic Oppidum near Čarnok (Bačka, Vojvodina, Serbia remains of four mud-plastered granarybaskets were discovered. They are all dated to the period Gomolava VI-B (first half of the 1st century B.C.. Hulled barley and broomcorn millet were stored in the granary-baskets. The mesh of the granary-baskets was composed of young branches of oak tree (Quercus, common English elm tree (Ulmus cf. campestris L., poplar / willow (Populus / Salix, purgin buckthorn (Rhamnus cf. cathartica L., wayfaring tree (Viburnum cf. lantana L., spindle tree (Euonymus cf. europaeus L., barberry (Berberis vulgaris L. and a Pomoidae-tree. At least four different tree taxa were used for basket making. Construction of two-thousand-year old mud-plastered granary-baskets from the Pannonian plain is very similar to that of traditional granaries in some present-day villages in Africa. Additionally, one non-plastered basket was also discovered at Oppidum. It was build out of maple (Acer, barberry, buckthorn (Rhamnus and branches of a pomaceous fruits tree (Pomoidae. .
Reducing plant uptake of PAHs by cationic surfactant-enhanced soil retention
International Nuclear Information System (INIS)
Lu Li; Zhu Lizhong
2009-01-01
Reducing the transfer of contaminants from soils to plants is a promising approach to produce safe agricultural products grown on contaminated soils. In this study, 0-400 mg/kg cetyltrimethylammonium bromide (CTMAB) and dodecylpyridinium bromide (DDPB) were separately utilized to enhance the sorption of PAHs onto soils, thereby reducing the transfer of PAHs from soil to soil solution and subsequently to plants. Concentrations of phenanthrene and pyrene in vegetables grown in contaminated soils treated with the cationic surfactants were lower than those grown in the surfactant-free control. The maximum reductions of phenanthrene and pyrene were 66% and 51% for chrysanthemum (Chrysanthemum coronarium L.), 62% and 71% for cabbage (Brassica campestris L.), and 34% and 53% for lettuce (Lactuca sativa L.), respectively. Considering the impacts of cationic surfactants on plant growth and soil microbial activity, CTMAB was more appropriate to employ, and the most effective dose was 100-200 mg/kg. - Cationic surfactants could enhance the retention of PAHs in soil, and reduce PAH transfer to and accumulation in vegetables.
International Nuclear Information System (INIS)
Perveen, A.; Khan, M.
2014-01-01
This is the first aerobiological survey of Khairpur, Sindh. The survey was conducted from January-December, 2011 using Burkard's Seven Days Volumetric Spore trap. A total of 4559 pollen/m3 were recorded belonging to 33 plant families and 41 pollen types. The major pollen types were Poaceae (13.84%), Amaranthaceae/ Chenopodiaceae (10.40%), Cyperus rotundus (7.61%); Prosopis juliflora (6.19%), Brassica campestris (4.91%), Typha angustifolia (4.89%), Tamarix indica (4.43%), Eucalyptus globules (4.28%), Conocarpus erectus (3.73%), Asteraceae (3.01%), Guaicum officinale (2.94%), Azadirachta indica (2.74%), Malvaceae (2.15%) and Phoenix dactylifera (1.84%) constituting more than 70% of total pollen catch. The highest pollen grains concentration was observed in May-2011 with 880 pollen/m3 count while second highest pollen concentration was detected in September 2011 with 682 pollen/m3. The lowest count was found in December- 2011. Climatic factors like wind speed, average temperature, humidity and rainfall were correlated with the pollen counts. Different pollen types showed significant positive correlation with average temperature while negative correlation with humidity and wind speed. (author)
International Nuclear Information System (INIS)
Wang Haiyan; Yang Zhen; Liu Ruyang; Fu Qiuguo; Zhang Sufen; Li Juying; Zhao Xiaojun; Ye Qingfu; Wang Wei; Li Zhong
2014-01-01
Paichongding, a neonicotinoid chiral insecticide containing two chiral centers, is a promising substitute for the widely used imidacloprid because it is effective against many imidacloprid-resistant insects. In this study, four optically-pure stereoisomers of Paichongding with 5R, 7R, 5S, 7S, 5S, 7R, and 5R, 7S were employed in both foliar and root of Chinese pak choi to investigate the stereoselective uptake and distribution of the insecticide in pak choi. The results showed, after foliar application, total absorption of individual "1"4C-Paichongding stereoisomers into pak-choi plants demonstrated no stereoselectivity between the enantiomers. The translocation of the four absorbed stereoisomers within pak choi occurred in both acropetal and basipetal directions and the transport of "1"4C from enantiomers 5R, 7R and 5S, 7S were significantly higher than enantiomers 5R, 7S and 5S, 7R. The statistically significant stereoselective translocation inside plants was observed between Paichongding epimers. Root treatment revealed that enantioselective and diastereoselective root uptake into pak-choi plants were both found between the four enantiomers. The enantiomers of 5R, 7S and 5S, 7R were more readily taken up by roots, and more readily accumulated in edible leaves than 5R, 7R and 5S, 7S. These results will help to develop an understanding of the proper application of Paichongding isomers in vegetables, and give useful information for food and environmental assessments of chiral pesticides. (authors)
International Nuclear Information System (INIS)
Khanna-Chopra, R.; Sinha, S.K.
1976-01-01
Dry weight changes in fruit wall and seed during fruit development in the pea and mustard were suggestive of the importance of fruit wall during seed development. So the relative photosynthetic potential of leaves and reproductive parts in the above crops were studied. In addition, the translocation of current photosynthates to the developing seeds was also assessed when fruits and leaves were fed 14 CO 2 independently. Considerable amount of photosynthetic carboxylase activity was observed in the fruit wall of both pea and mustard on unit fresh weight, chlorophyll and organ basis. On unit chlorophyll basis fruit wall had several times more activity than leaves. Both fruit wall as well as leaves translocated current photosynthates to the developing fruits. In the early stages, translocation from the leaves was more efficient but in the later stages, more translocation occurred from the fruit wall as compared with the leaves. Above results are discussed in relation to the importance of reproductive organs in the developing seeds. (author)
Directory of Open Access Journals (Sweden)
Ju-Hee Kim
2015-06-01
Full Text Available This study was carried out to develop the economic thresholds for the control of bacterial spot of red pepper. The correlation between diseased leaf rate and yield in field was Y = -0.724X + 281.58, R² = 0.78, r = -0.88**. The correlation between diseased leaf rate and yield loss in field was Y = 0.813X + 15.95, R² = 0.78, r = 0.88*. We found that control thresholds was below 30.3% diseased leaves rate per plant in field. The economic control thresholds for bacterial spot of red pepper was below 16.3%.
Zahoor, Mahwish; Irshad, Muhammad; Rahman, Hazir; Qasim, Muhammad; Afridi, Sahib Gul; Qadir, Muhammad; Hussain, Anwar
2017-08-01
Heavy metal (HM) pollution is of great concern in countries like Pakistan where a huge proportion of human population is exposed to it. These toxic metals are making their way from water bodies to soil where it not only interferes with plant growth and development but also initiates serious health issues in human consuming the produce of such soils. Bioremediation is one of the most viable and efficient solution for the problem. Purpose of the current study was to isolate endophytic fungi from plants grown on HM contaminated soil and screen them for their ability to tolerate multiple HM including chromium (Cr 6+ ), manganese (Mn 2+ ), cobalt (Co 2+ ), copper (Cu 2+ ) and zinc (Zn 2+ ). Out of 27 isolated endophytes, only one strain (MHR-7) was selected for multiple heavy metals tolerance. The strain was identified as Mucor sp. by 18S and 28S ribosomal RNA internal transcribed spacer (ITS) 1 and 4 sequence homology. The strain effectively tolerated up to 900µgmL -1 of these heavy metals showing no remarkable effect on its growth. The adverse effect of the heavy metals, measured as reduction of the fungal growth increased with increasing concentration of the metals. The strain was able to remove 60-87% of heavy metals from broth culture when supplied with 300µgmL -1 of these metals. A trend of decline in bioremediation potential of the strain was observed with increasing amount of metals. The strain removed metals by biotransformation and/or accumulation of heavy metal in its hyphae. Application of Mucor sp. MHR-7 locked down HM in tis mycelium thereby making them less available to plant root reducing HM uptake and toxicity in mustard. Besides its bioremediation potential, the strain was also able to produce IAA, ACC deaminase and solubilize phosphate making it excellent phytostimulant fungus. It is concluded that MHR-7 is an excellent candidate for use as biofertilizer in fields affected with heavy metals. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Fábio Rossi Cavalcanti
2006-12-01
Full Text Available O objetivo deste trabalho foi avaliar a influência de eliciadores biológicos e químicos sobre as atividades de duas proteínas relacionadas à patogênese (PR, quitinase e beta-1,3-glucanase, em folhas de tomateiro, e avaliar o potencial desses eliciadores na redução do progresso da mancha-foliar causada por Xanthomonas campestris pv. vesicatoria. Plantas de tomateiro da cultivar Santa Cruz Kada foram pulverizadas com: acibenzolar-S-metil (ASM; 0,2 g L-1; formulação biológica proveniente de biomassa cítrica, denominada Ecolife (5 mL L-1; suspensão de quitosana (MCp; 200 g L-1, proveniente de micélio de Crinipellis perniciosa; extrato aquoso de ramos de lobeira (Solanum lycocarpum infectados por C. perniciosa (VLA; 300 g L-1. As plantas foram desafiadas com um isolado virulento da bactéria, quatro dias depois das pulverizações. Plantas pulverizadas com extratos biológicos mostraram redução da mancha-bacteriana. ASM proporcionou 49,3% de proteção, e foi igual à MCp e Ecolife e superior ao VLA. Este último não diferiu significativamente de MCp e Ecolife. Observou-se maior atividade das duas enzimas nas plantas tratadas, principalmente nas primeiras horas após as pulverizações.The objective of this work was to assess the influence of foliar application of resistance inducers and the activation of plant pathogenesis-related (PR proteins, chitinases and beta-1,3-glucanases, against Xanthomonas campestris pv. vesicatoria, and evaluate the potential of these elicitors on the reduction of bacterial leaf spot. Tomato plants of the cultivar Santa Cruz Kada were sprayed with: acibenzolar-S-methyl (0.2 g L-1 ASM; Ecolife, a biological formulation based on citric biomass (5 mL L-1; chitosan suspension from Crinipellis perniciosa mycelium (MCp; 200 g L-1; an aqueous extract from branches of lobeira (Solanum lycocarpum infected with C. perniciosa (VLA; 300 g L-1. Plants were challenged with a virulent bacterial strain four days after
List of new names of plant pathogenic bacteria (2011-2012)
The International Society of Plant Pathology Committee on the Taxonomy of Plant Pathogenic Bacteria has responsibility to evaluate the names of newly proposed pathovars for adherence to the International Standards for Naming Pathovars of Phytopathogenic Bacteria. Currently, the Comprehensive List of...
Saric-Krsmanovic, Marija M; Bozic, Dragana M; Radivojevic, Ljiljana M; Umiljendic, Jelena S Gajic; Vrbnicanin, Sava P
2017-11-02
The effects of field dodder on physiological and anatomical processes in untreated sugar beet plants and the effects of propyzamide on field dodder were examined under controlled conditions. The experiment included the following variants: N-noninfested sugar beet plants (control); I - infested sugar beet plants (untreated), and infested plants treated with propyzamide (1500 g a.i. ha -1 (T 1 ) and 2000 g a.i. ha -1 (T 2 )). The following parameters were checked: physiological-pigment contents (chlorophyll a, chlorophyll b, total carotenoids); anatomical -leaf parameters: thickness of epidermis, parenchyma and spongy tissue, mesophyll and underside leaf epidermis, and diameter of bundle sheath cells; petiole parameters: diameter of tracheid, petiole hydraulic conductance, xylem surface, phloem cell diameter and phloem area in sugar beet plants. A conventional paraffin wax method was used to prepare the samples for microscopy. Pigment contents were measured spectrophotometrically after methanol extraction. All parameters were measured: prior to herbicide application (0 assessment), then 7, 14, 21, 28 and 35 days after application (DAA). Field dodder was found to affect the pigment contents in untreated sugar beet plants, causing significant reductions. Conversely, reduction in the treated plants decreased 27% to 4% for chlorophyll a, from 21% to 5% for chlorophyll b, and from 28% to 5% for carotenoids (T 1 ). Also, in treatment T 2, reduction decreased in infested and treated plants from 19% to 2% for chlorophyll a, from 21% to 2% for chlorophyll b, from 23% to 3% for carotenoids and stimulation of 1% and 2% was observed 28 and 35 DAA, respectively. Plants infested (untreated) by field dodder had lower values of most anatomical parameters, compared to noninfested plants. The measured anatomical parameters of sugar beet leaves and petiole had significantly higher values in noninfested plants and plants treated with propyzamide than in untreated plants. Also, the results showed that propyzamide is an adequate herbicide for control of field dodder at the stage of early infestation.
International Nuclear Information System (INIS)
Wang, Haiyan; Yang, Zhen; Liu, Ruyang; Fu, Qiuguo; Zhang, Sufen; Cai, Zhiqiang; Li, Juying; Zhao, Xiaojun; Ye, Qingfu; Wang, Wei; Li, Zhong
2013-01-01
Highlights: • Absorption of foliar applied Paichongding by pak choi was not stereoselective. • Foliar uptake and downward transport of Paichongding were both found in pak choi. • Enantioselective and epimer-selective root uptake were observed for Paichongding. • Foliage/root uptake showed diastereoselective transport of Paichongding epimers. • The SR and RS are more easily taken up by roots and accumulated in edible parts. -- Abstract: Neonicotinoid chiral insecticidal Paichongding is a promising substitute for the widely used imidacloprid. Four stereoisomers of Paichongding, 5R,7R, 5S,7S, 5S,7R and 5R,7S, were employed in both foliage and roots of Chinese pak choi to investigate their stereoselective uptake and distribution in pak choi. Results showed that after foliar application, no stereoselective absorption into pak-choi plants was observed among the enantiomers. Total absorptions were 35.40% of the applied amount for 5R,7R, 36.66% for 5S,7S, 36.80% for 5S,7R and 38.20% for 5R,7S at 96 HAT. The translocation of the four absorbed stereoisomers within pak choi occurred both acropetally and basipetally and the transport of 14 C from enantiomers 5R,7R and 5S,7S were significantly higher than for 5R,7S and 5S,7R. Significant stereoselective translocation inside plants was observed between Paichongding epimers. Total root uptake reached 16.49–19.85% for 5R,7R and 5S,7S, and 24.57–28.82% for 5S,7R and 5R,7S at 144 HAT. Both enantioselective and diastereoselective root uptake into pak-choi occurred between the four stereoisomers. The 5R,7S and 5S,7R enantiomers were more readily uptaken by the roots than 5R,7R and 5S,7S and accumulated in the edible leaves. These results will help to develop an understanding of Paichongding using only the target-active enantiomer of pesticides
Directory of Open Access Journals (Sweden)
Lingyun Yuan
2017-06-01
Full Text Available Heat stress is a major environmental stress that limits plant growth and yield worldwide. The present study was carried out to explore the physiological mechanism of heat tolerant to provide the theoretical basis for heat-tolerant breeding. The changes of leaf morphology, anatomy, nitrogen assimilation, and carbohydrate metabolism in two wucai genotypes (WS-1, heat tolerant; WS-6, heat sensitive grown under heat stress (40°C/30°C for 7 days were investigated. Our results showed that heat stress hampered the plant growth and biomass accumulation in certain extent in WS-1 and WS-6. However, the inhibition extent of WS-1 was significantly smaller than WS-6. Thickness of leaf lamina, upper epidermis, and palisade mesophyll were increased by heat in WS-1, which might be contributed to the higher assimilation of photosynthates. During nitrogen assimilation, WS-1 possessed the higher nitrogen-related metabolic enzyme activities, including nitrate reductase (NR, glutamine synthetase (GS, glutamate synthase (GOGAT, and glutamate dehydrogenase (GDH, which were reflected by higher photosynthetic nitrogen-use efficiency (PNUE with respect to WS-6. The total amino acids level had no influence in WS-1, whereas it was reduced in WS-6 by heat. And the proline contents of both wucai genotypes were all increased to respond the heat stress. Additionally, among all treatments, the total soluble sugar content of WS-1 by heat got the highest level, including higher contents of sucrose, fructose, and starch than those of WS-6. Moreover, the metabolism efficiency of sucrose to starch in WS-1 was greater than WS-6 under heat stress, proved by higher activities of sucrose phosphate synthase (SPS, sucrose synthase (SuSy, acid invertase (AI, and amylase. These results demonstrated that leaf anatomical alterations resulted in higher nitrogen and carbon assimilation in heat-tolerant genotype WS-1, which exhibited a greater performance to resist heat stress.
International Nuclear Information System (INIS)
Fan Zhengqi; Cui Hairui
2003-01-01
Cotyledons with petiole were cultured on MS basic medium containing 5 mg/L BA, 0.5 mg/L NAA, 5 mg/L AgNO 3 , and produced adventitious buds with higher frequency. Induction frequency of adventitious buds could be increased by irradiation treatment of γ-rays with the lower dose of 1-2.5 Gy to seedlings and explants in culture, but decreased dramatically when the dose was higher than 10 Gy. Irradiation treatment in co-culture with lower dose of 1-7.5 Gy also promote transient expression frequency of gus gene, while irradiation treatment in pre-culture did not show obvious effect on transient expression of gus gene
Energy Technology Data Exchange (ETDEWEB)
Wang, Haiyan; Yang, Zhen; Liu, Ruyang; Fu, Qiuguo; Zhang, Sufen; Cai, Zhiqiang; Li, Juying; Zhao, Xiaojun [Institute of Nuclear Agricultural Sciences, Key Laboratory of Nuclear Agricultural Sciences of Ministry of Agriculture and Zhejiang Province, Zhejiang University, Hangzhou 310029 (China); Ye, Qingfu, E-mail: qfye@zju.edu.cn [Institute of Nuclear Agricultural Sciences, Key Laboratory of Nuclear Agricultural Sciences of Ministry of Agriculture and Zhejiang Province, Zhejiang University, Hangzhou 310029 (China); Wang, Wei [Institute of Nuclear Agricultural Sciences, Key Laboratory of Nuclear Agricultural Sciences of Ministry of Agriculture and Zhejiang Province, Zhejiang University, Hangzhou 310029 (China); Li, Zhong, E-mail: lizhong@ecust.edu.cn [School of Pharmacy, East China University of Science and Technology, 130 Meilong Road, Shanghai 200237 (China)
2013-11-15
Highlights: • Absorption of foliar applied Paichongding by pak choi was not stereoselective. • Foliar uptake and downward transport of Paichongding were both found in pak choi. • Enantioselective and epimer-selective root uptake were observed for Paichongding. • Foliage/root uptake showed diastereoselective transport of Paichongding epimers. • The SR and RS are more easily taken up by roots and accumulated in edible parts. -- Abstract: Neonicotinoid chiral insecticidal Paichongding is a promising substitute for the widely used imidacloprid. Four stereoisomers of Paichongding, 5R,7R, 5S,7S, 5S,7R and 5R,7S, were employed in both foliage and roots of Chinese pak choi to investigate their stereoselective uptake and distribution in pak choi. Results showed that after foliar application, no stereoselective absorption into pak-choi plants was observed among the enantiomers. Total absorptions were 35.40% of the applied amount for 5R,7R, 36.66% for 5S,7S, 36.80% for 5S,7R and 38.20% for 5R,7S at 96 HAT. The translocation of the four absorbed stereoisomers within pak choi occurred both acropetally and basipetally and the transport of {sup 14}C from enantiomers 5R,7R and 5S,7S were significantly higher than for 5R,7S and 5S,7R. Significant stereoselective translocation inside plants was observed between Paichongding epimers. Total root uptake reached 16.49–19.85% for 5R,7R and 5S,7S, and 24.57–28.82% for 5S,7R and 5R,7S at 144 HAT. Both enantioselective and diastereoselective root uptake into pak-choi occurred between the four stereoisomers. The 5R,7S and 5S,7R enantiomers were more readily uptaken by the roots than 5R,7R and 5S,7S and accumulated in the edible leaves. These results will help to develop an understanding of Paichongding using only the target-active enantiomer of pesticides.
International Nuclear Information System (INIS)
Rafi, H.; Dawar, S.; Tariq, M.
2016-01-01
Organic amendments of soil help in proper aeration, rising of temperature and water holding capacity which results in better uptake of nutrients with root system gets extensive establishment. In this study, effects of soil amendment with oil seed cakes including mustard (Brassica campestris L.), cotton (Gossypium hirsutum L.), almond (Prunus amygdalus L.) and black seed (Nigella sativa L.) cakes at the rate of 0.1 and 1% w/w and priming of seeds with Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L.) leaves extracts and microbial antagonists (Trichoderma harzianum and Rhizobium melilotii) was observed on the growth of plants and in the suppression of root infecting fungi. The results obtained showed that combined effect of bio-priming of seeds with T. harzianum spore suspension and amendment of soil with mustard cake at the rate of 1% was found to be most effective for the growth of leguminous and non-leguminous crop plants (peanut, chickpea, okra and sunflower) and for the reduction of root infecting fungi like Macrophomina phaseolina, Fusarium spp followed by R. meliloti primed seeds in combination with cotton, almond and black seed cakes amendment respectively as compared to control (non treated seeds and soil). (author)
Falandysz, Jerzy
2008-01-01
Selenium is vital to human health. This article is a compendium of virtually all the published data on total selenium concentrations, its distribution in fruitbody, bioconcentration factors, and chemical forms in wild-grown, cultivated, and selenium-enriched mushrooms worldwide. Of the 190 species reviewed (belonging to 21 families and 56 genera), most are considered edible, and a few selected data relate to inedible mushrooms. Most of edible mushroom species examined until now are selenium-poor (cesarea, A. campestris, A. edulis, A. macrosporus, and A. silvaticus. A particularly rich source of selenium could be obtained from selenium-enriched mushrooms that are cultivated on a substrate fortified with selenium (as inorganic salt or selenized-yeast). The Se-enriched Champignon Mushroom could contain up to 30 or 110 microg Se/g dw, while the Varnished Polypore (Ganoderma lucidum) could contain up to 72 microg Se/g dw. An increasingly growing database on chemical forms of selenium of mushrooms indicates that the seleno-compounds identified in carpophore include selenocysteine, selenomethionine, Se-methylselenocysteine, selenite, and several unidentified seleno-compounds; their proportions vary widely. Some aspects of environmental selenium occurrence and human body pharmacokinetics and nutritional needs will also be briefly discussed in this review.
Directory of Open Access Journals (Sweden)
Guy Blomme
2017-07-01
Full Text Available Bacterial diseases of bananas and enset have not received, until recently, an equal amount of attention compared to other major threats to banana production such as the fungal diseases black leaf streak (Mycosphaerella fijiensis and Fusarium wilt (Fusarium oxysporum f. sp. cubense. However, bacteria cause significant impacts on bananas globally and management practices are not always well known or adopted by farmers. Bacterial diseases in bananas and enset can be divided into three groups: (1 Ralstonia-associated diseases (Moko/Bugtok disease caused by Ralstonia solanacearum and banana blood disease caused by R. syzygii subsp. celebesensis; (2 Xanthomonas wilt of banana and enset, caused by Xanthomonas campestris pv. musacearum and (3 Erwinia-associated diseases (bacterial head rot or tip-over disease Erwinia carotovora ssp. carotovora and E. chrysanthemi, bacterial rhizome and pseudostem wet rot (Dickeya paradisiaca formerly E. chrysanthemi pv. paradisiaca. Other bacterial diseases of less widespread importance include: bacterial wilt of abaca, Javanese vascular wilt and bacterial fingertip rot (probably caused by Ralstonia spp., unconfirmed. This review describes global distribution, symptoms, pathogenic diversity, epidemiology and the state of the art for sustainable disease management of the major bacterial wilts currently affecting banana and enset.
Li, Jun-Min; Jin, Ze-Xin; Hagedorn, Frank; Li, Mai-He
2014-11-01
Native parasitic plants may be used to infect and control invasive plants. We established microcosms with invasive Mikania micrantha and native Coix lacryma-jobi growing in mixture on native soils, with M. micrantha being infected by parasitic Cuscuta campestris at four intensity levels for seven weeks to estimate the top-down effects of plant parasitism on the biomass and functional diversity of soil microbial communities. Parasitism significantly decreased root biomass and altered soil microbial communities. Soil microbial biomass decreased, but soil respiration increased at the two higher infection levels, indicating a strong stimulation of soil microbial metabolic activity (+180%). Moreover, a Biolog assay showed that the infection resulted in a significant change in the functional diversity indices of soil microbial communities. Pearson correlation analysis indicated that microbial biomass declined significantly with decreasing root biomass, particularly of the invasive M. micrantha. Also, the functional diversity indices of soil microbial communities were positively correlated with soil microbial biomass. Therefore, the negative effects on the biomass, activity and functional diversity of soil microbial community by the seven week long plant parasitism was very likely caused by decreased root biomass and root exudation of the invasive M. micrantha.
Ibarrondo, I; Prieto-Taboada, N; Martínez-Arkarazo, I; Madariaga, J M
2016-04-01
Raman spectroscopy differentiation of carotenoids has traditionally been based on the ν 1 position (C = C stretching vibrations in the polyene chain) in the 1500-1600 cm(-1) range, using a 785 nm excitation laser. However, when the number of conjugated double bonds is similar, as in the cases of zeaxanthin and β-carotene, this distinction is still ambiguous due to the closeness of the Raman bands. This work shows the Raman results, obtained in resonance conditions using a 514 mm laser, on Lecanora campestris and Lecanora atra species, which can be used to differentiate and consequently characterize carotenoids. The presence of the carotenoid found in Lecanoraceae lichens has been demonstrated to depend on the atmospheric pollution level of the environment they inhabit. Astaxanthin, a superb antioxidant, appears as the principal xanthophyll in highly polluted sites, usually together with the UV screening pigment scytonemin; zeaxanthin is the major carotenoid in medium polluted environments, while β-carotene is the major carotenoid in cleaner environments. Based on these observations, an indirect classification of the stress suffered in a given environment can be assessed by simply analysing the carotenoid content in the Lecanoraceae lichens by using resonance Raman imaging.
Elshafie, Hazem S; Sakr, Shimaa; Mang, Stefania M; Belviso, Sandra; De Feo, Vincenzo; Camele, Ippolito
2016-11-01
There is a growing interest in essential oils (EOs) as possible alternatives for traditional chemical pesticides. This study was carried out to characterize the chemical composition of the three EOs extracted from Verbena officinalis, Majorana hortensis, and Salvia officinalis using gas chromatography (GC) and GC-mass spectrometry (GC-MS) and to evaluate in vitro their efficacy against some phyto or human pathogens. The antifungal activity was investigated against Colletotrichum acutatum and Botrytis cinerea in comparison with Azoxystrobin as a large spectrum fungicide. Antibacterial activity was evaluated against Bacillus megaterium, Bacillus mojavensis, and Clavibacter michiganensis (G+ve) and Escherichia coli, Xanthomonas campestris, Pseudomonas savastanoi, and P. syringae pv. phaseolicola (G-ve) compared to a synthetic antibiotic tetracycline. Minimum inhibitory concentration was evaluated against the above tested fungi using 96-well microplate method. Results showed that the chemical structure of the three studied EOs was mainly composed of monoterpene compounds and all oils belong to the chemotype carvacrol/thymol. Results of GC analysis identified 64 compounds, which were identified based on their mass to charge ratio. Furthermore, the different concentrations of studied EOs inhibited the growth of tested microorganism in a dose-dependent manner.
Farmacopeia natural de comunidades rurais no Estado do Piauí, Nordeste do Brasil
Directory of Open Access Journals (Sweden)
Maria Pessoa da Silva
2015-04-01
Full Text Available The purpose of this work is to know more about medicinal plants, forms of usage and therapeutic indications determined by the communities of Pau-Arrastado, Salinas and Resolvido. We used semi-structured interviews, guided tours and followed the usual botanical methodology. The study sample included 93 individuals (51.9% of the total. Species were grouped into 18 categories of disease, according to the World Health Organization (WHO. We calculated the Factor of Informant Consensus (FIC and the Index of Relative Importance (IRI. They included eighty-one (81 species, belonging to 40 botanical families and 69 genera were referred, of which 75.3% were native ones. The most prominent family was Fabaceae (18.5%, and the leaves were the most used parts (32%. The preparation method most used was dye (38.2%. The highlights were the body systems: agents of bacterial and viral infections (27.2%, digestive system diseases (22.4% and genitourinary diseases (19.5%. Croton campestris A. St. Hil. and Ximenia americana L. were the most versatile with an IRI of 2.00. There was a greater consensus for the plants indicated for the treatment of liver diseases.
Natural metabolites for parasitic weed management.
Vurro, Maurizio; Boari, Angela; Evidente, Antonio; Andolfi, Anna; Zermane, Nadjia
2009-05-01
Compounds of natural origin, such as phytotoxins produced by fungi or natural amino acids, could be used in parasitic weed management strategies by interfering with the early growth stages of the parasites. These metabolites could inhibit seed germination or germ tube elongation, so preventing attachment to the host plant, or, conversely, stimulate seed germination in the absence of the host, contributing to a reduction in the parasite seed bank. Some of the fungal metabolites assayed were very active even at very low concentrations, such as some macrocyclic trichothecenes, which at 0.1 microM strongly suppressed the germination of Orobanche ramosa L. seeds. Interesting results were also obtained with some novel toxins, such as phyllostictine A, highly active in reducing germ tube elongation and seed germination both of O. ramosa and of Cuscuta campestris Yuncker. Among the amino acids tested, methionine and arginine were particularly interesting, as they were able to suppress seed germination at concentrations lower than 1 mM. Some of the fungal metabolites tested were also able to stimulate the germination of O. ramosa seeds. The major findings in this research field are described and discussed.
DNA barcoding for biosecurity: case studies from the UK plant protection program.
Hodgetts, Jennifer; Ostojá-Starzewski, Jozef C; Prior, Thomas; Lawson, Rebecca; Hall, Jayne; Boonham, Neil
2016-11-01
Since its conception, DNA barcoding has seen a rapid uptake within the research community. Nevertheless, as with many new scientific tools, progression towards the point of routine deployment within diagnostic laboratories has been slow. In this paper, we discuss the application of DNA barcoding in the Defra plant health diagnostic laboratories, where DNA barcoding is used primarily for the identification of invertebrate pests. We present a series of case studies that demonstrate the successful application of DNA barcoding but also reveal some potential limitations to expanded use. The regulated plant pest, Bursephalenchus xylophilus, and one of its vectors, Monochamus alternatus, were found in dining chairs. Some traded wood products are potentially high risk, allowing the movement of longhorn beetles; Trichoferus campestris, Leptura quadrifasciata, and Trichoferus holosericeus were found in a wooden cutlery tray, a railway sleeper, and a dining chair, respectively. An outbreak of Meloidogyne fallax was identified in Allium ampeloprasum and in three weed species. Reference sequences for UK native psyllids were generated to enable the development of rapid diagnostics to be used for monitoring following the release of Aphalara itadori as a biological control agent for Fallopia japonica.
Directory of Open Access Journals (Sweden)
Kopij Grzegorz
2015-03-01
Full Text Available In 2009, in the Special Protection Area Natura 2000 ‘Grądy Odrzańskie’ in Czernica and Siechnice counties, Wrocław district, 95 breeding bird species were recorded. For 33 of them, maps of distribution of their breeding pairs are presented and for the remaining a relative abundance was estimated based on line transect method. In 2009, the following species were recorded in the study area for the first time: Cygnus olor, Crex crex, Upupa epops, and Picus canus. On the other hand, 11 species recorded in 1978-87 as breeding in the study area (Ciconia nigra, Pernis apivorus, Milvus migrans, Milvus milvus, Falco tinnunculus, Gallinago gallinago, Limosa limosa, Tringa totanus, Riparia riparia, Anthus campestris, Phoenicurus phoenicurus were not recorded again in 2009. It has been shown that Saxicola torquata, Ficedula albicollis, Corvus corax and Remiz pendulinus have increased in numbers. The following species recorded in 2009 as breeding in the the study area: Cygnus olr, Ciconia ciconia, Circus aeruginosus, Crex crex, Alcedo atthis, Dryocopus martius, Picus canus, Dendrocopos medius, Lulula arborea, Sylvia nisoria, Ficedula albicollis, Lanius collurio and Emberiza hortulana are included in Annex 1 of the Bird Directive.
Structure of xanthan gum and cell ultrastructure at different times of alkali stress.
Luvielmo, Márcia de Mello; Borges, Caroline Dellinghausen; Toyama, Daniela de Oliveira; Vendruscolo, Claire Tondo; Scamparini, Adilma Regina Pippa
2016-01-01
The effect of alkali stress on the yield, viscosity, gum structure, and cell ultrastructure of xanthan gum was evaluated at the end of fermentation process of xanthan production by Xanthomonas campestris pv. manihotis 280-95. Although greater xanthan production was observed after a 24h-alkali stress process, a lower viscosity was observed when compared to the alkali stress-free gum, regardless of the alkali stress time. However, this outcome is not conclusive as further studies on gum purification are required to remove excess sodium, verify the efficiency loss and the consequent increase in the polymer viscosity. Alkali stress altered the structure of xanthan gum from a polygon-like shape to a star-like form. At the end of the fermentation, early structural changes in the bacterium were observed. After alkali stress, marked structural differences were observed in the cells. A more vacuolated cytoplasm and discontinuities in the membrane cells evidenced the cell lysis. Xanthan was observed in the form of concentric circles instead of agglomerates as observed prior to the alkali stress. Copyright © 2015 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
Hamza, A A; Robene-Soustrade, I; Jouen, E; Lefeuvre, P; Chiroleu, F; Fisher-Le Saux, M; Gagnevin, L; Pruvost, O
2012-05-01
MultiLocus Sequence Analysis (MLSA) and Amplified Fragment Length Polymorphism (AFLP) were used to measure the genetic relatedness of a comprehensive collection of xanthomonads pathogenic to solaneous hosts to Xanthomonas species. The MLSA scheme was based on partial sequences of four housekeeping genes (atpD, dnaK, efp and gyrB). Globally, MLSA data unambiguously identified strains causing bacterial spot of tomato and pepper at the species level and was consistent with AFLP data. Genetic distances derived from both techniques showed a close relatedness of (i) X. euvesicatoria, X. perforans and X. alfalfae and (ii) X. gardneri and X. cynarae. Maximum likelihood tree topologies derived from each gene portion and the concatenated data set for species in the X. campestris 16S rRNA core (i.e. the species cluster comprising all strains causing bacterial spot of tomato and pepper) were not congruent, consistent with the detection of several putative recombination events in our data sets by several recombination search algorithms. One recombinant region in atpD was identified in most strains of X. euvesicatoria including the type strain. Copyright © 2012 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Cha Jae-Soon
2010-07-01
Full Text Available Abstract Background Xanthomonas oryzae pv. oryzae (Xoo is the causal agent of rice bacterial blight disease. Xoo produces a range of virulence factors, including EPS, extracellular enzyme, iron-chelating siderophores, and type III-secretion dependent effectors, which are collectively essential for virulence. Genetic and genomics evidence suggest that Xoo might use the diffusible signal factor (DSF type quorum sensing (QS system to regulate the virulence factor production. However, little is known about the chemical structure of the DSF-like signal(s produced by Xoo and the factors influencing the signal production. Results Xoo genome harbours an rpf cluster comprising rpfB, rpfF, rpfC and rpfG. The proteins encoded by these genes are highly homologous to their counterparts in X. campestris pv. campestris (Xcc, suggesting that Xcc and Xoo might use similar mechanisms for DSF biosynthesis and autoregulation. Consistent with in silico analysis, the rpfF mutant was DSF-deficient and the rpfC mutant produced about 25 times higher DSF-like activity than the wild type Xoo strain KACC10331. From the supernatants of rpfC mutant, we purified three compounds showing strong DSF-like activity. Mass spectrometry and NMR analysis revealed that two of them were the previously characterized DSF and BDSF; the third one was a novel unsaturated fatty acid with 2 double bonds and was designated as CDSF in this study. Further analysis showed that all the three DSF-family signals were synthesized via the enzyme RpfF encoded by Xoo2868. DSF and BDSF at a final concentration of 3 μM to the rpfF mutant could fully restore its extracellular xylanase activity and EPS production to the wild type level, but CDSF was less active than DSF and BDSF in induction of EPS and xylanase. DSF and CDSF shared a similar cell density-dependent production time course with the maximum production being detected at 42 h after inoculation, whereas the maximum production of BDSF was observed
Directory of Open Access Journals (Sweden)
M.H.T. Mascarenhas
1980-12-01
Full Text Available Em um solo aluvião eutrófico de classificação textural argilo siltoso, com 2,75% de M.O. foram estudados os efeitos de doses do herbicida bentazon (3 - isopropi l - 2,1,3 - benzotio-diazinona - (4 - 2,2 - dióxido aplicado em pós-emergência. no controle de plantas daninhas dicotiledôneas na cultura da cebola. O delineamento experimental adotado foi um fatorial 2 x 5 x 2 + 4. constituído por duas cultivares: 'Baia Pe ri forme' e 'Texas Grano': cinco épocas de aplicação do produto: aos 10, 20, 30, 40 e 50 dias após a emergência das plantas daninhas: duas doses de bentazon: 0,46kg. i.a./ha e 0,96 kg. i.a./ha e quatro tratamentos adicionais: 'Baia Periforme' capinada e sem capina e 'Texas Grano'. capinada e sem capina. . As plantas daninhas predominantes no experimento foram: botão -de-ouro (Galinsoga parviflora Cav., picão-preto (Bidens pilosa L., amendoim-bravo (Euphorbia prunifoiia Jacq.(, mostarda (Brassica campestris L., joá (Physalis angulata L. fedegoso (Cassia tora L.(, serralha falsa (Emilia sonchifolia (L . DC e mentruz (Lepidium virginicum L. Nas condições em que foi realizado o ensaio, o herbicida bentazon nas duas doses aplicadas mostrou-se eficiente no controle das plantas daninhas até 60 dias após o transplante. Nas doses empregadas o bentazon não apresentou efeito fitotóxico sobre a produção das cultivares 'Baia Periforme' e 'Texas Grano'.The effects of doses of the herbicide bentazon applied at post-emergence in the control of dycotiledonous weeds in onion crops were studied on a alluvial eutrophic soil with a clay silt texture. and 2.75%% of organic matter. The experiment was set according to a complete randomized design in a factorial arrangement of 2 x 5 x 2- 4 (two onion varieties: 'Bala Periforme' and 'Texas Grano': five herbicide application dates: 10. 20. 30, 40 and 50 days after emergence of the weeds: bentazon doses were 0,46g a.i./ha and 0.96 g a.i./ha: and four more tre atments: 'Baia Periforme
Directory of Open Access Journals (Sweden)
Rogério Luis Cansian
2010-06-01
Full Text Available Este trabalho teve como objetivo determinar a atividade antimicrobiana e antioxidante do óleo essencial de Ho-Sho. O principal componente do óleo essencial obtido a partir de folhas da planta submetidas ao processo de hidrodestilação foi o linalol (80 a 95% m/m. O óleo essencial mostrou atividade antimicrobiana para todos os microrganismos testados, com exceção de Pseudomonas aeruginosa. A maior atividade antimicrobiana do óleo essencial sobre as bactérias testadas foi observada sobre Xanthomonas campestris (33,0 mm e a menor sobre Yersinia enterocolitica (10,5 mm. Para a concentração inibitória mínima (CIM, observou-se que todos os microrganismos apresentaram-se susceptíveis ao óleo essencial de Ho-Sho. A variação das CIM para as bactérias Gram-positivas foi de 1,00 mg.mL-1 (Streptococcus mutans a 1,75 mg.mL-1 (Staphylococcus epidermidis. Já a variação das CIM para as bactérias Gram-negativas foi de 0,625 mg.mL-1 (Citrobacter freundii a 2,50 mg.mL-1 (Shigella flexneri. Os resultados obtidos na determinação da atividade antioxidante do óleo essencial demonstram que o percentual antioxidante aumenta proporcionalmente à concentração de óleo essencial adicionado, atingindo o valor máximo de 97,49% de atividade antioxidante para a concentração de 50000 μg.mL-1.The main objective of this work was to evaluate the antimicrobial and antioxidant activities of the Ho-Sho essential oil. The major component of the essential oil obtained from the leaves submitted to hydro-distillation was linalool (80-95 wt%. The essential oil showed antimicrobial activity for all tested microorganisms, except for Pseudomonas aeruginosa. Higher antimicrobial activities over the tested bacterium were observed for Xanthomonas campestris (33.0 mm, and lower activities were obtained for Yersinia enterocolitica (10.5 mm. For the minimal inhibition concentration (MIC, it was observed that all microorganisms presented susceptibility to the Ho
Fonseca, Renata G; Barros, Francisco M; Apel, Miriam A; Poser, Gilsane L von; Andriolli, Jo O L; Filho, Pedro C Campos; Sousa, Dhierlate F; Lobo, Ivon P; Conceiç O, Aline O
2015-01-01
2 was active against Eschirichia coli. Phytopatogens tested revealed resistance of Ralstonia solanacearum CGH12 to all samples and susceptibility of Xcv 112 strain of Xanthomonas campestris pv campestris to almost all samples. MIC and MMC showed bacteriostatic effect against clinical interest bacteria and bactericidal effect against phytopatogens. The results from physicochemical analysis reinforce the fact that it is imperative to include simple conventional methods in the analysis of oil products. The analysis of copaiba oil gives safe products and purity which ensure products with quality. Also, since copaiba oil is an over-the-counter product the results indicate that pharmacosurveillance must be improved by the governmental regulation agency to avoid microorganism resistance selection and to achieve better international quality products.
Ciarroni, Serena; Gallipoli, Lorenzo; Taratufolo, Maria C.; Butler, Margi I.; Poulter, Russell T. M.; Pourcel, Christine; Vergnaud, Gilles; Balestra, Giorgio M.; Mazzaglia, Angelo
2015-01-01
The bacterial canker of kiwifruit by Pseudomonas syringae pv. actinidiae is an emblematic example of a catastrophic disease of fruit crops. In 2008 a new, extremely virulent form of the pathogen emerged and rapidly devastated many Actinidia spp. orchards all over the world. In order to understand differences in populations within this pathovar and to elucidate their diffusion and movements on world scale, it is necessary to be able to quickly and on a routine basis compare new isolates with previous records. In this report a worldwide collection of 142 strains was analyzed by MLVA, chosen as investigative technique for its efficacy, reproducibility, simplicity and low cost. A panel of 13 Variable Number of Tandem Repeats (VNTR) loci was identified and used to describe the pathogen population. The MLVA clustering is highly congruent with the population structure as previously established by other molecular approaches including whole genome sequencing and correlates with geographic origin, time of isolation and virulence. For convenience, we divided the VNTR loci in two panels. Panel 1 assay, using six loci, recognizes 23 different haplotypes, clustered into ten complexes with highest congruence with previous classifications. Panel 2, with seven VNTR loci, provides discriminatory power. Using the total set of 13 VNTR loci, 58 haplotypes can be distinguished. The recent hypervirulent type shows very limited diversity and includes, beside the strains from Europe, New Zealand and Chile, a few strains from Shaanxi, China. A broad genetic variability is observed in China, but different types are also retrievable in Japan and Korea. The low virulent strains cluster together and are very different from the other MLVA genotypes. Data were used to generate a public database in MLVAbank. MLVA represents a very promising first-line assay for large-scale routine genotyping, prior to whole genome sequencing of only the most relevant samples. PMID:26262683
Sor-suwan, Sriwatapron; Jariyapan, Narissara; Roytrakul, Sittiruk; Paemanee, Atchara; Phumee, Atchara; Phattanawiboon, Benjarat; Intakhan, Nuchpicha; Chanmol, Wetpisit; Bates, Paul A.; Saeung, Atiporn; Choochote, Wej
2014-01-01
Malaria sporozoites must invade the salivary glands of mosquitoes for maturation before transmission to vertebrate hosts. The duration of the sporogonic cycle within the mosquitoes ranges from 10 to 21 days depending on the parasite species and temperature. During blood feeding salivary gland proteins are injected into the vertebrate host, along with malaria sporozoites in the case of an infected mosquito. To identify salivary gland proteins depleted after blood feeding of female Anopheles ca...
Directory of Open Access Journals (Sweden)
Sarić-Krsmanović Marija
2016-01-01
Full Text Available The effects of field dodder on physiological processes and the anatomy of alfalfa plants were examined under controlled conditions. The experiment included the following variants: N - noninfested alfalfa plants (control; I - infested alfalfa plants (untreated; T - infested plants treated with imazethapyr. Imazethapyr application rate was 100 g a.i. ha-1. The following parameters were checked: physiological - pigment content (chlorophyll ɑ, chlorophyll b, total carotenoids; anatomical - stem parameters: thickness of epidermis and cortex, and diameter of stem and central cylinder; leaf parameters: thickness of epidermis, parenchyma and spongy tissue, mesophyll and underside leaf epidermis, and diameter of bundle sheath cells in alfalfa plants. Pigment contents and anatomical parameters were measured: prior to herbicide treatment (0 assessment, then 7 (I assessment, 14 (II assessment, 21 (III assessment, 28 (IV assessment and 35 (V assessment days after application (DAA. Field dodder was found to affect the contents of chlorophyll ɑ, chlorophyll ɑ and carotenoids in untreated alfalfa plants, causing significant reductions in pigment content. Conversely, percent reduction in the treated plants decreased 22-5% for chlorophyll ɑ, 25-1%, for chlorophyll b, and 21-11% for carotenoids, while a stimulating effect of 1-6% was observed for the contents of chlorophyll b and carotenoids 35 DAA. Plants infested (untreated by field dodder had lower values of most anatomical parameters, compared to noninfested plants. The measured anatomical parameters of alfalfa stems and leaves had significantly higher values in noninfested plants and plants treated with imazethapyr than in untreated plants.
Directory of Open Access Journals (Sweden)
Yannick Durbec
2012-07-01
Full Text Available L’édition du papyrus P. Mil. Vogl. VIII 309 par Guido Bastianini et Claudio Gallazzi fut pour les spécialistes de l’Antiquité un événement majeur. Les centaines de publications qui s’ensuivirent ont ouvert de multiples pistes de réflexion, préparant la voie pour des travaux de synthèse. Le présent ouvrage de Margherita Maria Di Nino, qui est le fruit de la réélaboration de sa thèse soutenue à l’université de Bologne, est plus que cela. En effet, ce volume o...
Perronne, Rémi; Gibot-Leclerc, Stéphanie; Dessaint, Fabrice; Reibel, Carole; Le Corre, Valérie
2017-12-01
Phelipanche ramosa is a major root-holoparasitic damaging weed characterized by a broad host range, including numerous Fabaceae species. In France, the agricultural threat posed by P. ramosa has increased over two decades due to the appearance of a genetically differentiated pathovar presenting a clear host specificity for oilseed rape. The new pathovar has led to a massive expansion of P. ramosa in oilseed rape fields. The germination rate of P. ramosa seeds is currently known to vary among P. ramosa pathovars and host species. However, only a few studies have investigated whether phylogenetic relatedness among potential host species is a predictor of the ability of these species to induce the seed germination of parasitic weeds by testing for phylogenetic signal. We focused on a set of 12 Fabaceae species and we assessed the rate of induction of seed germination by these species for two pathovars based on in vitro co-cultivation experiments. All Fabaceae species tested induced the germination of P. ramosa seeds. The germination rate of P. ramosa seeds varied between Fabaceae species and tribes studied, while pathovars appeared non-influential. Considering oilseed rape as a reference species, we also highlighted a significant phylogenetic signal. Phylogenetically related species therefore showed more similar rates of induction of seed germination than species drawn at random from a phylogenetic tree. In in vitro conditions, only Lotus corniculatus induced a significantly higher germination rate than oilseed rape, and could potentially be used as a catch crop after confirmation of these results under field conditions.
Weselowski, Brian; Nathoo, Naeem; Eastman, Alexander William; MacDonald, Jacqueline; Yuan, Ze-Chun
2016-10-18
Paenibacillus polymyxa is a plant-growth promoting rhizobacterium that could be exploited as an environmentally friendlier alternative to chemical fertilizers and pesticides. Various strains have been isolated that can benefit agriculture through antimicrobial activity, nitrogen fixation, phosphate solubilization, plant hormone production, or lignocellulose degradation. However, no single strain has yet been identified in which all of these advantageous traits have been confirmed. P. polymyxa CR1 was isolated from degrading corn roots from southern Ontario, Canada. It was shown to possess in vitro antagonistic activities against the common plant pathogens Phytophthora sojae P6497 (oomycete), Rhizoctonia solani 1809 (basidiomycete fungus), Cylindrocarpon destructans 2062 (ascomycete fungus), Pseudomonas syringae DC3000 (bacterium), and Xanthomonas campestris 93-1 (bacterium), as well as Bacillus cereus (bacterium), an agent of food-borne illness. P. polymyxa CR1 enhanced growth of maize, potato, cucumber, Arabidopsis, and tomato plants; utilized atmospheric nitrogen and insoluble phosphorus; produced the phytohormone indole-3-acetic acid (IAA); and degraded and utilized the major components of lignocellulose (lignin, cellulose, and hemicellulose). P. polymyxa CR1 has multiple beneficial traits that are relevant to sustainable agriculture and the bio-economy. This strain could be developed for field application in order to control pathogens, promote plant growth, and degrade crop residues after harvest.
Directory of Open Access Journals (Sweden)
Alice Jiruskova
2016-08-01
Full Text Available We identified a high diversity in the net-winged beetles of the genus Cautires in Peninsular Malaysia. Fourteen new species are described: Cautires alexae sp. nov., C. andujari sp. nov., C. arribasae sp. nov., C. berembanensis sp. nov., C. campestris sp. nov., C. communis sp. nov., C. jasarensis sp. nov., C. katarinae sp. nov., C. kirstenae sp. nov., C. kotatinggensis sp. nov., C. linardi sp. nov., C. maseki sp. nov., C. pahangensis sp. nov. and C. renatae sp. nov. Seven previously described species are discussed, illustrated and differential diagnoses provided; all species are keyed. The Cautires species differ in a limited number of diagnostic characters, namely in the shape of male antennae, the relative size of eyes and in the shape of the male genitalia. The females are difficult to assign to a conspecific male due to high intraspecific variability. The characteristically low dispersal propensity of net-winged beetles lead to the evolution of the unique fauna in the Malay mountains and despite an extensive study of the type material we recorded only a single species of Cautires occurring simultaneously in Sumatra. We suggest that the Malay mountain fauna is highly endemic and evolved in situ.
Directory of Open Access Journals (Sweden)
Saadia R. Tariq
2016-11-01
Full Text Available The phytoremediation potential of Helianthus annuus, Zea maize, Brassica campestris and Pisum sativum was studied for the soil of firing range contaminated with selected metals i.e. Cd, Cu, Co, Ni, Cr and Pb. The seedlings of the selected plants germinated in a mixture of sand and alluvial soil were transferred to the pots containing the soil of firing ranges and allowed to grow to the stage of reproductive growth. Subsequently they were harvested and then analyzed for selected metals by using AAS. Among the studied plants, P. sativum exhibited highest removal efficiency (i.e. 96.23% and bioconcentration factor for Pb thereby evidencing it to be Pb hyperaccumulator from the soil of firing ranges. Z. maize appreciably reduced the levels of all the selected metals in the soil but the highest phytoextraction capacity was shown for Pb i.e. 66.36%, which was enhanced to approximately 74% on EDTA application. H. annuus represented the highest removal potential for Cd i.e. 56.03% which was further increased on EDTA application. Thus it proved to be an accumulator of Cd after EDTA application. It was therefore concluded that different plants possess different phytoremediation potentials under given set of conditions.
El Euch, Salma Kammoun; Cieśla, Łukasz; Bouzouita, Nabiha
2014-01-01
Aqueous-methanol extracts prepared from 10 Tunisian plant species were analyzed for the presence of potent direct antioxidants. The analyzed species included: Anacyclus clavatus Desf., Erica multiflora L., Cistus salvifolius L., Centaurium erythraea Rafn., Marrubium vulgare L., Lavandula stoechas L., Artemisia campestris L., Origanum majorana L., Salvia officinalis L., and Pistacia lentiscus L. All the extracts were chromatographed on the RP18 W plates with methanol-water-acetic acid (48 + 47 + 5, v/v/v) mobile phase. Upon completion of the chromatographic development and the drying step, the plates were stained with a chloroform solution of 2, 2-diphenyl-1-picrylhydrazyl radical (DPPH(•)). An image processing protocol, with use of Sorbfil TLC Videodensitometer, was applied to quantitatively measure the activity of polyphenols and to screen complex samples for the presence of free radical scavengers. The activity of the individual compounds was compared with that of rutin, used as a standard. The TLC-DPPH(•) test showed that C. salvifolius had the most potent antioxidant activity, as it possessed the highest activity coefficient (calculated as the sum of the areas under the peaks of all active compounds/area under peak of rutin). The proposed procedure may be used to differentiate potent chain-breaking antioxidants and compounds propagating radical chain reactions.
Kim, Min-Suk; Min, Hyun-Gi; Koo, Namin; Park, Jeongsik; Lee, Sang-Hwan; Bak, Gwan-In; Kim, Jeong-Gyu
2014-12-15
Spent coffee grounds (SCG) and charred spent coffee grounds (SCG-char) have been widely used to adsorb or to amend heavy metals that contaminate water or soil and their success is usually assessed by chemical analysis. In this work, the effects of SCG and SCG-char on metal-contaminated water and soil were evaluated using chemical and biological assessments; a phytotoxicity test using bok choy (Brassica campestris L. ssp. chinensis Jusl.) was conducted for the biological assessment. When SCG and SCG-char were applied to acid mine drainage, the heavy metal concentrations were decreased and the pH was increased. However, for SCG, the phytotoxicity increased because a massive amount of dissolved organic carbon was released from SCG. In contrast, SCG-char did not exhibit this phenomenon because any easily released organic matter was removed during pyrolysis. While the bioavailable heavy metal content decreased in soils treated with SCG or SCG-char, the phytotoxicity only rose after SCG treatment. According to our statistical methodology, bioavailable Pb, Cu and As, as well as the electrical conductivity representing an increase in organic content, affected the phytotoxicity of soil. Therefore, applying SCG during environment remediation requires careful biological assessments and evaluations of the efficiency of this remediation technology. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Chang-Gi Back
2015-09-01
Full Text Available In this study, we developed a species-specific PCR assay for rapid and accurate detection of three Xanthomonas species, X. axonopodis pv. poinsettiicola (XAP, X. hyacinthi (XH and X. campestris pv. zantedeschiae (XCZ, based on their draft genome sequences. XAP, XH and XCZ genomes consist of single chromosomes that contain 5,221, 4,395 and 7,986 protein coding genes, respectively. Species-specific primers were designed from variable regions of the draft genome sequence data and assessed by a PCR-based detection method. These primers were also tested for specificity against 17 allied Xanthomonas species as well as against the host DNA and the microbial community of the host surface. Three primer sets were found to be very specific and no amplification product was obtained with the host DNA and the microbial community of the host surface. In addition, a detection limit of 1 pg/μl per PCR reaction was detected when these primer sets were used to amplify corresponding bacterial DNAs. Therefore, these primer sets and the developed species-specific PCR assay represent a valuable, sensitive, and rapid diagnostic tool that can be used to detect three specific pathogens at early stages of infection and may help control diseases.
Huang, Jin; Lin, Yuheng; Yuan, Qipeng; Yan, Yajun
2015-04-01
Tyrosine is a proteinogenic aromatic amino acid that is often used as a supplement of food and animal feed, as well as a (bio-)synthetic precursor to various pharmaceutically or industrially important molecules. Extensive metabolic engineering efforts have been made towards the efficient and cost-effective microbial production of tyrosine. Conventional strategies usually focus on eliminating intrinsic feedback inhibition and redirecting carbon flux into the shikimate pathway. In this study, we found that continuous conversion of phenylalanine into tyrosine by the action of tetrahydromonapterin (MH4)-utilizing phenylalanine 4-hydroxylase (P4H) can bypass the feedback inhibition in Escherichia coli, leading to tyrosine accumulation in the cultures. First, expression of the P4H from Xanthomonas campestris in combination with an MH4 recycling system in wild-type E. coli allowed the strain to accumulate tyrosine at 262 mg/L. On this basis, enhanced expression of the key enzymes associated with the shikimate pathway and the MH4 biosynthetic pathway resulted in the elevation of tyrosine production up to 401 mg/L in shake flasks. This work demonstrated a novel approach to tyrosine production and verified the possibility to alleviate feedback inhibition by creating a phenylalanine sink.
Geographical influences on content of 10-hydroxy-trans-2-decenoic acid in royal jelly in China.
Wei, Wen-Ting; Hu, Yuan-Qiang; Zheng, Huo-Qing; Cao, Lian-Fei; Hu, Fu-Liang; Hepburn, H Randall
2013-10-01
The content of 10-hydroxy-trans-2-decenoic acid (10-HDA), a marker compound in royal jelly (RJ), is the most important criterion in grading RJ for commercial trade and varies with its origin. To identify the effect of geographical origin on 10-HDA content in RJ, 138 samples were collected from 19 provinces of China (divided into three groups) produced by either Apis mellifera ligustica Spinola, 1806 or a hybrid of A. m. ligustica and Apis mellifera carnica Pollman, 1879 and analyzed for moisture, sugar, crude protein, ash, acid, and 10-HDA concentration. The results show that RJ from western China has a significantly higher 10-HDA level (2.01 +/- 0.05%) than those from northeastern (1.87 +/- 0.05%) and eastern (1.75 +/- 0.03%) China. RJ secreted by hybrid bees contained more 10-HDA (1.89 +/- 0.03%) than that secreted by A. m. ligustica (1.78 +/- 0.03%). The 10-HDA content of RJ produced during flowering of rape (Brassica campestris L.), lime (Tilia amurensis Ruprecht), and vitex (Vitex negundo L. variety heterophylla (Franch.) Rehder) was 1.92, 1.80, and 1.68%, respectively. The results would be helpful during the process of price determination of RJ by providing some basis of geographical, bee strain, and botanical information for commercial trade.
Energy Technology Data Exchange (ETDEWEB)
Kim, J. S.; Baek, M. H.; Lee, Y. G. [KAERI, Taejon (Korea, Republic of); Jung, K. H. [Kyunghee Univ., Yongin (Korea, Republic of)
2000-10-01
To determine the effect of low dose gamma-ray radiation on the germination rate and physiology of germinative seeds of Chinese cabbage(Brassica campestris L. cv. Hanyoreum) and radish(Raphanus sativus L. cv. Chungsukoungzoung). The germination rate of irradiation group was higher than that of the control. Especially it was highest at the early stage of induction. The germination rate of Chinese cabbage increased at 4 Gy-, 10 Gy- and 50 Gy irradiation group and that of radish increased at 2 Gy-, 6 Gy- and 10 Gy irradiation group. The seedling height of Chinese cabbage and radish increased positively in low dose irradiation group. The seedling height of Chinese cabbage was noticeably higher at 4 Gy and 10 Gy irradiation group and that of radish at 6 Gy irradiation group. The protein contents of seeds irradiated with low dose gamma-ray radiation was increased compared to that of the control especially at the early stage of induction. The enzyme activity of seeds irradiated with low dose of gamma-ray radiation was increased at 4 Gy and 10 Gy irradiation group. These results suggest that the germination and physiological activity of old seeds could be stimulated promisingly by the low dose gamma-ray radiation.
Directory of Open Access Journals (Sweden)
Takeshi Kawanishi
Full Text Available Culturing is an indispensable technique in microbiological research, and culturing with selective media has played a crucial role in the detection of pathogenic microorganisms and the isolation of commercially useful microorganisms from environmental samples. Although numerous selective media have been developed in empirical studies, unintended microorganisms often grow on such media probably due to the enormous numbers of microorganisms in the environment. Here, we present a novel strategy for designing highly selective media based on two selective agents, a carbon source and antimicrobials. We named our strategy SMART for highly Selective Medium-design Algorithm Restricted by Two constraints. To test whether the SMART method is applicable to a wide range of microorganisms, we developed selective media for Burkholderia glumae, Acidovorax avenae, Pectobacterium carotovorum, Ralstonia solanacearum, and Xanthomonas campestris. The series of media developed by SMART specifically allowed growth of the targeted bacteria. Because these selective media exhibited high specificity for growth of the target bacteria compared to established selective media, we applied three notable detection technologies: paper-based, flow cytometry-based, and color change-based detection systems for target bacteria species. SMART facilitates not only the development of novel techniques for detecting specific bacteria, but also our understanding of the ecology and epidemiology of the targeted bacteria.
Hazen, Tracy H; Michalski, Jane; Luo, Qingwei; Shetty, Amol C; Daugherty, Sean C; Fleckenstein, James M; Rasko, David A
2017-06-14
Escherichia coli that are capable of causing human disease are often classified into pathogenic variants (pathovars) based on their virulence gene content. However, disease-associated hybrid E. coli, containing unique combinations of multiple canonical virulence factors have also been described. Such was the case of the E. coli O104:H4 outbreak in 2011, which caused significant morbidity and mortality. Among the pathovars of diarrheagenic E. coli that cause significant human disease are the enteropathogenic E. coli (EPEC) and enterotoxigenic E. coli (ETEC). In the current study we use comparative genomics, transcriptomics, and functional studies to characterize isolates that contain virulence factors of both EPEC and ETEC. Based on phylogenomic analysis, these hybrid isolates are more genomically-related to EPEC, but appear to have acquired ETEC virulence genes. Global transcriptional analysis using RNA sequencing, demonstrated that the EPEC and ETEC virulence genes of these hybrid isolates were differentially-expressed under virulence-inducing laboratory conditions, similar to reference isolates. Immunoblot assays further verified that the virulence gene products were produced and that the T3SS effector EspB of EPEC, and heat-labile toxin of ETEC were secreted. These findings document the existence and virulence potential of an E. coli pathovar hybrid that blurs the distinction between E. coli pathovars.
Directory of Open Access Journals (Sweden)
Sarah Green
Full Text Available A recently emerging bleeding canker disease, caused by Pseudomonas syringae pathovar aesculi (Pae, is threatening European horse chestnut in northwest Europe. Very little is known about the origin and biology of this new disease. We used the nucleotide sequences of seven commonly used marker genes to investigate the phylogeny of three strains isolated recently from bleeding stem cankers on European horse chestnut in Britain (E-Pae. On the basis of these sequences alone, the E-Pae strains were identical to the Pae type-strain (I-Pae, isolated from leaf spots on Indian horse chestnut in India in 1969. The phylogenetic analyses also showed that Pae belongs to a distinct clade of P. syringae pathovars adapted to woody hosts. We generated genome-wide Illumina sequence data from the three E-Pae strains and one strain of I-Pae. Comparative genomic analyses revealed pathovar-specific genomic regions in Pae potentially implicated in virulence on a tree host, including genes for the catabolism of plant-derived aromatic compounds and enterobactin synthesis. Several gene clusters displayed intra-pathovar variation, including those encoding type IV secretion, a novel fatty acid biosynthesis pathway and a sucrose uptake pathway. Rates of single nucleotide polymorphisms in the four Pae genomes indicate that the three E-Pae strains diverged from each other much more recently than they diverged from I-Pae. The very low genetic diversity among the three geographically distinct E-Pae strains suggests that they originate from a single, recent introduction into Britain, thus highlighting the serious environmental risks posed by the spread of an exotic plant pathogenic bacterium to a new geographic location. The genomic regions in Pae that are absent from other P. syringae pathovars that infect herbaceous hosts may represent candidate genetic adaptations to infection of the woody parts of the tree.
Directory of Open Access Journals (Sweden)
Grasielle Soares Gusman
2011-10-01
Full Text Available Allelopathy is characterized by the harmful or benefic effects caused by secondary metabolites, that are produced by plants, microorganisms or fungi and are released in the environment, on the development of natural biological systems or implemented ones. This study aimed to evaluate the allelopathic effects of aqueous extracts of eucalypt (Eucalyptus globulus Labill. and wild coffee (Casearia sylvestris Sw. on the germination and initial development of mustard (Brassica campestris L., cabbage (Brassica oleracea L. cv. capitata, broccoli (Brassica oleracea L. cv. italica, kale (Brassica pekinensis L., lettuce (Lactuca sativa L. cv. grand rapids, tomato (Lycopersicum esculentum Miller, turnip (Brassica rapa L., rucola (Eruca sativa L. and radish (Raphanus sativus L.. Six concentrations of each aqueous extract were tested (10, 30, 50, 70, 90 and 100% and compared to control (distilled water, with five replicates of each concentration, being ten seeds of each crop distributed in each replicate. The aqueous extracts of E. globulus and C. sylvestris reduced significantly the percentage of seed germination, the index of germination speed and the initial growth of the above ground part and roots of all cultivated species, being the reduction of these parameters higher with the increment of the aqueous extracts concentration, which led to thicker and atrophied roots with a higher number of absorbent hairs. Therefore, the results indicate an existence of allelopathic potential of E. globulus and C. sylvestris.A alelopatia caracteriza-se pelos efeitos danosos ou benéficos que metabólitos secundários produzidos por plantas, microrganismos ou fungos liberados no ambiente exercem sobre o desenvolvimento de sistemas biológicos naturais ou implantados. O objetivo do trabalho foi avaliar o efeito alelopático de extratos aquosos de eucalipto (Eucalyptus globulus Labill. e guaçatonga (Casearia sylvestris Sw. na germinação e no crescimento inicial de
Haque, Md Azizul; Yun, Han Dae; Cho, Kye Man
2016-05-01
The study aimed to reveal the diversity of endophytic bacteria in the roots of Chinese cabbage (CC) cultivated in two areas in Korea, namely, Seosang-gun (SS) and Haenam-gun (HN), and also in a transgenic plant (TP) from the laboratory. A total of 653 colonies were isolated from the interior of CC roots, comprising 118, 302, and 233 isolates from SS, HN, and TP samples, respectively. Based on 16S rRNA gene sequence analysis, the isolates belonged to four major phylogenetic groups: high-G+C Gram-positive bacteria (HGC-GPB), low-G+C Gram-positive bacteria (LGC-GPB), Proteobacteria, and Bacteriodetes. The most dominant groups in the roots of the SS, HN, and TP cultivars were LGC-GPB (48.3%), Proteobacteria (50.2%), and HGC-GPB (38.2%), respectively. Importantly, most of the isolates that produced cell-walldegrading enzymes belonged to the genus Bacillus. Bacillus sp. (HNR03, TPR06), Bacillus pumilus (SSR07, HNR11, TPR07), and Bacillus subtilis (TPR03) showed high antagonism against the tested food-borne pathogenic bacteria. In addition, Bacillus sp. (HNR03, TPR06), Bacillus pumilus (SSR07, HNR11, HNR17, TPR11), Microbacterium oxidans (SSR09, TPR04), Bacillus cereus HNR10, Pseudomonas sp. HNR13, and Bacillus subtilis (TPR02, TPR03) showed strong antagonistic activity against the fungi Phythium ultimum, Phytophthora capsici, Fusarium oxysporum, and Rhizoctonia solani. The endophytes isolated from the TP cultivar showed the strongest antagonistic reactions against pathogens. This study is the first report on endophytic bacteria from Chinese cabbage roots.
Huang, Bin; Shi, Zhanghong; Hou, Youming
2014-01-01
Abstract Insect herbivores often have higher densities on host plants grown in monocultures than those in diverse environments. The underlying mechanisms are thought to be that polyphagous insects have difficulty in selecting food or oviposition sites when multiple host plants exist. However, this hypothesis needs to be extensively investigated. Our field experiments revealed that the population of the diamondback moths, Plutella xylostella (L.) (Lepidoptera: Plutellidae), significantly decreased in a mixed cropping field compared with a monoculture. To determine the reasons for the reduction in population in the mixed cropping field, the takeoff behavior and fecundity of females in no-choice and free-choice laboratory environments were compared by video recordings of host selection by P. xylostella . Adults displayed a significantly higher takeoff frequency in free-choice environments than those in no-choice treatments and preferred landing on Brassica campestris (L.) or Brassica juncea (Coss) plants in contrast with Brassica oleracea (L.). Female adults in the free-choice environment also laid fewer eggs compared with the monoculture. Olfaction experiments demonstrated orientation by P. xylostella to host volatiles when presented with a choice between plant odors and clean air, but females showed no preference when odors from three Brassicaceae species were presented simultaneously. We conclude that mixed cropping alters the host-finding behavior of P. xylostella resulting in reduced oviposition. PMID:25527573
Directory of Open Access Journals (Sweden)
Alexis Lamz Piedra
2017-10-01
Full Text Available Among the main factors affecting bean production is poor distribution of varieties for different environmental conditions in which its are grown. The aim of this work was to evaluate the impact of participatory selection of foreign genetic materials and national commercial and pre-commercial common bean in identifying genotypes for their outstanding performance and resistance to common bacteriosis (Xanthomonas campestris pv. phaseoli (Smith Dye (Xcp. In the "El Mulato" farm belonging to the Empowered Cooperative of Credit and Services (CCSF "Orlando Cuellar" in the municipality San José de las Lajas, Mayabeque, two experiments were conducted. In the first one, 15 genotypes were planted in 13 September 2014 (early season in experimental plots to develop a diversity Fair and evaluate the natural incidence of common bean bacteriosis. In the second experiment, they were sown on 25 December (late season the materials selected by farmers with superior agronomic performance (7 genotypes to validate the stability of its performance. Among the results, an effective range of 93,33 % between the selected materials and selective criteria that this diversity was identified were high performance, resistance to common bacteriosis and color of beans. It was found that the selection of the diversity of beans by farmers is not influenced by the origin of materials and participatory selection identified common bean genotypes with high yield potential and stability between planting seasons.
International Nuclear Information System (INIS)
Sackschewsky, M.R.
1992-04-01
Environmental characterization in support of hazardous, radioactive, and mixed waste cleanup (in accordance with the Comprehensive Environmental Response, Compensation, and Liability Act of 1980) can involve a large number of both nonintrusive and intrusive activities. Many of these activities could have a detrimental impact on listed plant species. These impacts can be minimized by following simple conservation policies while conducting the various field activities. For instance, frequent off-road vehicular traffic and have a severe impact on native habitats and, therefore, should be kept to a minimum. Personnel performing the field activities should be trained to preserve, respect, and minimize their impact on native habitat while performing work in the field. In addition, areas where sampling is planned should be surveyed for the presence of listed plant species before the initiation of the field activities. Extremely distributed areas could be exempted from this requirement provided adequate habitat assessments have been performed by qualified personnel. Twelve special status plant species are known to survive on or very near the Hanford Site. None of these species currently are listed as Federal Threatened or Endangered Species. However, four local species currently are candidates for federal protection. These species are the Northern Wormwood (Artemisia campestris ssp. borealis var. wormskioldii), Persistantsepal Yellowcress (Rorippa columbiae), Hoover's Desert Parsley (Lomatium tuberosum), and Columbia Milkvetch (Astragalus columbianus)
Crop candidates for the bioregenerative life support systems in China
Chunxiao, Xu; Hong, Liu
The use of plants for life support applications in space is appealing because of the multiple life support functions by the plants. Research on crops that were grown in the life support system to provide food and oxygen, remove carbon dioxide was begun from 1960. To select possible crops for research on the bioregenerative life support systems in China, criteria for the selection of potential crops were made, and selection of crops was carried out based on these criteria. The results showed that 14 crops including 4 food crops (wheat, rice, soybean and peanut) and 7 vegetables (Chinese cabbage, lettuce, radish, carrot, tomato, squash and pepper) won higher scores. Wheat ( Triticum aestivum L.), rice ( Oryza sativa L.), soybean ( Glycine max L.) and peanut ( Arachis hypogaea L.) are main food crops in China. Chinese cabbage ( Brassica campestris L. ssp. chinensis var. communis), lettuce ( Lactuca sativa L. var. longifolia Lam.), radish ( Raphanus sativus L.), carrot ( Daucus carota L. var. sativa DC.), tomato ( Lycopersicon escalentum L.), squash ( Cucurbita moschata Duch.) and pepper ( Capsicum frutescens L. var. longum Bailey) are 7 vegetables preferred by Chinese. Furthermore, coriander ( Coriandum sativum L.), welsh onion ( Allium fistulosum L. var. giganteum Makino) and garlic ( Allium sativum L.) were selected as condiments to improve the taste of space crew. To each crop species, several cultivars were selected for further research according to their agronomic characteristics.
Do Tillage Methods Affect Germination and Species Similarity of Soil Weed Seeds Bank?
Directory of Open Access Journals (Sweden)
Shahgholi Hassan
2015-12-01
Full Text Available Cultural practices such as tillage used for crop production influence the composition of the weed seed bank in the soil. In order to investigate the effects of different tillage methods on seed bank properties, species diversity and similarity, two laboratory and greenhouse experiments were carried out as randomized complete block design with four replications in 2011. Treatments included: once tillage per year (T1, twice tillage per year (T2, more than twice tillage (T3 and no tillage (T4. Laboratory results showed that the T3 and T4 treatments had the highest and the lowest observed seeds numbers, respectively. Between the laboratory observed weed seeds, the maximum weed seed numbers were Echinochloa crus-galli and Amaranthus retroflexus in the T3 treatment, while Chenopodium album, Polygonum aviculare and Cuscuta campestris had the highest seed numbers in the T2 treatment. At the greenhouse study, Chenopodium album, Amaranthus retroflexus and Hordeum morinum in the T2 treatment were dominant species. The highest diversity was observed in the T2 treatment, and Chenopodium album and Echinochloa crus-galli were dominant species in the T2 and T3 treatments. Maximum species similarity index was achieved from the T1 and T3 treatments. Thereby this study concluded that increasing of tillage number could affect the similarity index of weed seeds and subsequently alters the weed community composition.
Li, Hongyang; Toleman, Mark A; Bennett, Peter M; Jones, Ronald N; Walsh, Timothy R
2008-09-01
An outbreak involving a Pseudomonas aeruginosa strain that was resistant to all tested antimicrobials except polymyxin B occurred in a hospital in Houston, TX. Previous studies on this strain showed that it possesses a novel mobile metallo-beta-lactamase (MBL) gene, designated bla(VIM-7), located on a plasmid (p07-406). Here, we report the complete sequence, annotation, and functional characterization of this plasmid. p07-406 is 24,179 bp in length, and 29 open reading frames were identified related to known or putatively recognized proteins. Analysis of this plasmid showed it to be comprised of four distinct regions: (i) a region of 5,200 bp having a Tn501-like mercuric resistance (mer) transposon upstream of the replication region; (ii) a Tn3-like transposon carrying a truncated integron with a bla(VIM-7) gene and an insertion sequence inserted at the other end of this transposon; (iii) a region of four genes, upstream of the Tn3-like transposon, possessing very high similarity to plasmid pXcB from Xanthomonas campestris pv. citri commonly associated with plants; (iv) a backbone sequence similar to the backbone structure of the IncP group plasmid Rms149, pB10, and R751. This is the first plasmid to be sequenced carrying an MBL gene and highlights the amelioration of DNA segments from disparate origins, most noticeably from plant pathogens.
Directory of Open Access Journals (Sweden)
Tanushree Mondal
2017-04-01
Full Text Available To study the impact of reduced dose of chemical fertilizer and its combination with biofertilizer and vermicompost on morpho-physiological and biochemical traits of mustard (Brassica campestris cv. B9, field experiments were conducted during winter seasons of November to February 2011–2012 and 2012–2013 respectively in an old alluvial soil zone of Crop Research and Seed Multiplication Farm, Burdwan University, Burdwan, West Bengal, India. Mustard was cultivated using a full recommended dose of chemical fertilizer (N:P:K–100:50:50 and along with six different reduced doses of chemical fertilizer combined with biofertilizers and vermicompost. The performance of the crop was adjudged in terms of various parameters viz. leaf area index (LAI, leaf area duration (LAD, leaf area ratio (LAR, crop growth rate (CGR, net assimilation rate (NAR, photosynthetic rate (PR, harvest index (HI and biochemical attributes such as total chlorophyll, sugar and proline content of physiologically active leaves of mustard. Differential significant (p < 0.05 treatment response was reflected for the studied traits during crop maturity. The data revealed that vermicompost application significantly stimulated most of the studied attributes. It was concluded that 25% reduced dose of chemical fertilizer and its combination with vermicompost (T4 was optimum for most of the parameters studied as compared to the control at both crop stages.
1,8-cineole inhibits both proliferation and elongation of BY-2 cultured tobacco cells.
Yoshimura, Hiroko; Sawai, Yu; Tamotsu, Satoshi; Sakai, Atsushi
2011-03-01
Volatile monoterpenes such as 1,8-cineole inhibit the growth of Brassica campestris seedlings in a dose-dependent manner, and the growth-inhibitory effects are more severe for roots than hypocotyls. The preferential inhibition of root growth may be explained if the compounds inhibit cell proliferation more severely than cell elongation because root growth requires both elongation and proliferation of the constituent cells, whereas hypocotyl growth depends exclusively on elongation of existing cells. In order to examine this possibility, BY-2 suspension-cultured tobacco (Nicotiana tabacum) cells were treated with 1,8-cineole, and the inhibitory effects on cell proliferation and on cell elongation were assessed quantitatively. Treatment with 1,8-cineole lowered both the mitotic index and elongation of the cells in a dose-dependent manner, and the half-maximal inhibitory concentration (IC₅₀) for cell elongation was lower than that for cell proliferation. Moreover, 1,8-cineole also inhibited starch synthesis, with IC₅₀ lower than that for cell proliferation. Thus, the inhibitory effects of 1,8-cineole were not specific to cell proliferation; rather, 1,8-cineole seemed inhibitory to a variety of physiological activities when it was in direct contact with target cells. Based on these results, possible mechanisms for the mode of action of 1,8-cineole and for its preferential inhibition on root growth are discussed.
Spoilage of vegetable crops by bacteria and fungi and related health hazards.
Tournas, V H
2005-01-01
After harvest, vegetables are often spoiled by a wide variety of microorganisms including many bacterial and fungal species. The most common bacterial agents are Erwinia carotovora, Pseudomonas spp., Corynebacterium, Xanthomonas campestris, and lactic acid bacteria with E. carotovora being the most common, attacking virtually every vegetable type. Fungi commonly causing spoilage of fresh vegetables are Botrytis cinerea, various species of the genera Alternaria, Aspergillus, Cladosporium, Colletotrichum, Phomopsis, Fusarium, Penicillium, Phoma, Phytophthora, Pythium and Rhizopus spp., Botrytis cinerea, Ceratocystis fimbriata, Rhizoctonia solani, Sclerotinia sclerotiorum, and some mildews. A few of these organisms show a substrate preference whereas others such as Botrytis cinerea, Colletotrichum, Alternaria, Cladosporium, Phytophthora, and Rhizopus spp., affect a wide variety of vegetables causing devastating losses. Many of these agents enter the plant tissue through mechanical or chilling injuries, or after the skin barrier has been broken down by other organisms. Besides causing huge economic losses, some fungal species could produce toxic metabolites in the affected sites, constituting a potential health hazard for humans. Additionally, vegetables have often served as vehicles for pathogenic bacteria, viruses, and parasites and were implicated in many food borne illness outbreaks. In order to slow down vegetable spoilage and minimize the associated adverse health effects, great caution should be taken to follow strict hygiene, good agricultural practices (GAPs) and good manufacturing practices (GMPs) during cultivation, harvest, storage, transport, and marketing.
Directory of Open Access Journals (Sweden)
ibtissem Kacem Jedidi
2016-04-01
Full Text Available In Tunisia, many people collect wild edible mushrooms as pickers for their own consumption. The present work aims at contributing to the determination of the chemical composition, non volatile components content (soluble sugars, free amino acids and minerals and trace elements of three popular Tunisian wild edible mushrooms species collected from the northwest of Tunisia (Agaricus campestris, Boletus edulis and Cantharellus cibarius.All investigated mushrooms revealed that these species are rich sources of proteins (123.70 – 374.10 g kg-1 dry weight (DW and carbohydrates (403.3 – 722.40 g kg-1 DW, and low content of fat (28.2 – 39.9 g kg-1 DW; the highest energetic contribution was guaranteed by C. cibarius (1542.71 kJ / 100 g. A. compestris (33.14 mg/g DW showed the highest concentration of essential amino acids. The composition in individual sugars was also determined, mannitol and trehalose being the most abundant sugars. C. cibarius revealed the highest concentrations of carbohydrates (722.4 g kg-1 DW and A. compestris the lowest concentration (403.3 g kg-1 DW. Potassium (K and sodium (Na are the most abundant minerals in analyzed samples (A. compestris showed the highest concentrations of K and Na, 49141.44 and 9263.886 µg/g DW respectively.
Morpho-phenological and Antibacterial Characteristics of Aconitum spp.
Directory of Open Access Journals (Sweden)
Yoirentomba Meetei SINAM
2013-05-01
Full Text Available Aconitum species have been traditionally used as ethnomedicine to cure various ailments. The present study reveals the morpho-phenology and antibacterial property of alkaloid extracts of the two Aconitum species. The morpho-phenological characteristics will be helpful for determining the resource availability. Aconitum nagarum is erect type, whereas, Aconitum elwesii is a climber. Aconitum elwesii grows in advance of A. nagarum in terms of growth, flowering and senescence. Towards the end of the year, when the fruits have ripened, the parent tuber dies off. As a result, the daughter tuber becomes independent and in the following spring, takes over the function of the parent tuber. Aconitum nagarum and A. elwesii were found to contain 4-5 aconitine equivalent (AE mg/g of alkaloid. These alkaloids showed antibacterial activity against different bacterial species including human pathogens, namely, Staphylococcus aureus, Salmonella typhimurium, Bordetella bronchiseptica, Escherichia coli, Bacillus subtilis, Pseudomonas putida, Pseudomonas fluorescence and Xanthomonas campestris. However, the extent of antibacterial activity varied among different bacterial species. The antibacterial activity against S. aureus, B. bronchiseptica, and B. subtilis was bactericidal in nature, whereas, against other tested bacterial species was bacteriostatic. Efficacy of the antibacterial activity of these alkaloids was evaluated by comparing with that of standard antibiotics. Differential localization of the antibacterial principle was observed among the Aconitum species studied.
Energy Technology Data Exchange (ETDEWEB)
Gagnaire, J; Gerard, J M [Commisariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires
1963-07-01
The concentration power of plant tissues and the translocation speed of mineral salts are considerably varying with the absorbed salt, the botanical species, the considered tissue and the part of the vegetative cycle. In Grenoble, with Picea excelsa, the 'true dormancy' is short (half-november, end of december). It is accompanied by a pre-dormancy period (October, half-november) and a post dormancy period (January, february, march). In vegetative period, Picea excelsa leaves are less concentrating mineral salt than Acer campestris leaves (coefficient 2 for calcium - 3 for phosphates) and Populus nigra leaves (coefficient 3 for calcium, coefficient 5 for phosphates). (author) [French] Le pouvoir de concentration de tissus vegetaux, et particulierement la vitesse de transport des sels mineraux varient beaucoup selon le sel mineral absorbe, l'espece vegetale, le tissu considere ainsi que la periode du cycle vegetatif. A Grenoble, pour les epiceas 'la dormance veritable' est courte (mi-novembre, fin decembre). Elle est encadree par des periodes de pre-dormance (octobre, mi-novembre) et de post-dormance (janvier, fevrier, mars). Pendant la periode vegetative, le pouvoir de concentration de sels mineraux des aiguilles d'epiceas est plus faible que celui des feuilles d'erables (coefficient 2 pour le calcium - coefficient 3 pour les phosphates) ou que celui des feuilles de peupliers (coefficient 3 pour le calcium - coefficient 5 pour les phosphates). (auteur)
Lin, Shuo; Chen, Yixin; Bai, Yan; Cai, Hongjiao; Wei, Hui; Tian, Houjun; Zhao, Jianwei; Chen, Yong; Yang, Guang; Gu, Xiaojun; Murugan, Kadarkarai
2018-06-06
Tea saponin (TS) is extracted from the seeds of the tea plant and is generally regarded as a safe compound that has insecticidal properties and can act synergistically with other compounds. In this study, the activities of antioxidant enzymes superoxide dismutase (SOD), peroxidase (POD), catalase (CAT), and the levels of malondialdehyde (MDA) were compared in midgut tissues of third instar larvae of the diamondback moth (DBM), Plutella xylostella L. (Lepidoptera: Plutellidae). The larvae were fed on three different host plants, cabbage (Brassica oleracea L. var. capitata [Capparales: Brassicaceae]), radish (Raphanus sativus L. var. radiculus Persi [Capparales: Brassicaceae]), or rape (Brassica campestris L. [Capparales: Brassicaceae]), that had been treated with TS. Higher SOD, POD, and CAT activities were found in DBM larvae fed on cabbage after LC20 (concentration that induced 20% larval mortality) or LC50 (concentration that induced 50% larval mortality) treatment than on the control. On rape, TS treatments led to lower SOD and CAT activities than in the control and to higher POD activities after 24 h. MDA content increased in larvae fed on rape but decreased in larvae fed on radish after 12 h. Our results indicated that DBM larvae are more susceptible to TS on rape than on cabbage and radish, suggesting that this treatment may be an economic and effective means of controlling DBM on rape.
Lukáts, Akos; Dkhissi-Benyahya, Ouria; Szepessy, Zsuzsanna; Röhlich, Pál; Vígh, Béla; Bennett, Nigel C; Cooper, Howard M; Szél, Agoston
2002-07-01
To decide whether the identical topography of short- and middle-wavelength cone photoreceptors in two species of rodents reflects the presence of both opsins in all cone cells. Double-label immunocytochemistry using antibodies directed against short-wavelength (S)-and middle- to long-wavelength (M/L)-sensitive opsin were used to determine the presence of visual pigments in cones of two species of rodents, the Siberian hamster (Phodopus sungorus) and the pouched mouse (Saccostomus campestris) from South Africa. Topographical distribution was determined from retinal whole-mounts, and the colocalization of visual pigments was examined using confocal laser scanning microscopy. Opsin colocalization was also confirmed in consecutive semithin tangential sections. The immunocytochemical results demonstrate that in both the Siberian hamster and the pouched mouse all retinal cones contain two visual pigments. No dorsoventral gradient in the differential expression of the two opsins is observed. The retina of the Siberian hamster and the pouched mouse is the first example to show a uniform coexpression of M and S cone opsins in all cones, without any topographical gradient in opsin expression. This finding makes these two species good models for the study of molecular control mechanisms in opsin coexpression in rodents, and renders them suitable as sources of dual cones for future investigations on the role and neural connections of this cone type.
Halevas, Eleftherios; Nday, Christiane M; Chatzigeorgiou, Evanthia; Varsamis, Vasileios; Eleftheriadou, Despoina; Jackson, Graham E; Litsardakis, Georgios; Lazari, Diamanto; Ypsilantis, Konstantinos; Salifoglou, Athanasios
2017-11-01
The advent of biodegradable nanomaterials with enhanced antibacterial activity stands as a challenge to the global research community. In an attempt to pursue the development of novel antibacterial medicinal nanotechnology, we herein a) synthesized ionic-gelated chitosan nanoparticles, b) compared and evaluated the antibacterial activity of essential oils extracted from nine different herbs (Greek origin) and their combinations with a well-defined antibacterial Zn(II)-Schiff base compound, and c) encapsulated the most effective hybrid combination of Zn(II)-essential oils inside the chitosan matrix, thereby targeting well-formulated nanoparticles of distinct biological impact. The empty and loaded chitosan nanoparticles were physicochemically characterized by FT-IR, Thermogravimetric Analysis (TGA), Scanning Electron Microscopy (SEM), with the entrapment and drug release studies being conducted through UV-Visible and atomic absorption techniques. The antimicrobial properties of the novel hybrid materials were demonstrated against Gram positive (S. aureus, B. subtilis, and B. cereus) and Gram negative (E. coli and X. campestris) bacteria using modified agar diffusion methods. The collective physicochemical profile of the hybrid Zn(II)-essential oil cocktails, formulated so as to achieve optimal activity when loaded to chitosan nanoparticles, signifies the importance of design in the development of efficient nanomedicinal pharmaceuticals a) based on both natural products and biogenic metal ionic cofactors, and b) targeting bacterial infections and drug resistance. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Kyusik Jeong
2011-04-01
Full Text Available The aim of this study was to develop specific and sensitive PCR-based procedures for simultaneous detection of economically important plant seed infection pathogenic bacteria and virus, Xanthomonns campestris pv. vesicatoria (Xcv, Clavibacter michiganensis subsp. michiganensis (Cmm, Erwinia carotovora subsp. carotovora (Ecc, Pepper mild mottle virus (PMMoV and Tobacco mild green mosaic virus (TMGMV in pepper and tomato seeds. Most of pepper and tomato bacterial and virus diseases are responsible for germination and growth obstruction. PCR with arbitral primers: selection of specific primers, performance of PCR with specific primers and determination of the threshold level for pathogens detection. To detect simultaneously the Xcv, Cmm, Ecc, PMMoV and TMGMV in pepper and tomato seeds, five pairs (Cmm-F/R, Ecc-F/R, Xcv-F/R, PMMoV-F/R, TMGMV-F/R of specific primer were synthesized by primer-blast program. The multiplex PCR for the five pathogens in pepper and tomato seeds could detect specially without interference among primers and/or cDNA of plant seeds and other plant pathogens. The PCR result for pathogen detection using 20 commercial pepper and 10 tomato seed samples, Ecc was detected from 4 pepper and 2 tomato seed samples, PMMoV was detected from 1 pepper seed sample, and PMMoV and TMGMV were simultaneously detected from 1 pepper seed sample.
Directory of Open Access Journals (Sweden)
Szövényi Gergely
2015-06-01
Full Text Available Orthopterans play an important role in Red-footed Falcon diet, however, most studies focus only on its qualitative food composition, and less on quantitative composition and preferences of the taxa identified as prey. During the present research, an extensive orthopterological investigation was carried out in the Red-footed Falcon study area, Vásárhelyi Plain (SE-Hungary between 2006 and 2008. Grasshoppers were sampled in their main habitats by sweep netting and pitfall trapping, and orthopterans were identified in the food remnants collected from the nests, both artificial and natural ones. 26 species were detected during the field works, 18 species from the food remnants. Altogether 32 species were identified. Prey preference values for all species for each year were calculated. More than two thirds of the identified preys were Decticus verrucivorus, and nearly 20% were Tettigonia viridissima. Other common prey species were Melanogryllus desertus, Platycleis affinis, Gryllotalpa gryllotalpa, Calliptamus italicus and Gryllus campestris. Based on the prey preference analysis, the most preferred species was Decticus verrucivorus with extreme high values, and the other preferred ones, overlapping with the previous list, were Platycleis affinis, Bicolorana bicolor, Tettigonia viridissima, Calliptamus italicus and Roeseliana roeselii. These results may help in the development of Red-footed Falcon-friendly habitats through the application of habitat management favourable for the preferred prey species.
The gross beta activity and the concentration of sup(90)Sr in the vegetables of Daejeon area
International Nuclear Information System (INIS)
Lee, J.Y.; Jun, J.S.; Oh, H.P.
1984-01-01
The measurement of gross beta activity and the concentration of sup(90)Sr in the vegetables such as Brassica Campestris, Raphanus Sativus and Lactuca Sativa grown in Daejeon area was carried out during the period of April through August 1983. The observed levels of gross beta activity and the concentration of sup(90)Sr in the levels of the vegetables were, on average, 189.2+-51.8pCi/g-ash (2372+-827pCi/kg-fresh) and 44.4+-11.5sup(90)Sr pCi/g-Ca(2.5+-0.5sup(90) pCi/g-ash or 31.6+-8.6 sup(90)Sr pCi/kg-fresh), respectively, while the mean level of the gross beta activity in roots was 158.6+-19.4pCi/g-ash(2121+-899pCi/kg-fresh). On the basis of the ICRP recommendations, an estimative evaluation was made for the concentration of sup(90)Sr in the vegetables, and it was turned out to be far below the permissible level. An attempt was also made to look for any existing difference in the gross beta, activities of the vegetables grown in vinyl house and in open field, taking seasonal variation of airborne radioactivity into account for normalizing the activity deposited during the course of discrepant farming period. (Author)
Gross beta activity and the concentration of sup(90)Sr in the vegetables of Daejeon area
Energy Technology Data Exchange (ETDEWEB)
Lee, J.Y.; Jun, J.S.; Oh, H.P. (Chungnam National Univ., Taejon (Republic of Korea))
1984-06-01
The measurement of gross beta activity and the concentration of sup(90)Sr in the vegetables such as Brassica Campestris, Raphanus Sativus and Lactuca Sativa grown in Daejeon area was carried out during the period of April through August 1983. The observed levels of gross beta activity and the concentration of sup(90)Sr in the levels of the vegetables were, on average, 189.2+-51.8pCi/g-ash (2372+-827pCi/kg-fresh) and 44.4+-11.5sup(90)Sr pCi/g-Ca(2.5+-0.5sup(90) pCi/g-ash or 31.6+-8.6 sup(90)Sr pCi/kg-fresh), respectively, while the mean level of the gross beta activity in roots was 158.6+-19.4pCi/g-ash(2121+-899pCi/kg-fresh). On the basis of the ICRP recommendations, an estimative evaluation was made for the concentration of sup(90)Sr in the vegetables, and it was turned out to be far below the permissible level. An attempt was also made to look for any existing difference in the gross beta, activities of the vegetables grown in vinyl house and in open field, taking seasonal variation of airborne radioactivity into account for normalizing the activity deposited during the course of discrepant farming period.
Uptake of 3HHO and 32P by roots of wheat and rape
International Nuclear Information System (INIS)
Bole, J.B.
1977-01-01
Direct measurements were made of 3 HHO and 32 P taken up from labelled soil by roots of wheat (Triticum aestivum L.) and rape (Brassica campestris L.). Single roots were encased in labelled soil for 3 days, and the amount of 3 HHO and 32 P retained in the shoots was determined. Plants were grown to five stages of maturity in growth boxes under controlled conditions. Roots were labelled at up to four depths (to 90 cm) depending on the rooting depth at each stage of maturity. Uptake of 3 HHP per unit length of root increased as the plant age increased, while uptake of 32 P decreased to below detection levels by 45 days after germination. Larger amounts of both nutrients were translocated to and retained in the shoots from surface roots than from roots located deeper in the soil although the soil was uniform in temperature, bulk density, and composition through the growth boxes. Wheat roots were more efficient than rape roots in absorbing 3 HHO; however, rape roots took up larger amounts of 32 P per unit length of root. Neither native nor added P located more than 30 cm deep is of much importance to these annual crops, since uptake is minimal and the main demand for this nutrient occurs at early growth stages when the root system is restricted to the surface layers
Proposal of Xanthomonas translucens pv. pistaciae pv. nov., pathogenic to pistachio (Pistacia vera).
Giblot-Ducray, Danièle; Marefat, Alireza; Gillings, Michael R; Parkinson, Neil M; Bowman, John P; Ophel-Keller, Kathy; Taylor, Cathy; Facelli, Evelina; Scott, Eileen S
2009-12-01
Strains of Xanthomonas translucens have caused dieback in the Australian pistachio industry for the last 15 years. Such pathogenicity to a dicotyledonous woody host contrasts with that of other pathovars of X. translucens, which are characterized by their pathogenicity to monocotyledonous plant families. Further investigations, using DNA-DNA hybridization, gyrB gene sequencing and integron screening, were conducted to confirm the taxonomic status of the X. translucens pathogenic to pistachio. DNA-DNA hybridization provided a clear classification, at the species level, of the pistachio pathogen as a X. translucens. In the gyrB-based phylogeny, strains of the pistachio pathogen clustered among the X. translucens pathovars as two distinct lineages. Integron screening revealed that the cassette arrays of strains of the pistachio pathogen were different from those of other Xanthomonas species, and again distinguished two groups. Together with previously reported pathogenicity data, these results confirm that the pistachio pathogen is a new pathovar of X. translucens and allow hypotheses about its origin. The proposed name is Xanthomonas translucens pv. pistaciae pv. nov.
Directory of Open Access Journals (Sweden)
LÓPEZ, A.N.
2012-04-01
Full Text Available ResumenLa colza (Brassica napus, B. campestris en siembra directa (SD representa una alternativa en los sistemas de rotación actuales. Armadillidium vulgare es una de las plagas principales de los cultivos en SD. El objetivo de este trabajo fue evaluar cebos de acción combinada como estrategia alternativa de control de dicha especie.Se realizaron ensayos de laboratorio y de campo con los siguientes tratamientos: testigo sin tratamiento químico; testigo químico (4 kg/ha de Carbaryl 8%, MataBiBos Acay; 3, 4 y 5 kg/ha de cebo de acción combinada (Carbaryl 8% + Metaldehído 4%, Dual Acay. Se evaluó el número de individuos de A. vulgare muertos, de plantas dañadas y de plantas sanas. En el laboratorio, a los 2, 3, 7 y 9 días después de la aplicación de los cebos, los tratamientos químicos se diferenciaron del testigo y no mostraron diferencias significativas entre ellos. Los tratamientos con aplicaciones de cebos presentaron un número de plantas sanas y totales mayorcon respecto al testigo. En el campo, se detectaron diferencias en el número de individuos muertos entre los tratamientos químicos y el testigo. No se observaron diferencias en la proporción de individuos muertos ni de plantas dañadas entre los tratamiento químicos, sí respecto al testigo. La presencia del molusquicida en el cebo de acción combinada no interfirió en el control de A. vulgare. Se concluye que el cebo de acción combinada representa una alternativa de control de A. vulgare eficaz, que permite la protección del cultivo de colza. AbstractOilseed rape (Brassica napus, B. campestris under No-Tillage (NT represents an alternative in the current crop rotation systems. Armadillidium vulgare is a principal pest in crops under NT. The aim of this study was to evaluate combined action baits as alternative strategy in the control of that species. Laboratory and fields traits were carried out with five treatments: control treatment without chemicals, positive
Zhu, Su-Qin; Chen, Ming-Wei; Ji, Ben-Hua; Jiao, De-Mao; Liang, Jian-Sheng
2011-08-01
Changes in actual efficiency of PS II photochemistry, non-photochemical quenching (NPQ), content of xanthophylls and kinetics of de-epoxidation were studied in ABA-fed and non-ABA-fed leaves of rice and cabbage under NaCl stress. Salt stress induced more progressive decrease in actual efficiency of PS II photochemistry (ФPS II), higher reduction state of PS II, and a small significant increase in NPQ in NaCl-sensitive rice plants as compared with NaCl-tolerant cabbage plants, whereas exogenously supplied ABA alleviated the decrease in actual efficiency of PS II photochemistry (ФPS II), induced a lower reduction state of PS II, and caused higher capacity of NPQ in ABA-fed plants than in non-ABA-fed plants. As a result, there were higher activities of photosynthetic electron transport, higher capacity of energy dissipation, and lower cumulation of excess light in cabbage than in rice plants, and in ABA-fed leaves than in non-ABA-fed leaves. The effect of ABA was more efficient in cabbage than in rice plants. Addition of exogenous ABA resulted in enhancement of the size of the xanthophyll cycle pool, promotion of de-epoxidation of the xanthophyll cycle components, and a rise in the level of NPQ by altering the kinetics of de-epoxidation of the xanthophyll cycle. Protection from photodamage appears to be achieved by coordinated contributions by exogenous ABA and xanthophyll cycle-mediated NPQ. This variety of photoprotective mechanisms may be essential for conferring photodamage tolerance under NaCl stress. © The Author [2011]. Published by Oxford University Press [on behalf of the Society for Experimental Biology]. All rights reserved.
A biotemplated nickel nanostructure: Synthesis, characterization and antibacterial activity
Energy Technology Data Exchange (ETDEWEB)
Ashtari, Khadijeh [Department of Nanobiotechnology, Faculty of Biological Science, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Fasihi, Javad [Department of Analytical Chemistry, Faculty of Science, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Mollania, Nasrin [Department of Biochemistry, Faculty of Biological Science, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of); Khajeh, Khosro, E-mail: khajeh@modares.ac.ir [Department of Nanobiotechnology, Faculty of Biological Science, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Department of Biochemistry, Faculty of Biological Science, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of)
2014-02-01
Highlights: • Nickel nanostructure-encapsulated bacteria were prepared using electroless deposition. • Bacterium surface was activated by red-ox reaction of its surface amino acids. • Interfacial changes at cell surfaces were investigated using fluorescence spectroscopy. • TEM and AFM depicted morphological changes. • Antibacterial activity of nanostructure was examined against different bacteria strains. - Abstract: Nickel nanostructure-encapsulated bacteria were prepared using the electroless deposition procedure and activation of bacterium cell surface by red-ox reaction of surface amino acids. The electroless deposition step occurred in the presence of Ni(II) and dimethyl amine boran (DMAB). Interfacial changes at bacteria cell surfaces during the coating process were investigated using fluorescence spectroscopy. Fluorescence of tryptophan residues was completely quenched after the deposition of nickel onto bacteria surfaces. Transmission electron microscopy (TEM) and atomic force microscopy (AFM) depicted morphological changes on the surface of the bacterium. It was found that the Ni coated nanostructure was mechanically stable after ultrasonication for 20 min. Significant increase in surface roughness of bacteria was also observed after deposition of Ni clusters. The amount of coated Ni on the bacteria surface was calculated as 36% w/w. The antibacterial activity of fabricated nanostructure in culture media was examined against three different bacteria strains; Escherichia coli, Bacillus subtilis and Xantomonas campestris. The minimum inhibitory concentrations (MIC) were determined as 500 mg/L, 350 mg/L and 200 mg/L against bacteria, respectively.
Production of Fungal Mycelial Protein in Submerged Culture of Soybean Whey
Falanghe, Helcio; Smith, A. K.; Rackis, J. J.
1964-01-01
Various soybean whey media were tested as substrate for seven species of fungi in submerged culture. Very little mycelial growth was obtained with Morchella hybrida, Collybia velutipes, Cantharellus cibarius, and Xylaria polymorpha. Agaricus campestris failed to grow. Tricholoma nudum and Boletus indecisus showed the greatest rate of growth and production of mycelial protein and the best utilization of soybean whey solids, with much shorter incubation times compared with those of the other species. T. nudum developed as spheres having diameters of about 5 to 8 mm, instead of the usual slurry or yeastlike form, in the presence of added ammonium acetate. B. indecisus always developed as spheres. Mycelial yields and production of protein by T. nudum greatly decreased with the addition of more than 1% glucose to soybean whey, whereas with B. indecisus the yield of protein almost doubled when up to 3% glucose was added. The effect of minerals on mycelial growth was determined. With soybean whey concentrated to 50%, the rate of mycelial growth of T. nudum was nearly doubled, but protein content of mycelia was greatly reduced. Mycelial growth and yield of protein of B. indecisus grown in concentrated whey were increased greatly. About 4 to 6 g of mycelial protein per liter can be obtained from fermentation in soybean whey, depending upon the medium used. Utilization of soybean whey by fungal fermentation may have economic value in whey disposal and in the production of products of high protein content. PMID:14199023
Sekar, Jegan; Prabavathy, Vaiyapuri Ramalingam
2014-07-01
Genetic diversity of phlD gene, an essential gene in the biosynthesis of 2,4-diacetylphloroglucinol, was studied by restriction fragment length polymorphism (RFLP) in 20 Phl-producing pseudomonads isolated from finger millet rhizosphere. RFLP analysis of phlD gene displayed three patterns with HaeIII and TaqI enzymes. phlD gene sequence closely correlated with RFLP results and revealed the existence of three new genotypes G, H and I. Further, the phylogenetic and concatenated sequence analysis of the 16S rRNA, rpoB, gyrB, rpoD genes supported the hypothesis that these genotypes G, H and I were different from reported genotypes A-F. In all phylogenetic studies, the genotype G formed a distant clade from the groups of Pseudomonas putida and P. aeruginosa (sensu strictu), but the groups H and I were closely related to P. aeruginosa/P. stutzeri group. The Phl-producing pseudomonads exhibited antagonistic activity against Pyricularia grisea (TN508), Gaeumannomyces graminis (DSM1463), Fusarium oxysporum (DSM62297), Xanthomonas campestris (DSM3586) and Erwinia persicina (HMGU155). In addition, these strains exhibited various plant growth-promoting traits. In conclusion, this study displays the existence of novel Phl-producing pseudomonads genotypes G, H and I from finger millet rhizosphere, which formed taxonomically outward phylogenetic lineage from the groups of P. putida and P. aeruginosa (sensu strictu). © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
In vitro antibacterial effect of tobacco leaf exudates against two bacterial plant pathogens
Directory of Open Access Journals (Sweden)
Yanelis Karina Capdesuñer
2015-01-01
Full Text Available Natural products are an alternative to control microorganisms that cause diseases in crops. This work aimed to evaluate different solvents for obtaining crude extracts from tobacco leaf exudates and to determine in vitro effect of these extracts against two phytopathogenic bacteria: Xanthomonas campestris(Xc and Pectobacterium carotovorum(Pc. Crude extracts from ten tobacco lines using solvents with polarities between 3.1 and 6.2 (dichloromethane, n-butanol, ethyl acetate, methanol and ethanol 90% were obtained. Ethanol 90% was selected as the best solvent for obtaining extracts from tobacco leaf exudates and as a substitute of dichloromethane due to the best yield. The chemical composition diversity of the ethanolic extracts was revealed by thin-layer chromatography. The antibacterial activity was evaluated by agar disk diffusion method recording the inhibition zones. Growth inhibition was observed for all extracts against Xc, and the better activity corresponded to the lines Nic 1061"TI 1738" and Nic 1016 "Incekara" until a minimal amount of 5 µg/ disc, with higher yield in case of the line Nic1061 . Only the extract of the line Nic 1015 was able to inhibit the growth of Pc until a minimal inhibitory concentration of 5 µg/disc. These results suggest a potential use of crude extracts from lines Nic 1061 and Nic 1015 "TI 1341" as an effective agent for the crop protection against Xc and Pc respectively.
International Nuclear Information System (INIS)
Timofeev, S.F.; Podolyak, A.G.; Avseenko, S.V.; Sapegin, L.M.; Dayneko, N.M.
1997-01-01
Science-research in the zones of eviction in the Bragin district of the Gomel region confirms interdependence between development of plants' communities and such factors as type of soil, kind of agricultural field, the term of nonuse. The study of vegetation change on the former fields, represented by turf-podsol soil, indicates that plant community has by now been formed on it, in which out of 100% projection cover prevail Artemisia absinthium L., - 40%, Artemisia campestris L. -20%, Artemisia vulgaris L. -5%, Elytrigia repens (L.) Nevski - 30%. On lower lots, represented by turf-podsol swampy soil, prevail Elytrigia repens - 60%, Artemisia absinthium -20%, Erigeron canadensis - 10%. So, on the unused arable land the tendency to form communities of Elytrigia repens is observed. In 10-15 years there may be a community here, consisting of bunch-grasses an densely turfed grasses. On the haymaking and pasture meadows, sowing plants are replaced by rhizome bunch-grasses (Poa pratensis L.) rhizome (Elytrigia repens) and diverse grasses (Artemisia absinthium, Achillea millefolium, Erigeron canadensis and others). On sowing meadows, situated on peat-swamp soil, Urtica dioica L. took root. It formed powerful herbage with 80-90% projection cover, which prevents the renewing of grasses. Only after gradual decrease of Urtica dioica there will appear different grasses, as well as rhisome grasses. In future this land can be used for haymaking. It is impossible to use this kind of soil without herbicides in large quantity, which may create additional problems of ecological character
Energy Technology Data Exchange (ETDEWEB)
Bialobok, S.; Bartkowiak, S.; Rachwal, L.
1974-01-01
The field work conducted has shown that high concentrations of SO/sub 2/ in the air can be withstood by the following trees and shrubs. Trees: Acer campestris, A. platanoides, Ailanthus altissima, Aesculus hippocastanum, Morus alba, Platanus acerifolia, Pinus strobur, P. nigra, Populus Berolinensis, P. candicans, P. Hybr. 27, P. Marilandica, P. simonii, P. Serotina, Quercus robus, Robinia pseudoacacia. Shrubs: Caragana arborescens, Crataegus oxyacantha, C. monogyna, Cerasus mehaleb, Forsythia/most of the species and varieties/, Ligustrum vulgare, Philadelphus coronaria, Ptelea trifoliata, Sambucus nigra, Salix caprea, Sorbaria sorbifolia, Sorbus aucuparia, Taxus baccata. For the selection of trees and shrubs in the laboratory, high concentrations of SO/sub 2/ were used (60-150 ppm for a period of 10 minutes). Experiments were conducted on cut shrubs kept in the gas chambers. In order to estimate the degree of their injury, they were transferred to a shaded greenhouse. A concentration of 65 ppm of SO/sub 2/ could be withstood by the following Forsythias: Forsythia intermedia Primulina, F. Densiflora, F. Spectabilis, F. giraldina, F. suspensa, F. koreana, F. ovata, F. japonica and Hippophae rhamnoides. A concentration of 130 ppm could be withstood only by F. intermedia Vitelina. A similarly high concentration of SO/sub 2/ could be withstood by shoots and leaves of Ailanthus girladii Duclouxii and by Platanus acerifolia. From among the lilacs Syringa pekinensis and S. amurensis proved resistant to high concentrations of SO/sub 2/.
PRODUCTION OF FUNGAL MYCELIAL PROTEIN IN SUBMERGED CULTURE OF SOYBEAN WHEY.
FALANGHE, H; SMITH, A K; RACKIS, J J
1964-07-01
Various soybean whey media were tested as substrate for seven species of fungi in submerged culture. Very little mycelial growth was obtained with Morchella hybrida, Collybia velutipes, Cantharellus cibarius, and Xylaria polymorpha. Agaricus campestris failed to grow. Tricholoma nudum and Boletus indecisus showed the greatest rate of growth and production of mycelial protein and the best utilization of soybean whey solids, with much shorter incubation times compared with those of the other species. T. nudum developed as spheres having diameters of about 5 to 8 mm, instead of the usual slurry or yeastlike form, in the presence of added ammonium acetate. B. indecisus always developed as spheres. Mycelial yields and production of protein by T. nudum greatly decreased with the addition of more than 1% glucose to soybean whey, whereas with B. indecisus the yield of protein almost doubled when up to 3% glucose was added. The effect of minerals on mycelial growth was determined. With soybean whey concentrated to 50%, the rate of mycelial growth of T. nudum was nearly doubled, but protein content of mycelia was greatly reduced. Mycelial growth and yield of protein of B. indecisus grown in concentrated whey were increased greatly. About 4 to 6 g of mycelial protein per liter can be obtained from fermentation in soybean whey, depending upon the medium used. Utilization of soybean whey by fungal fermentation may have economic value in whey disposal and in the production of products of high protein content.
Lyu, Meiling; Liang, Ying; Yu, Youjian; Ma, Zhiming; Song, Limin; Yue, Xiaoyan; Cao, Jiashu
2015-06-01
BoMF25 acts on pollen wall. Polygalacturonase (PG) is a pectin-digesting enzyme involved in numerous plant developmental processes and is described to be of critical importance for pollen wall development. In the present study, a PG gene, BoMF25, was isolated from Brassica oleracea. BoMF25 is the homologous gene of At4g35670, a PG gene in Arabidopsis thaliana with a high expression level at the tricellular pollen stage. Collinear analysis revealed that the orthologous gene of BoMF25 in Brassica campestris (syn. B. rapa) genome was probably lost because of genome deletion and reshuffling. Sequence analysis indicated that BoMF25 contained four classical conserved domains (I, II, III, and IV) of PG protein. Homology and phylogenetic analyses showed that BoMF25 was clustered in Clade F. The putative promoter sequence, containing classical cis-acting elements and pollen-specific motifs, could drive green fluorescence protein expression in onion epidermal cells. Quantitative RT-PCR analysis suggested that BoMF25 was mainly expressed in the anther at the late stage of pollen development. In situ hybridization analysis also indicated that the strong and specific expression signal of BoMF25 existed in pollen grains at the mature pollen stage. Subcellular localization showed that the fluorescence signal was observed in the cell wall of onion epidermal cells, which suggested that BoMF25 may be a secreted protein localized in the pollen wall.
Döhlemann, Johannes; Brennecke, Meike; Becker, Anke
2016-09-10
The soil-dwelling α-proteobacterium Sinorhizobium meliloti serves as model for studies of symbiotic nitrogen fixation, a highly important process in sustainable agriculture. Here, we report advancements of the genetic toolbox accelerating genome editing in S. meliloti. The hsdMSR operon encodes a type-I restriction-modification (R-M) system. Transformation of S. meliloti is counteracted by the restriction endonuclease HsdR degrading DNA which lacks the appropriate methylation pattern. We provide a stable S. meliloti hsdR deletion mutant showing enhanced transformation with Escherichia coli-derived plasmid DNA and demonstrate that using an E. coli plasmid donor, expressing S. meliloti methyl transferase genes, is an alternative strategy of increasing the transformation efficiency of S. meliloti. Furthermore, we devise a novel cloning-free genome editing (CFGE) method for S. meliloti, Agrobacterium tumefaciens and Xanthomonas campestris, and demonstrate the applicability of this method for intricate applications of the Cre/lox recombination system in S. meliloti. An enhanced Cre/lox system, allowing for serial deletions of large genomic regions, was established. An assay of lox spacer mutants identified a set of lox sites mediating specific recombination. The availability of several non-promiscuous Cre recognition sites enables simultaneous specific Cre/lox recombination events. CFGE combined with Cre/lox recombination is put forward as powerful approach for targeted genome editing, involving serial steps of manipulation to expedite the genetic accessibility of S. meliloti as chassis. Copyright © 2016 Elsevier B.V. All rights reserved.
Commercial versus synthesized polymers for soil erosion control and growth of Chinese cabbage.
Lee, Sang Soo; Chang, Scott X; Chang, Yoon-Young; Ok, Yong Sik
2013-01-01
Soil erosion leads to environmental degradation and reduces soil productivity. The use of anionic polyacrylamide (PAM) and synthesized biopolymer (BP) using lignin, corn starch, acrylamide, and acrylic acid were tested to evaluate soil erosion, water quality, and growth of Chinese cabbage (Brassica campestris L.). Each treatment of PAM and BP was applied at 200 kg ha(-1) to loamy sand soil and subjected to a slope of 36% with a 20 mm h(-1) simulated rainfall. Application of BP decreased soil pH compared to the untreated check (CK); however, the soil pH was not altered with PAM. The decrease in pH might most likely be due to availability of anionic sites to be protonated on soils having pH >6 and soil buffering capacity. Both PAM and BP applications may not induce eutrophication with stable levels of total contents of N and P. With PAM and BP, the average values of suspended soil (SS) and turbidity were reduced by up to 96.0 and 99.9%, respectively, compared to CK. Reduction of SS can be attributed to increasing soil stability and shear strength by clay flocculation. There was no toxicity effects resulting from germination tests and the dry weight was increased by 17.7% (vs. CK) when PAM and BP were applied. These results are attributed to increases in water retention and plant-available water. The use of polymeric soil amendments is an environmentally friendly way to mitigate soil erosion and nonpoint source pollution.
Directory of Open Access Journals (Sweden)
Manoel Albino Coelho de Miranda
2003-01-01
Full Text Available A cultivar de soja IAC-23 foi obtida pelo método genealógico modificado, a partir do cruzamento BR-6 X IAC 83-23, tendo sido avaliada com a designação IAC 93-345, em 14 ambientes, nos Estados de São Paulo e de Minas Gerais. Os ensaios finais foram desenvolvidos em Conceição das Alagoas (MG, Mococa (SP e Campinas (SP, em 1994/95; em Conceição das Alagoas, Campinas, Morro Agudo (SP e Tarumã (SP em 1995/96; Conceição das Alagoas, Mococa, Campinas, Morro Agudo, Tarumã e Ribeirão Preto (SP, em 1996/97; e em Campinas em 1998/99. Utilizou-se o delineamento de blocos ao acaso, com quatro repetições. Em semeaduras de novembro, esse cultivar precoce, com período juvenil longo, floresceu aos 43 dias, após a semeadura, e suas plantas atingiram 67 cm de estatura. A duração entre a emergência das plântulas e o estádio de maturação (R-8 foi de 106 dias, dentro do grupo de maturação precoce. O rendimento médio de grãos foi de 3.017 kg.ha-1. As plantas na maturação apresentam pubescência marrom e sementes amarelas com hilo marrom. Essa cultivar apresenta resistência às doenças pústula-bacteriana (Xanthomonas campestris pv. glycines, fogo-selvagem (Pseudomonas syringae pv. tabaci, cancro-da-haste (Diaporthe phaseolorum f. sp. meridionalis e mancha-café ("soybean mosaic virus", SMV. Apresenta também resistência a insetos mastigadores e sugadores, semelhante à cultivar IAC-17 e superior à IAS-5. A produtividade e estabilidade apresentadas pela cultivar IAC-23 sugerem sua indicação para condições edafoclimáticas similares às dos experimentos realizados.The breeding line IAC 93-345(IAC-23 was selected from the cross BR-6 XIAC 83-23 through single seed descent method (SSD to increase insect resistance, and was evaluated at fourteen environments at São Paulo (SP and Minas Gerais (MG States: Conceição das Alagoas (MG, Mococa and Campinas (SP (1994/95; in Conceição das Alagoas, Mococa, Campinas, Morro Agudo, Tarumã and
Directory of Open Access Journals (Sweden)
Wânia dos Santos Neves
2009-12-01
Full Text Available Neves, W.S; Freitas, L.G.; Coutinho, M.M.; Giaretta-Dallemole, R.; Fabry, C.F.S.; Dhingra, O.D. & Ferraz, S. Atividade nematicida de extratos botânicos de pimenta malagueta (Capsicum frutescens, mostarda (Brassica campestris e alho (Allium sativum sobre o nematóide das galhas, Meloidogyne javanica, em casa de vegetação. Summa Phytopathologica, v.35, n.4, p.255-261, 2009 O experimento teve como objetivo avaliar a atividade nematicida de extratos botânicos dos frutos de pimenta malagueta (Capsicum frutescens, plantas de mostarda (Brassica campestris, de bulbos de alho (Allium sativum e óleo de mostarda sobre o nematóide das galhas, Meloidogyne javanica, em tomateiro em casa de vegetação e posteriormente comparar os extratos que apresentassem maior redução de número de galhas e de ovos com dois produtos à base de capsaicina, capsainóides e alil isotiocianato. Uma mistura peneirada de solo e areia na proporção 1:1 (v:v foi colocada em vasos de plástico e infestada com 4000 ovos de M. javanica. Quatro dias após 20 mL de cada extrato, na concentração de 1000 ppm, foram espalhados sobre o solo. Apenas água foi derramada sobre o solo infestado no tratamento testemunha. Mudas de tomate com 20 dias de idade foram transplantadas quatro dias após a colocação dos extratos ao solo. Após quarenta e cinco dias avaliou-se o número de ovos e o número de galhas do sistema radicular de cada planta. Os extratos clorofórmico e cetônico de pimenta malagueta e o óleo de mostarda apresentaram melhor controle do nematóide, diferindo estatisticamente da testemunha quanto ao número de galhas. Porém, somente o óleo de mostarda reduziu significativamente o número de ovos quando comparado com a testemunha. Os extratos cetônico e clorofórmico de pimenta e o óleo de mostarda reduziram em 34,5%, 40,4% e 99,9% o número de galhas, respectivamente e o óleo de mostarda reduziu em 99,9% o número de ovos. No experimento seguinte foram avaliados
Reinhold-Hurek, Barbara; Maes, Tamara; Gemmer, Sabrina; Van Montagu, Marc; Hurek, Thomas
2006-02-01
The nitrogen-fixing endophyte Azoarcus sp. strain BH72 infects roots of Kallar grass and rice inter- and intra-cellularly and can spread systemically into shoots without causing symptoms of plant disease. Although cellulose or its breakdown products do not support growth, this strain expresses an endoglucanase, which might be involved in infection. Sequence analysis of eglA places the secreted 34-kDa protein into the glycosyl hydrolases family 5, with highest relatedness (40% identity) to endoglucanases of the phytopathogenic bacteria Xanthomonas campestris and Ralstonia solanacearum. Transcriptional regulation studied by eglA:: gusA fusion was not significantly affected by cellulose or its breakdown products or by microaerobiosis. Strongest induction (threefold) was obtained in bacteria grown in close vicinity to rice roots. Visible sites of expression were the emergence points of lateral roots and root tips, which are the primary regions of ingress into the root. To study the role in endophytic colonization, eglA was inactivated by transposon mutagenesis. Systemic spreading of the eglA mutant and of a pilAB mutant into the rice shoot could no longer be detected by polymerase chain reaction. Microscopic inspection of infection revealed that the intracellular colonization of root epidermis cells was significantly reduced in the eglA- mutant BHE6 compared with the wild type and partially restored in the complementation mutant BHRE2 expressing eglA. This provides evidence that Azoarcus sp. endoglucanase is an important determinant for successful endophytic colonization of rice roots, suggesting an active bacterial colonization process.
Rastogi, Gurdeep; Sbodio, Adrian; Tech, Jan J; Suslow, Trevor V; Coaker, Gitta L; Leveau, Johan H J
2012-01-01
The presence, size and importance of bacterial communities on plant leaf surfaces are widely appreciated. However, information is scarce regarding their composition and how it changes along geographical and seasonal scales. We collected 106 samples of field-grown Romaine lettuce from commercial production regions in California and Arizona during the 2009–2010 crop cycle. Total bacterial populations averaged between 105 and 106 per gram of tissue, whereas counts of culturable bacteria were on average one (summer season) or two (winter season) orders of magnitude lower. Pyrosequencing of 16S rRNA gene amplicons from 88 samples revealed that Proteobacteria, Firmicutes, Bacteroidetes and Actinobacteria were the most abundantly represented phyla. At the genus level, Pseudomonas, Bacillus, Massilia, Arthrobacter and Pantoea were the most consistently found across samples, suggesting that they form the bacterial ‘core' phyllosphere microbiota on lettuce. The foliar presence of Xanthomonas campestris pv. vitians, which is the causal agent of bacterial leaf spot of lettuce, correlated positively with the relative representation of bacteria from the genus Alkanindiges, but negatively with Bacillus, Erwinia and Pantoea. Summer samples showed an overrepresentation of Enterobacteriaceae sequences and culturable coliforms compared with winter samples. The distance between fields or the timing of a dust storm, but not Romaine cultivar, explained differences in bacterial community composition between several of the fields sampled. As one of the largest surveys of leaf surface microbiology, this study offers new insights into the extent and underlying causes of variability in bacterial community composition on plant leaves as a function of time, space and environment. PMID:22534606
King, Tim L; Switzer, John F; Morrison, Cheryl L; Eackles, Michael S; Young, Colleen C; Lubinski, Barbara A; Cryan, Paul
2006-12-01
Zapus hudsonius preblei, listed as threatened under the US Endangered Species Act (ESA), is one of 12 recognized subspecies of meadow jumping mice found in North America. Recent morphometric and phylogenetic comparisons among Z. h. preblei and neighbouring conspecifics questioned the taxonomic status of selected subspecies, resulting in a proposal to delist the Z. h. preblei from the ESA. We present additional analyses of the phylogeographic structure within Z. hudsonius that calls into question previously published data (and conclusions) and confirms the original taxonomic designations. A survey of 21 microsatellite DNA loci and 1380 base pairs from two mitochondrial DNA (mtDNA) regions (control region and cytochrome b) revealed that each Z. hudsonius subspecies is genetically distinct. These data do not support the null hypothesis of a homogeneous gene pool among the five subspecies found within the southwestern portion of the species' range. The magnitude of the observed differentiation was considerable and supported by significant findings for nearly every statistical comparison made, regardless of the genome or the taxa under consideration. Structuring of nuclear multilocus genotypes and subspecies-specific mtDNA haplotypes corresponded directly with the disjunct distributions of the subspecies investigated. Given the level of correspondence between the observed genetic population structure and previously proposed taxonomic classification of subspecies (based on the geographic separation and surveys of morphological variation), we conclude that the nominal subspecies surveyed in this study do not warrant synonymy, as has been proposed for Z. h. preblei, Z. h. campestris, and Z. h. intermedius.
Effect of oxygen on the growth and biofilm formation of Xylella fastidiosa in liquid media.
Shriner, Anthony D; Andersen, Peter C
2014-12-01
Xylella fastidiosa is a xylem-limited bacterial pathogen, and is the causative agent of Pierce's disease of grapevines and scorch diseases of many other plant species. The disease symptoms are putatively due to blocking of the transpiration stream by bacterial-induced biofilm formation and/or by the formation of plant-generated tylosis. Xylella fastidiosa has been classified as an obligate aerobe, which appears unusual given that dissolved O2 levels in the xylem during the growing season are often hypoxic (20-60 μmol L(-1)). We examined the growth and biofilm formation of three strains of X. fastidiosa under variable O2 conditions (21, 2.1, 0.21 and 0 % O2), in comparison to that of Pseudomonas syringae (obligate aerobe) and Erwinia carotovora (facultative anaerobe) under similar conditions. The growth of X. fastidiosa more closely resembled that of the facultative anaerobe, and not the obligate aerobe. Xanthomonas campestris, the closest genetic relative of X. fastidiosa, exhibited no growth in an N2 environment, whereas X. fastidiosa was capable of growing in an N2 environment in PW(+), CHARDS, and XDM2-PR media. The magnitude of growth and biofilm formation in the N2 (0 % O2) treatment was dependent on the specific medium. Additional studies involving the metabolism of X. fastidiosa in response to low O2 are warranted. Whether X. fastidiosa is classified as an obligate aerobe or a facultative anaerobe should be confirmed by gene activation and/or the quantification of the metabolic profiles under hypoxic conditions.
Rastogi, Gurdeep; Sbodio, Adrian; Tech, Jan J; Suslow, Trevor V; Coaker, Gitta L; Leveau, Johan H J
2012-10-01
The presence, size and importance of bacterial communities on plant leaf surfaces are widely appreciated. However, information is scarce regarding their composition and how it changes along geographical and seasonal scales. We collected 106 samples of field-grown Romaine lettuce from commercial production regions in California and Arizona during the 2009-2010 crop cycle. Total bacterial populations averaged between 10(5) and 10(6) per gram of tissue, whereas counts of culturable bacteria were on average one (summer season) or two (winter season) orders of magnitude lower. Pyrosequencing of 16S rRNA gene amplicons from 88 samples revealed that Proteobacteria, Firmicutes, Bacteroidetes and Actinobacteria were the most abundantly represented phyla. At the genus level, Pseudomonas, Bacillus, Massilia, Arthrobacter and Pantoea were the most consistently found across samples, suggesting that they form the bacterial 'core' phyllosphere microbiota on lettuce. The foliar presence of Xanthomonas campestris pv. vitians, which is the causal agent of bacterial leaf spot of lettuce, correlated positively with the relative representation of bacteria from the genus Alkanindiges, but negatively with Bacillus, Erwinia and Pantoea. Summer samples showed an overrepresentation of Enterobacteriaceae sequences and culturable coliforms compared with winter samples. The distance between fields or the timing of a dust storm, but not Romaine cultivar, explained differences in bacterial community composition between several of the fields sampled. As one of the largest surveys of leaf surface microbiology, this study offers new insights into the extent and underlying causes of variability in bacterial community composition on plant leaves as a function of time, space and environment.
Sachês antimicrobianos em pós-colheita de manga
Directory of Open Access Journals (Sweden)
Eber Antonio Alves Medeiros
2011-10-01
Full Text Available Objetivou-se com este trabalho desenvolver sachês incorporados com óleos essenciais avaliando as propriedades físico-químicas e microbiológicas de mangas armazenadas em saco de papel contendo estes sachês em seu interior. Os óleos essenciais de orégano (Origanum vulgaris e capim-limão (Cymbopogon citratus foram incorporados em saches, e sua atividade antimicrobiana foi testada nos fungos Colletotrichum gloeosporides, Lasiodiplodia theobromae, Xanthomonas campestris pv. mangiferae indica, Alternaria alternata. Frutos de manga 'Tommy Atkins' foram acondicionados individualmente em sacos de papel contendo em seu interior um sachê antimicrobiano e mantidos a 25 °C ± 2 °C e UR 80% ± 5% por nove dias. Os parâmetros cor da epiderme, firmeza de polpa, sólidos solúveis, acidez titulável e pH sofreram pouca influência dos óleos essenciais de orégano e capim limão, indicando que a presença do óleo essencial não altera as características físico-químicas da polpa de manga. Os sachês ativos incorporados com óleos essenciais de orégano e capim limão apresentaram controle no crescimento dos microrganismos testados, sendo o capim-limão mais eficiente, reduzindo em aproximadamente 2 ciclos Log a contagem de mesófilos aeróbios e fungos filamentosos e leveduras em relação ao tratamento controle empregado.
International Nuclear Information System (INIS)
Usunov, N.; Dojchinov, A.; Kamenov, D.
1994-01-01
An attempt is made to establish the the time when the prolong impact of slightly increased radiation background get over the compensator mechanisms of living systems. The object of investigation was the ecosystem of the Bay of Wromos (Black Sea, BG) and its surroundings where the flotation slack from an uranium mine was disposed. radioactivity. The following radiobiological picture of the site is obtained according to measurements performed: the alpha-activity of the beach sands is higher than one of the slack and is different in plants; the beta-activity is higher compared to controls in all samples investigated; the gamma spectra show high concentration of the members of U-238 and Th-232 series. The biological effect provoked by this heightened radiation background is studied by means of the isoenzymes as indicators of changes on molecular level. The isoenzyme spectra of lactate dehydrogenase and butyrol dehydrogenase is studied by vertical electrophoresis. The following species are tested: Tettigonia candata charp, Galliptumus italicus, Grillus campestris and Lumbicus terrestrial. An increase in activity and quantity of enzymes as well as changes of their isoenzyme spectra is observed. Calliptumus italicus could be used as a bio indicator of contamination, as it show better separation of the LDH and BDH-isoforms of LDH and BDH, and is more wide-spread. The increase in activity and quantity of some isoenzyme fractions in the conditions of this experiment is one of the possible mechanisms for increase in radioresistance of the living systems. 3 tabs., 2 figs., 8 refs
Nakasaki, Kiyohiko; Ohtaki, Akihito; Takemoto, Minoru; Fujiwara, Shunrokuro
2011-03-01
The effect of various operational conditions on the decomposition of organic material during the composting of night-soil treatment sludge was quantitatively examined. The optimum composting conditions were found to be a temperature of ca. 60°C and an initial pH value of 8. Rapid decomposition of organic matter ceased by the sixth day of composting under these optimum conditions, and the final value of the cumulative emission of carbon (E(C)), which represents the degree of organic matter decomposition, was less than 40%, indicating that the sludge contained only a small amount of easily degradable organic material. A plant growth assay using Komatsuna (Brassica campestris L. var. rapiferafroug) in a 1/5000a standard cultivation pot was then conducted for the compost at various degrees of organic matter decomposition: the raw composting material, the final compost obtained on day 6, and the 2 intermediate compost products (i.e., E(C)=10% and 20%). It was found that the larger the E(C), the greater the yield of Komatsuna growth. It was also found that 6 days of composting is sufficient to promote Komatsuna growth at the standard loading level, which is equivalent to a 1.5 g N/pot, since the promotion effect was as high as that obtained using chemical fertilizer. It can therefore be concluded that well-matured compost could be obtained in a short period of time (i.e., as early as 6 days), when night-soil sludge is composted under optimum conditions. Copyright © 2010 Elsevier Ltd. All rights reserved.
Lee, Chia-Hsing; Wang, Chung-Chi; Lin, Huan-Hsuan; Lee, Sang Soo; Tsang, Daniel C W; Jien, Shih-Hao; Ok, Yong Sik
2018-04-01
Climate change gives rise to rapid degradation of rural soils in sloping subtropical and tropical areas and might further threaten environmental sustainability. In this study, we conducted an integrated evaluation of the effects of wood biochar (WB) application mixed with a green waste dreg compost (GWC) on runoff quality, soil losses, and agricultural productivity for a highly weathered tropical soil. A conventional agriculture method, in which soils are treated with anionic polyacrylamide (PAM), was also conducted for comparison. The amounts of runoff and soil loss, and nutrient retention were evaluated a year after WB application. Soil fertility was also investigated through a year pot experiment with rape (Brassica campestris L.) cultivation. Our results showed that the WB application not only effectively increased soil pH, soil organic carbon (SOC) and exchangeable K + but also increased the production of rape plants. Significant reduction of runoff and the increases of inorganic nitrogen (IN) and total phosphorus (TP) were found in the WB-treated soil. Compared to the control, the co-application of WB and GWC, particularly for the WB at 4%, decreased runoff by 16.8%, soil loss by 25%, and IN loss (via runoff) by 41.8%. Meanwhile, compared to the control and PAM treatments, the co-application of WB and GWC improved soil acidity and the contents of SOC, IN, TP, and exchangeable K + . The co-application of WB and GWC could be an alternative agricultural strategy to obtain benefits to agricultural productivity and environmental sustainability. Copyright © 2017 Elsevier B.V. All rights reserved.
Diallel analyses and estimation of genetic parameters of hot pepper (Capsicum chinense Jacq.
Directory of Open Access Journals (Sweden)
Sousa João Alencar de
2003-01-01
Full Text Available The degree of heterosis in the genus Capsicum spp. is considered high; however, most of the studies refer to the species Capsicum annuum L. In spite of the potential use of F1 hybrids in pungent peppers of the species Capsicum chinense, few studies are available which assess the magnitude of heterosis in this species . This study was carried out to assess heterosis and its components in F1 hybrids from a diallel cross between hot pepper lines (Capsicum chinense and to obtain data on the allelic interaction between the parents involved in the crosses. Trials were made in Rio Branco-Acre, Brazil, from March through October 1997. A randomized complete block design with fifteen treatments and three replications was used. The treatments were five C. chinense accessions (from the Vegetable Germplasm Bank of the Universidade Federal de Viçosa - BGH/UFV and 10 F1 hybrids derived from single crosses between them (reciprocals excluded. Diallel analyses were performed for total yield, fruit length/diameter ratio, fruit dry matter per plant, Xanthomonas campestris pv. vesicatoria incidence, capsaicin yield per plant and number of seeds per fruit. Non-additive genetic effects were larger than additive effects for all the traits assessed. Epistasis was detected for fruit dry matter per plant, capsaicin yield per plant and number of seeds per fruit. In these cases, epistasis seemed to be largely responsible for heterosis expression. Dominant gene action, ranging from incomplete dominance to probable overdominance, was responsible for heterosis in those traits where no epistatic genetic action was detected.
Kim, Dae Sung; Kim, Nak Hyun; Hwang, Byung Kook
2015-01-01
The pepper receptor-like cytoplasmic protein kinase, CaPIK1, which mediates signalling of plant cell death and defence responses was previously identified. Here, the identification of a class IV chitinase, CaChitIV, from pepper plants (Capsicum annuum), which interacts with CaPIK1 and promotes CaPIK1-triggered cell death and defence responses, is reported. CaChitIV contains a signal peptide, chitin-binding domain, and glycol hydrolase domain. CaChitIV expression was up-regulated by Xanthomonas campestris pv. vesicatoria (Xcv) infection. Notably, avirulent Xcv infection rapidly induced CaChitIV expression in pepper leaves. Bimolecular fluorescence complementation and co-immunoprecipitation revealed that CaPIK1 interacts with CaChitIV in planta, and that the CaPIK1–CaChitIV complex is localized mainly in the cytoplasm and plasma membrane. CaChitIV is also localized in the endoplasmic reticulum. Transient co-expression of CaChitIV with CaPIK1 enhanced CaPIK1-triggered cell death response and reactive oxygen species (ROS) and nitric oxide (NO) bursts. Co-silencing of both CaChitIV and CaPIK1 in pepper plants conferred enhanced susceptibility to Xcv infection, which was accompanied by a reduced induction of cell death response, ROS and NO bursts, and defence response genes. Ectopic expression of CaPIK1 in Arabidopsis enhanced basal resistance to Hyaloperonospora arabidopsidis infection. Together, the results suggest that CaChitIV positively regulates CaPIK1-triggered cell death and defence responses through its interaction with CaPIK1. PMID:25694549
Kim, Dae Sung; Kim, Nak Hyun; Hwang, Byung Kook
2015-01-01
Plants use a variety of innate immune regulators to trigger cell death and defense responses against pathogen attack. We identified pepper (Capsicum annuum) GLYCINE-RICH RNA-BINDING PROTEIN1 (CaGRP1) as a RECEPTOR-LIKE CYTOPLASMIC PROTEIN KINASE1 (CaPIK1)-interacting partner, based on bimolecular fluorescence complementation and coimmunoprecipitation analyses as well as gene silencing and transient expression analysis. CaGRP1 contains an N-terminal RNA recognition motif and a glycine-rich region at the C-terminus. The CaGRP1 protein had DNA- and RNA-binding activity in vitro. CaGRP1 interacted with CaPIK1 in planta. CaGRP1 and CaGRP1-CaPIK1 complexes were localized to the nucleus in plant cells. CaPIK1 phosphorylated CaGRP1 in vitro and in planta. Transient coexpression of CaGRP1 with CaPIK1 suppressed the CaPIK1-triggered cell death response, accompanied by a reduced CaPIK1-triggered reactive oxygen species (ROS) burst. The RNA recognition motif region of CaGRP1 was responsible for the nuclear localization of CaGRP1 as well as the suppression of the CaPIK1-triggered cell death response. CaGRP1 silencing in pepper conferred enhanced resistance to Xanthomonas campestris pv vesicatoria (Xcv) infection; however, CaPIK1-silenced plants were more susceptible to Xcv. CaGRP1 interacts with CaPIK1 and negatively regulates CaPIK1-triggered cell death and defense responses by suppressing ROS accumulation. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.
International Nuclear Information System (INIS)
Rosa Correa, Albertina Xavier da; Roerig, Leonardo Rubi; Verdinelli, Miguel A.; Cotelle, Sylvie; Ferard, Jean-Francois; Radetski, Claudemir Marcos
2006-01-01
In this work, cadmium phytotoxicity and quantitative sensitivity relationships between different hierarchical endpoints in plants cultivated in a contaminated soil were studied. Thus, germination rate, biomass growth and antioxidative enzyme activity (i.e. superoxide dismutase, peroxidase, catalase and glutathione reductase) in three terrestrial plants (Avena sativa L., Brassica campestris L. cv. Chinensis, Lactuca sativa L. cv. hanson) were analyzed. Plant growth tests were carried out according to an International Standard Organization method and the results were analyzed by ANOVA followed by Williams' test. The concentration of Cd 2+ that had the smallest observed significant negative effect (LOEC) on plant biomass was 6.25, 12.5 and 50 mg Cd/kg dry soil for lettuce, oat and Chinese cabbage, respectively. Activity of all enzymes studied increased significantly compared to enzyme activity in plant controls. For lettuce, LOEC values (mg Cd/kg dry soil) for enzymic activity ranged from 0.05 (glutathione reductase) to 0.39 (catalase). For oat, LOEC values (mg Cd/kg dry soil) ranged from 0.19 (for superoxide dismutase and glutathione reductase) to 0.39 (for catalase and peroxidase). For Chinese cabbage, LOEC values (mg Cd/kg dry soil) ranged from 0.19 (peroxidase, catalase and glutathione reductase) to 0.39 (superoxide dismutase). Classical (i.e. germination and biomass) and biochemical (i.e. enzyme activity) endpoints were compared to establish a sensitivity ranking, which was: enzyme activity > biomass > germination rate. For cadmium-soil contamination, the determination of quantitative sensitivity relationships (QSR) between classical and antioxidative enzyme biomarkers showed that the most sensitive plant species have, generally, the lowest QSR values
Directory of Open Access Journals (Sweden)
Abdjad Asih Nawangsih
2011-04-01
Full Text Available Xanthomonas oryzae pv oryzae the Causal Agent of Bacterial Leaf Blight of rice: Isolation, Characterization, and Study of Transposon Mutagenesis. X. oryzae pv. oryzae (Xoo causes bacterial leaf blight (BLB of rice (Oryza sativa L., a major disease that constrains production of the staple crop in many countries of the world. Identification of X. oryzae pv. oryzae (Xoo was conducted based on the disease symptoms, pathogenicity, morphological, physiological, and genetic characteristics of bacterial cultures isolated from the infected plants. Fifty bacterial isolates predicted as Xoo have been successfully isolated. They are aerobic, rod shaped, and Gram negative bacteria. The isolates were evaluated for their hypersensitivity in tobacco and pathogenicity in rice plant. Fifty isolates induced hypersensitive reaction in tobacco and showed pathogenicity symptom in rice in different length. Based on physiological test, hypersensitivity and pathogenicity reactions, three bacterial isolates strongly predicted as Xoo, i.e. STG21, STG42, and STG46, were non indole formation, non pigment fluorescent, hydrolyzed casein, catalase activity positive, but negative oxidase. Partial sequencing of 16S rRNA genes of STG21 and STG42 showed 80% and 82% homology with X. oryzae, respectively, while STG46 showed 84% homology with X. campestris. Mini-Tn5 transposon mutagenesis of STG21 generated one of the mutants (M5 lossed it’s ability to induce hypersensitive reaction in tobacco plant and deficient in pathogenicity on rice. The lesion length of rice leaf caused by the mutant M5 decreased up to 80%.
Directory of Open Access Journals (Sweden)
Fernanda Morcatti Coura
2018-02-01
Full Text Available ABSTRACT: This study identified the virulence genes, pathovars, and phylogenetic groups of Escherichia coli strains obtained from the feces of dogs with and without diarrhea. Virulence genes and phylogenetic group identification were studied using polymerase chain reaction. Thirty-seven E. coli isolates were positive for at least one virulence factor gene. Twenty-one (57.8% of the positive isolates were isolated from diarrheal feces and sixteen (43.2% were from the feces of non-diarrheic dogs. Enteropathogenic E. coli (EPEC were the most frequently (62.2% detected pathovar in dog feces and were mainly from phylogroup B1 and E. Necrotoxigenic E. coli were detected in 16.2% of the virulence-positive isolates and these contained the cytotoxic necrotizing factor 1 (cnf1 gene and were classified into phylogroups B2 and D. All E. coli strains were negative for the presence of enterotoxigenic E. coli (ETEC enterotoxin genes, but four strains were positive for ETEC-related fimbriae 987P and F18. Two isolates were Shiga toxin-producing E. coli strains and contained the toxin genesStx2 or Stx2e, both from phylogroup B1. Our data showed that EPEC was the most frequent pathovar and B1 and E were the most common phylogroups detected in E. coli isolated from the feces of diarrheic and non-diarrheic dogs.
Directory of Open Access Journals (Sweden)
Kirstin V. Wurms
2017-08-01
Full Text Available Pseudomonas syringae pv. actinidiae (Psa and Pseudomonas syringae pv. actinidifoliorum (Pfm are closely related pathovars infecting kiwifruit, but Psa is considered one of the most important global pathogens, whereas Pfm is not. In this study of Actinidia deliciosa ‘Hayward’ responses to the two pathovars, the objective was to test whether differences in plant defense responses mounted against the two pathovars correlated with the contrasting severity of the symptoms caused by them. Results showed that Psa infections were always more severe than Pfm infections, and were associated with highly localized, differential expression of phytohormones and putative defense gene transcripts in stem tissue closest to the inoculation site. Phytohormone concentrations of jasmonic acid (JA, jasmonate isoleucine (JA-Ile, salicylic acid (SA and abscisic acid were always greater in stem tissue than in leaves, and leaf phytohormones were not affected by pathogen inoculation. Pfm inoculation induced a threefold increase in SA in stems relative to Psa inoculation, and a smaller 1.6-fold induction of JA. Transcript expression showed no effect of inoculation in leaves, but Pfm inoculation resulted in the greatest elevation of the SA marker genes, PR1 and glucan endo-1,3-beta-glucosidase (β-1,3-glucosidase (32- and 25-fold increases, respectively in stem tissue surrounding the inoculation site. Pfm inoculation also produced a stronger response than Psa inoculation in localized stem tissue for the SA marker gene PR6, jasmonoyl-isoleucine-12-hydrolase (JIH1, which acts as a negative marker of the JA pathway, and APETALA2/Ethylene response factor 2 transcription factor (AP2 ERF2, which is involved in JA/SA crosstalk. WRKY40 transcription factor (a SA marker was induced equally in stems by wounding (mock inoculation and pathovar inoculation. Taken together, these results suggest that the host appears to mount a stronger, localized, SA-based defense response to Pfm
Directory of Open Access Journals (Sweden)
Jingfang Chen
Full Text Available Flowering Chinese cabbage is one of the most important vegetable crops in southern China. Genetic improvement of various agronomic traits in this crop is underway to meet high market demand in the region, but the progress is hampered by limited number of molecular markers available in this crop. This study aimed to develop EST-SSR markers from transcriptome sequences generated by next-generation sequencing. RNA-seq of eight cabbage samples identified 48,975 unigenes. Of these unigenes, 23,267 were annotated in 56 gene ontology (GO categories, 6,033 were mapped to 131 KEGG pathways, and 7,825 were assigned to clusters of orthologous groups (COGs. From the unigenes, 8,165 EST-SSR loci were identified and 98.57% of them were 1-3 nucleotide repeats with 14.32%, 41.08% and 43.17% of mono-, di- and tri-nucleotide repeats, respectively. Fifty-eight types of motifs were identified with A/T, AG/CT, AT/AT, AC/GT, AAG/CTT and AGG/CCT the most abundant. The lengths of repeated nucleotide sequences in all SSR loci ranged from 12 to 60 bp, with most (88.51% under 20 bp. Among 170 primer pairs were randomly selected from a total of 4,912 SSR primers we designed, 48 yielded unambiguously polymorphic bands with high reproducibility. Cluster analysis using 48 SSRs classified 34 flowering Chinese cabbage cultivars into three groups. A large number of EST-SSR markers identified in this study will facilitate marker-assisted selection in the breeding programs of flowering Chinese cabbage.
Flowering Chinese cabbage is one of the most important vegetable crops in southern China. Genetic improvement of various agronomic traits in this crop is underway to meet high market demand in the region, but the progress is hampered by limited number of molecular markers available in this crop. Thi...
Chen, Jingfang; Li, Ronghua; Xia, Yanshi; Bai, Guihua; Guo, Peiguo; Wang, Zhiliang; Zhang, Hua; Siddique, Kadambot H M
2017-01-01
Flowering Chinese cabbage is one of the most important vegetable crops in southern China. Genetic improvement of various agronomic traits in this crop is underway to meet high market demand in the region, but the progress is hampered by limited number of molecular markers available in this crop. This study aimed to develop EST-SSR markers from transcriptome sequences generated by next-generation sequencing. RNA-seq of eight cabbage samples identified 48,975 unigenes. Of these unigenes, 23,267 were annotated in 56 gene ontology (GO) categories, 6,033 were mapped to 131 KEGG pathways, and 7,825 were assigned to clusters of orthologous groups (COGs). From the unigenes, 8,165 EST-SSR loci were identified and 98.57% of them were 1-3 nucleotide repeats with 14.32%, 41.08% and 43.17% of mono-, di- and tri-nucleotide repeats, respectively. Fifty-eight types of motifs were identified with A/T, AG/CT, AT/AT, AC/GT, AAG/CTT and AGG/CCT the most abundant. The lengths of repeated nucleotide sequences in all SSR loci ranged from 12 to 60 bp, with most (88.51%) under 20 bp. Among 170 primer pairs were randomly selected from a total of 4,912 SSR primers we designed, 48 yielded unambiguously polymorphic bands with high reproducibility. Cluster analysis using 48 SSRs classified 34 flowering Chinese cabbage cultivars into three groups. A large number of EST-SSR markers identified in this study will facilitate marker-assisted selection in the breeding programs of flowering Chinese cabbage.
DEFF Research Database (Denmark)
Silipo, Alba; Sturiale, Luisa; Garozzo, Domenico
2008-01-01
Lipopolysaccharides (LPSs) are major components of the cell surface of Gram-negative bacteria. LPSs comprise a hydrophilic heteropolysaccharide (formed by the core oligosaccharide and the O-specific polysaccharide) that is covalently linked to the glycolipid moiety lipid A, which anchors these ma...
DEFF Research Database (Denmark)
Dudnik, Alexey; Dudler, Robert
2014-01-01
derivative that inhibits the eukaryotic proteasome. In strains colonizing dicotyledonous plants, the compound was demonstrated to suppress the salicylic-acid-dependent defense pathway. Here, we analyze virulence factors of three strains colonizing wheat (Triticum aestivum): P. syringae pathovar syringae (Psy...
Huang, Chao-Li; Pu, Pei-Hua; Huang, Hao-Jen; Sung, Huang-Mo; Liaw, Hung-Jiun; Chen, Yi-Min; Chen, Chien-Ming; Huang, Ming-Ban; Osada, Naoki; Gojobori, Takashi; Pai, Tun-Wen; Chen, Yu-Tin; Hwang, Chi-Chuan; Chiang, Tzen-Yuh
2015-01-01
Background: Comparative genomics provides insights into the diversification of bacterial species. Bacterial speciation usually takes place with lasting homologous recombination, which not only acts as a cohering force between diverging lineages but brings advantageous alleles favored by natural selection, and results in ecologically distinct species, e.g., frequent host shift in Xanthomonas pathogenic to various plants. Results: Using whole-genome sequences, we examined the genetic divergence in Xanthomonas campestris that infected Brassicaceae, and X. citri, pathogenic to a wider host range. Genetic differentiation between two incipient races of X. citri pv. mangiferaeindicae was attributable to a DNA fragment introduced by phages. In contrast to most portions of the genome that had nearly equivalent levels of genetic divergence between subspecies as a result of the accumulation of point mutations, 10% of the core genome involving with homologous recombination contributed to the diversification in Xanthomonas, as revealed by the correlation between homologous recombination and genomic divergence. Interestingly, 179 genes were under positive selection; 98 (54.7%) of these genes were involved in homologous recombination, indicating that foreign genetic fragments may have caused the adaptive diversification, especially in lineages with nutritional transitions. Homologous recombination may have provided genetic materials for the natural selection, and host shifts likely triggered ecological adaptation in Xanthomonas. To a certain extent, we observed positive selection nevertheless contributed to ecological divergence beyond host shifting. Conclusion: Altogether, mediated with lasting gene flow, species formation in Xanthomonas was likely governed by natural selection that played a key role in helping the deviating populations to explore novel niches (hosts) or respond to environmental cues, subsequently triggering species diversification. © Huang et al.
Energy Technology Data Exchange (ETDEWEB)
Jensen, Matthew R.; Goblirsch, Brandon R.; Christenson, James K.; Esler, Morgan A.; Mohamed, Fatuma A.; Wackett, Lawrence P.; Wilmot, Carrie M. (UMM)
2017-10-12
In the interest of decreasing dependence on fossil fuels, microbial hydrocarbon biosynthesis pathways are being studied for renewable, tailored production of specialty chemicals and biofuels. One candidate is long-chain olefin biosynthesis, a widespread bacterial pathway that produces waxy hydrocarbons. Found in three- and four-gene clusters, oleABCD encodes the enzymes necessary to produce cis-olefins that differ by alkyl chain length, degree of unsaturation, and alkyl chain branching. The first enzyme in the pathway, OleA, catalyzes the Claisen condensation of two fatty acyl-coenzyme A (CoA) molecules to form a β-keto acid. In this report, the mechanistic role of Xanthomonas campestris OleA Glu117 is investigated through mutant enzymes. Crystal structures were determined for each mutant as well as their complex with the inhibitor cerulenin. Complemented by substrate modeling, these structures suggest that Glu117 aids in substrate positioning for productive carbon–carbon bond formation. Analysis of acyl-CoA substrate hydrolysis shows diminished activity in all mutants. When the active site lacks an acidic residue in the 117 position, OleA cannot form condensed product, demonstrating that Glu117 has a critical role upstream of the essential condensation reaction. Profiling of pH dependence shows that the apparent pKa for Glu117 is affected by mutagenesis. Taken together, we propose that Glu117 is the general base needed to prime condensation via deprotonation of the second, non-covalently bound substrate during turnover. This is the first example of a member of the thiolase superfamily of condensing enzymes to contain an active site base originating from the second monomer of the dimer.
Echchakery, Mohamed; Chicharro, Carmen; Boussaa, Samia; Nieto, Javier; Carrillo, Eugenia; Sheila, Ortega; Moreno, Javier; Boumezzough, Ali
2017-10-02
Leishmaniasis remains a major public health problem in African nations, including Morocco, where little is known about the vertebrate reservoirs involved in the causal parasites' transmission cycles. The present study investigates the role of rodent species as potential reservoirs of Leishmania spp. in central Morocco, where both L. tropica and L. infantum have been reported. Rodents were caught from 22 sites in central Morocco, by using Sherman metal traps, and identified morphologically. For each specimen, genomic DNA was extracted from different tissues using the Speed Tools DNA extraction Kit. Then, samples were PCR-analyzed, targeting the SSU rRNA gene to detect Leishmania spp. DNA, followed by amplification of the internal transcribed spacer 1 (ITS1) and its sequencing to identify the species. A total of 197 rodents belonging to ten species were captured and identified: Rattus rattus (40.61%), Mus musculus (25.38%), Apodemus sylvaticus (8.63%), Mus spretus (7.11%), Meriones shawi (5.58%), Rattus norvegicus (4.57%), Meriones libycus (3.05%), Mastomys erythroleucus (2.03%), Gerbillus campestris (2.03%) and Lemniscomys barbarus (1.01%). Molecular analysis revealed the presence of Leishmania species in 18 specimens: six R. rattus (out of 80 captured; 7.5%), 11 M. musculus (out of 50 captured; 22%), and one R. norvegicus (out of 9 captured; 11.11%). To the best of our knowledge, L. infantum and L. tropica were identified in rodent species for the first time in Morocco. These findings suggest that rodent species may be involved in L. infantum and L. tropica transmission cycles in this country but that further studies are needed to confirm their role as reservoirs of Leishmania species in Morocco.
Huang, Chao-Li
2015-03-15
Background: Comparative genomics provides insights into the diversification of bacterial species. Bacterial speciation usually takes place with lasting homologous recombination, which not only acts as a cohering force between diverging lineages but brings advantageous alleles favored by natural selection, and results in ecologically distinct species, e.g., frequent host shift in Xanthomonas pathogenic to various plants. Results: Using whole-genome sequences, we examined the genetic divergence in Xanthomonas campestris that infected Brassicaceae, and X. citri, pathogenic to a wider host range. Genetic differentiation between two incipient races of X. citri pv. mangiferaeindicae was attributable to a DNA fragment introduced by phages. In contrast to most portions of the genome that had nearly equivalent levels of genetic divergence between subspecies as a result of the accumulation of point mutations, 10% of the core genome involving with homologous recombination contributed to the diversification in Xanthomonas, as revealed by the correlation between homologous recombination and genomic divergence. Interestingly, 179 genes were under positive selection; 98 (54.7%) of these genes were involved in homologous recombination, indicating that foreign genetic fragments may have caused the adaptive diversification, especially in lineages with nutritional transitions. Homologous recombination may have provided genetic materials for the natural selection, and host shifts likely triggered ecological adaptation in Xanthomonas. To a certain extent, we observed positive selection nevertheless contributed to ecological divergence beyond host shifting. Conclusion: Altogether, mediated with lasting gene flow, species formation in Xanthomonas was likely governed by natural selection that played a key role in helping the deviating populations to explore novel niches (hosts) or respond to environmental cues, subsequently triggering species diversification. © Huang et al.
Directory of Open Access Journals (Sweden)
E de Sousa
2013-12-01
Full Text Available In order to maintain the high production and export rates achieved by the Brazilian poultry industry, it is necessary to prevent and control certain disease agents, such as Salmonella spp. Using bacterial cultures, the aim of the present study was to investigate the prevalence of Salmonella spp. in specimens collected from broiler facilities. Local wild birds were also sampled, as well as the feces of swine housed on the poultry farm. After sample collection, the isolated serotypes were subsequently inoculated into broiler chicks to determine their effects. Positive samples were collected from the following locations in the poultry facilities: poultry litter (S. serotype 4,5,12:R:-; S. Heidelberg; S. Infantis, broiler feces (S. Heidelberg; S. serotype 6,7:R:-; S. serotype 4,5,12:R:-; S. Tennessee, water (S. Glostrup; S. serotype 6,8:d:-;, and lesser mealworms (Alphitobius diaperinus found in the litter (S. Tennessee. Among the 36 wild birds captured, S. Heidelberg was isolated from one bird's organs and intestinal contents (Colaptes campestris, and S. Enteritidis was isolated from another bird's intestinal contents (Zenaida auriculata. Salmonella Panama and Salmonella Typhimurium were isolated from swine feces. One-day-old chicks (150 were divided into 10 groups of 15 animals each. Each group was orally inoculated with a previously isolated serotype of Salmonella. Soft stools were observed on the cage floor and around the birds' cloaca between 3 and 12 days post-infection (dpi. The different serotypes of Salmonella used to inoculate the chicks were re-isolated from the spleen, liver, and cecal content samples of the infected birds on 15 and 21 dpi.
Directory of Open Access Journals (Sweden)
Usha Kiranmayi Mangamuri
2016-06-01
Full Text Available Sediment samples from the mangrove ecosystem of Nizampatnam have been analyzed for actinomycetes as an elite source to screen for the formulation and production of antimicrobial and cytotoxic compounds. The actinomycetes strain VUK-10 has an interesting bioactivity profile and was isolated during our systematic study of mangrove actinomycetes. It was identified as Pseudonocardia endophytica with the aid of polyphasic taxonomy. The ethyl acetate extract of the actinobacterial culture filtrate has been purified by gel-filtration and silica gel column chromatographic purifications led to the isolation of two diketopiperazine compounds, (3S,8aS-3-isobutylhexahydropyrrolo[1,2-a]pyrazine-1,4-dione (1 and (3R,8aS-3-isobutylhexahydropyrrolo[1,2-a]pyrazine-1,4-dione (2. The compounds listed, alluring cytotoxic activity against MDA-MB-231, HeLa, MCF-7 and OAW-42 cancer cell lines and also exhibited antimicrobial activities against gram-positive, gram-negative bacteria and fungi. Compound 1 recorded significant antibacterial activity against Xanthomonas campestris and Escherichia coli (8 μg/ml and compound 2 presented highest activity against Bacillus subtilis (4 μg/ml. Compounds 1 and 2 were active against pathogenic fungi to plants and human beings. The activity was compared with griseofulvin and amphotericin-B, which are standard fungicides. The activity of 16 μg/ml by compound 1 was recorded against Epidermophyton floccosum; an anthropophilic dermatophyte responsible for tinea pedis, tinea cruris and tinea corporis. To the best of our knowledge this is the first narration on the isolation of supra said compounds from the genus Pseudonocardia.
Directory of Open Access Journals (Sweden)
Michael Ionescu
2016-07-01
Full Text Available Cell density-dependent regulation of gene expression in Xylella fastidiosa that is crucial to its switching between plant hosts and insect vectors is dependent on RpfF and its production of 2-enoic acids known as diffusible signal factor (DSF. We show that X. fastidiosa produces a particularly large variety of similar, relatively long-chain-length 2-enoic acids that are active in modulating gene expression. Both X. fastidiosa itself and a Pantoea agglomerans surrogate host harboring X. fastidiosa RpfF (XfRpfF is capable of producing a variety of both saturated and unsaturated free fatty acids. However, only 2-cis unsaturated acids were found to be biologically active in X. fastidiosa. X. fastidiosa produces, and is particularly responsive to, a novel DSF species, 2-cis-hexadecanoic acid that we term XfDSF2. It is also responsive to other, even longer 2-enoic acids to which other taxa such as Xanthomonas campestris are unresponsive. The 2-enoic acids that are produced by X. fastidiosa are strongly affected by the cellular growth environment, with XfDSF2 not detected in culture media in which 2-tetradecenoic acid (XfDSF1 had previously been found. X. fastidiosa is responsive to much lower concentrations of XfDSF2 than XfDSF1. Apparently competitive interactions can occur between various saturated and unsaturated fatty acids that block the function of those agonistic 2-enoic fatty acids. By altering the particular 2-enoic acids produced and the relative balance of free enoic and saturated fatty acids, X. fastidiosa might modulate the extent of DSF-mediated quorum sensing.
Directory of Open Access Journals (Sweden)
Uğur Tutar
2012-12-01
Full Text Available Toprak solucanlarının, organik atıkları biyolojik olarak parçalayarak ayrıştırmaları ile oluşturdukları “vemikompost” un, bazı patojen bakteri ve funguslara karşı etkili oldukları yapılan çeşitli araştırmalarla saptanmıştır. Bu çalışmada, Eisenia fetida türü toprak solucanlarından elde edilen vermikompostun; etanol ve kloroform solventleri kullanılarak elde edilen ekstrelerinin, bitkilerde hastalıklara neden olan toprak kaynaklı patojen 9 adet bakteri ve 9 adet fungusa karşı etkinliklerinin belirlenmesi amacıyla “disk difüzyon” ve “MIC” testleri uygulanmıştır. Çalışma sonuçlarına göre, toprak solucanlarından elde edilen vermikompostun kloroform ile elde edilen ekstrelerinin Pseudomonas syringae, Xhantomonas carotae, Sclerotinia sclerotiorum, Fusarim oxysporum, Aspergillus humicola ve Aspergillus fumigatus’ a karşı etkileri güçlü olurken Erwinia chrysanthemi, Pseudomonas fluorescens, ve Penicillium brevicompactum’ a karşı etkilerinin daha zayıf olduğu görülmüştür. Vermikompostun etanol ile elde edilen ekstrelerinin ise Pseudomonas syringae, Xhantomonas campestris ve Aspergillus fumigatus’ a karşı etkilerinin güçlü olduğu, Erwinia herbicola, Erwinia chrysanthemi ve Sclerotinia sclerotiorum’ a karşı ise daha zayıf bir etki gösterdiği saptanmıştır.
Energy Technology Data Exchange (ETDEWEB)
Rosa Correa, Albertina Xavier da [Centro de Ciencias Tecnologicas da Terra e do Mar, Universidade do Vale do Itajai, Rua Uruguai, 458, 88302-202 Itajai SC (Brazil); Roerig, Leonardo Rubi [Centro de Ciencias Tecnologicas da Terra e do Mar, Universidade do Vale do Itajai, Rua Uruguai, 458, 88302-202 Itajai SC (Brazil); Verdinelli, Miguel A. [Centro de Ciencias Tecnologicas da Terra e do Mar, Universidade do Vale do Itajai, Rua Uruguai, 458, 88302-202 Itajai SC (Brazil); Cotelle, Sylvie [Centre des Sciences de l' Environnement, Universite de Metz, 57000 Metz (France); Ferard, Jean-Francois [Centre des Sciences de l' Environnement, Universite de Metz, 57000 Metz (France); Radetski, Claudemir Marcos [Centro de Ciencias Tecnologicas da Terra e do Mar, Universidade do Vale do Itajai, Rua Uruguai, 458, 88302-202 Itajai SC (Brazil)]. E-mail: radetski@univali.br
2006-03-15
In this work, cadmium phytotoxicity and quantitative sensitivity relationships between different hierarchical endpoints in plants cultivated in a contaminated soil were studied. Thus, germination rate, biomass growth and antioxidative enzyme activity (i.e. superoxide dismutase, peroxidase, catalase and glutathione reductase) in three terrestrial plants (Avena sativa L., Brassica campestris L. cv. Chinensis, Lactuca sativa L. cv. hanson) were analyzed. Plant growth tests were carried out according to an International Standard Organization method and the results were analyzed by ANOVA followed by Williams' test. The concentration of Cd{sup 2+} that had the smallest observed significant negative effect (LOEC) on plant biomass was 6.25, 12.5 and 50 mg Cd/kg dry soil for lettuce, oat and Chinese cabbage, respectively. Activity of all enzymes studied increased significantly compared to enzyme activity in plant controls. For lettuce, LOEC values (mg Cd/kg dry soil) for enzymic activity ranged from 0.05 (glutathione reductase) to 0.39 (catalase). For oat, LOEC values (mg Cd/kg dry soil) ranged from 0.19 (for superoxide dismutase and glutathione reductase) to 0.39 (for catalase and peroxidase). For Chinese cabbage, LOEC values (mg Cd/kg dry soil) ranged from 0.19 (peroxidase, catalase and glutathione reductase) to 0.39 (superoxide dismutase). Classical (i.e. germination and biomass) and biochemical (i.e. enzyme activity) endpoints were compared to establish a sensitivity ranking, which was: enzyme activity > biomass > germination rate. For cadmium-soil contamination, the determination of quantitative sensitivity relationships (QSR) between classical and antioxidative enzyme biomarkers showed that the most sensitive plant species have, generally, the lowest QSR values.
Schriefer, Eva-Maria; Hoffmann-Thoms, Stephanie; Schmid, Franz X; Schmid, Annika; Heesemann, Jürgen
2013-01-01
In general, β-lactamases of medically important Gram-negative bacteria are Sec-dependently translocated into the periplasm. In contrast, β-lactamases of Mycobacteria spp. (BlaC, BlaS) and the Gram-negative environmental bacteria Stenotrophomonas maltophilia (L2) and Xanthomonas campestris (Bla(XCC-1)) have been reported to be secreted by the twin-arginine translocation (Tat) system. Yersinia enterocolitica carries 2 distinct β-lactamase genes (blaA and blaB) encoding BlaA(Ye) and the AmpC-like β-lactamase BlaB, respectively. By using the software PRED-TAT for prediction and discrimination of Sec from Tat signal peptides, we identified a functional Tat signal sequence for Yersinia BlaA(Ye). The Tat-dependent translocation of BlaA(Ye) could be clearly demonstrated by using a Y. enterocolitica tatC-mutant and cell fractionation. Moreover, we could demonstrate a unique unusual temperature-dependent activity profile of BlaA(Ye) ranging from 15 to 60 °C and a high 'melting temperature' (T(M)=44.3°) in comparison to the related Sec-dependent β-lactamase TEM-1 (20-50°C, T(M)=34.9 °C). Strikingly, the blaA gene of Y. enterocolitica is present in diverse environmental Yersinia spp. and a blaA homolog gene could be identified in the closely related Photorhabdus asymbiotica (BlaA(Pa); 69% identity to BlaA(Ye)). For BlaA(Pa) of P. asymbiotica, we could also demonstrate Tat-dependent secretion. These results suggest that Yersinia BlaA-related β-lactamases may be the prototype of a large Tat-dependent β-lactamase family, which originated from environmental bacteria. Copyright © 2012 Elsevier GmbH. All rights reserved.
Tieman, Denise; Zeigler, Michelle; Schmelz, Eric; Taylor, Mark G; Rushing, Sarah; Jones, Jeffrey B; Klee, Harry J
2010-04-01
Methyl salicylate (MeSA) is a volatile plant secondary metabolite that is an important contributor to taste and scent of many fruits and flowers. It is synthesized from salicylic acid (SA), a phytohormone that contributes to plant pathogen defense. MeSA is synthesized by members of a family of O-methyltransferases. In order to elaborate the mechanism of MeSA synthesis in tomato, we screened a set of O-methyltransferases for activity against multiple substrates. An enzyme that specifically catalyzes methylation of SA, SlSAMT, as well as enzymes that act upon jasmonic acid and indole-3-acetic acid were identified. Analyses of transgenic over- and under-producing lines validated the function of SlSAMT in vivo. The SlSAMT gene was mapped to a position near the bottom of chromosome 9. Analysis of MeSA emissions from an introgression population derived from a cross with Solanum pennellii revealed a quantitative trait locus (QTL) linked to higher fruit methyl salicylate emissions. The higher MeSA emissions associate with significantly higher SpSAMT expression, consistent with SAMT gene expression being rate limiting for ripening-associated MeSA emissions. Transgenic plants that constitutively over-produce MeSA exhibited only slightly delayed symptom development following infection with the disease-causing bacterial pathogen, Xanthomonas campestris pv. vesicatoria (Xcv). Unexpectedly, pathogen-challenged leaves accumulated significantly higher levels of SA as well as glycosylated forms of SA and MeSA, indicating a disruption in control of the SA-related metabolite pool. Taken together, the results indicate that SlSAMT is critical for methyl salicylate synthesis and methyl salicylate, in turn, likely has an important role in controlling SA synthesis.
Pseudomonas syringae (P.s.) infects diverse plant species and several P.s. pathovars have been used in the study of molecular events that occur during plant-microbe interactions. Although the relationship between bacterial metabolism, nutrient acquisition and virulence has attracted increasing atten...
Bull, Carolee T; Clarke, Christopher R; Cai, Rongman; Vinatzer, Boris A; Jardini, Teresa M; Koike, Steven T
2011-07-01
Since 2002, severe leaf spotting on parsley (Petroselinum crispum) has occurred in Monterey County, CA. Either of two different pathovars of Pseudomonas syringae sensu lato were isolated from diseased leaves from eight distinct outbreaks and once from the same outbreak. Fragment analysis of DNA amplified between repetitive sequence polymerase chain reaction; 16S rDNA sequence analysis; and biochemical, physiological, and host range tests identified the pathogens as Pseudomonas syringae pv. apii and P. syringae pv. coriandricola. Koch's postulates were completed for the isolates from parsley, and host range tests with parsley isolates and pathotype strains demonstrated that P. syringae pv. apii and P. syringae pv. coriandricola cause leaf spot diseases on parsley, celery, and coriander or cilantro. In a multilocus sequence typing (MLST) approach, four housekeeping gene fragments were sequenced from 10 strains isolated from parsley and 56 pathotype strains of P. syringae. Allele sequences were uploaded to the Plant-Associated Microbes Database and a phylogenetic tree was built based on concatenated sequences. Tree topology directly corresponded to P. syringae genomospecies and P. syringae pv. apii was allocated appropriately to genomospecies 3. This is the first demonstration that MLST can accurately allocate new pathogens directly to P. syringae sensu lato genomospecies. According to MLST, P. syringae pv. coriandricola is a member of genomospecies 9, P. cannabina. In a blind test, both P. syringae pv. coriandricola and P. syringae pv. apii isolates from parsley were correctly identified to pathovar. In both cases, MLST described diversity within each pathovar that was previously unknown.
Directory of Open Access Journals (Sweden)
Gilmar P. Henz
2002-06-01
Full Text Available Este artigo tem como objetivo principal relatar as doenças registradas para a mandioquinha-salsa até a data presente e descrever sua situação atual no País. Na literatura, foram registrados para a cultura 27 gêneros de fungos, três de bactérias, doze de nematóides e cinco espécies de vírus. Destes, já foram relatados no Brasil treze fungos, e todos nematóides e bactérias, enquanto nenhum vírus foi oficialmente registrado, embora já tenham sido observadas plantas com sintomas típicos de viroses a campo. A maior parte dos registros estão na forma de resumos, capítulos de livros ou publicações genéricas, desprovidos de uma série de dados relevantes, como provas de patogenicidade, importância da doença, perdas, identificação mais acurada, entre outras. A cultura da mandioquinha-salsa ainda é tida como rústica, sendo poucas as doenças consideradas limitantes. O nematóide das galhas (Meloidogyne spp. e a podridão-mole pós-colheita causada por Erwinia spp. são os principais problemas atualmente, e causam perdas significativas. Também ocorrem com muita frequência manchas foliares causadas por Septoria, Cercospora e Xanthomonas campestris pv. arracaciae, e em algumas regiões podridão de plantas a campo causadas por Sclerotinia sclerotiorum e Sclerotium rolfsii. Como não existe nenhum produto químico oficialmente registrado para a mandioquinha-salsa no Ministério da Agricultura, Pecuária e Abastecimento, as medidas de controle passíveis de recomendação incluem ações preventivas, como o uso de material propagativo sadio (preferencialmente mudas pré-enraizadas de origem conhecida, a adoção de rotação de culturas, a eliminação de plantas ou partes doentes, e a adubação e a irrigação adequadas. O estudo sistematizado das doenças e o registro cuidadoso de surtos ou novas enfermidades para a cultura são importantes para subsidiar futuras medidas de controle.The diseases of arracacha that have already
Comparative genomic analysis of two-component regulatory proteins in Pseudomonas syringae
DEFF Research Database (Denmark)
Lavin, J.L.; Kiil, Kristoffer; Resano, O.
2007-01-01
Background: Pseudomonas syringae is a widespread bacterial plant pathogen, and strains of P. syringae may be assigned to different pathovars based on host specificity among different plant species. The genomes of P. syringae pv. syringae (Psy) B728a, pv. tomato (Pto) DC3000 and pv. phaseolicola...
CRISPR-cas loci profiling of Cronobacter sakazakii pathovars.
Ogrodzki, Pauline; Forsythe, Stephen James
2016-12-01
Cronobacter sakazakii sequence types 1, 4, 8 and 12 are associated with outbreaks of neonatal meningitis and necrotizing enterocolitis infections. However clonality results in strains which are indistinguishable using conventional methods. This study investigated the use of clustered regularly interspaced short palindromic repeats (CRISPR)-cas loci profiling for epidemiological investigations. Seventy whole genomes of C. sakazakii strains from four clonal complexes which were widely distributed temporally, geographically and origin of source were profiled. All strains encoded the same type I-E subtype CRISPR-cas system with a total of 12 different CRISPR spacer arrays. This study demonstrated the greater discriminatory power of CRISPR spacer array profiling compared with multilocus sequence typing, which will be of use in source attribution during Cronobacter outbreak investigations.
Response of vegetable seed germination to solar radiation penetrating through soil
International Nuclear Information System (INIS)
Hamamoto, H.
1999-01-01
Response of vegetable seeds to irradiation and emergence of plants seeded at various depths were investigated to clarify the effects of solar radiation through soil on vegetable seed germination. Seeds of eight vegetable species were germinated in Petri dishes under 11-h irradiation per day. Seed germination was delayed in tomato (Licopersicon esculentum Mill.) but accelerated in perilla (Perilla ocymoides L.) and Japanese hornwort (Cryptotaenia japonica Hassk.) with increase in irradiation at the intensities higher than 0.4W m -2 . Seeds of Japanese radish (Raphanus sativus L.), watermelon (Citrullus lanatus Matsum.), and Chinese cabbage (Brassica campestris L.) showed delayed germination at more than 4-6W m -2 . No effect of irradiation on lettuce (Lactuca sativa L.) and carrot (Daucus carota L.) seed germination was seen. For tomato, Japanese radish and Japanese hornwort, the effects of irradiation time on germination were also investigated. Tomato seed germination was delayed and Japanese hornwort seed germination was accelerated with increase in irradiation time beyond 2h per day. The emergence of tomato and Japanese hornwort covered with Shimokuriyagawa loam soil (Kuriyagawa soil) and vermiculite at depths of less than 5mm, 5-10mm and 10-15mm was observed. Plants emerged more rapidly from 5-10mm depths than from less than 5mm depth in tomato. The plants seeded at 10-15mm depths emerged as rapidly as those at 5-10mm depths using vermiculite but later than those at other depths using Kuriyagawa soil, probably due to high bulk density. The early emergence of Japanese hornwort was fastest from less than 5mm depth. The plants seeded at 5-10mm depths did not emerge much slower than those at less than 5mm depth. A seeding depth of 5-10mm was suitable for the rapid emergence of those vegetables covered with both the soil and vermiculite. (author)
Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups.
Directory of Open Access Journals (Sweden)
Salman Rahimi
Full Text Available Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus to 76 h (P. aviculare. Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; P<0.05. This study shows that management programs aiming to minimize weed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure.
International Nuclear Information System (INIS)
Du Zeji; Kong Xianrong
1999-01-01
Deinococcus radiodurans (Dr) possesses a prominent ability to repair the DNA injury induced by various DNA- damaging agents including mitomycin C(MC), ultraviolet light (UV) and ionizing radiation. DNA damage resistance was restored in MC sensitive (MC s ) mutants 2621 and 3021 by transforming with DNAs of four cosmids clones derived from the gene library of strain KD8301 which showed the property of wild type phenotype to DNA-damaging agents. Gene affected by mutation (mtcA or mtcB) in both mutants was cloned and its nucleotide sequence was determined. The deduced amino acid (aa) sequence of Dr uvrA gene product consists of 1016 aa and shares homology with many bacterial UvrA proteins. The mutation sites in both mutants were identified by analyzing the polymerase chain reaction (PCR) fragments derived from the genomic DNA of the mutants. A 144-base pairs (bp) deletion including the start codon for the uvr A gene was observed in DNA of the mutant 3021, causing a defect in the gene. On the other hand, an insertion sequence (IS) element intervened in the uvrA gene of the mutant 2621, suggesting the insertional inactivation of the gene. The IS element comprise 1322-bp long, flanked by 19-bp inverted terminal repeats (ITR), and generated a 6-bp target duplication (TD). Two open reading frames (ORF) were found in the IS element. The deduced aa sequences of large and small ORF show homology to a putative transposes found in IS4 of Escherichia coli (E. coli) and to a resolvent found in IS Xc5 of Xanthomonas campestris (Xc), respectively. This is the first discovery of IS element in deino-bacteria, and the IS element was designated IS2621
Lee, Min Woo; Rogers, Elizabeth E; Stenger, Drake C
2010-12-01
Xylella fastidiosa strain riv11 harbors a 25-kbp plasmid (pXF-RIV11) belonging to the IncP-1 incompatibility group. Replication and stability factors of pXF-RIV11 were identified and used to construct plasmids able to replicate in X. fastidiosa and Escherichia coli. Replication in X. fastidiosa required a 1.4-kbp region from pXF-RIV11 containing a replication initiation gene (trfA) and the adjacent origin of DNA replication (oriV). Constructs containing trfA and oriV from pVEIS01, a related IncP-1 plasmid of the earthworm symbiont Verminephrobacter eiseniae, also were competent for replication in X. fastidiosa. Constructs derived from pXF-RIV11 but not pVEIS01 replicated in Agrobacterium tumefaciens, Xanthomonas campestris, and Pseudomonas syringae. Although plasmids bearing replication elements from pXF-RIV11 or pVEIS01 could be maintained in X. fastidiosa under antibiotic selection, removal of selection resulted in plasmid extinction after 3 weekly passages. Addition of a toxin-antitoxin addiction system (pemI/pemK) from pXF-RIV11 improved plasmid stability such that >80 to 90% of X. fastidiosa cells retained plasmid after 5 weekly passages in the absence of antibiotic selection. Expression of PemK in E. coli was toxic for cell growth, but toxicity was nullified by coexpression of PemI antitoxin. Deletion of N-terminal sequences of PemK containing the conserved motif RGD abolished toxicity. In vitro assays revealed a direct interaction of PemI with PemK, suggesting that antitoxin activity of PemI is mediated by toxin sequestration. IncP-1 plasmid replication and stability factors were added to an E. coli cloning vector to constitute a stable 6.0-kbp shuttle vector (pXF20-PEMIK) suitable for use in X. fastidiosa.
Ye, Xuezhu; Xiao, Wendan; Zhang, Yongzhi; Zhao, Shouping; Wang, Gangjun; Zhang, Qi; Wang, Qiang
2015-06-01
There are increasing concerns on heavy metal contaminant in soils and vegetables. In this study, we investigated heavy metal pollution in vegetables and the corresponding soils in the main vegetable production regions of Zhejiang province, China. A total of 97 vegetable samples and 202 agricultural soil samples were analyzed for the concentrations of Cd, Pb, As, Hg, and Cr. The average levels of Cd, Pb, and Cr in vegetable samples [Chinese cabbage (Brassica campestris spp. Pekinensis), pakchoi (Brassica chinensis L.), celery (Apium graveolens), tomato (Lycopersicon esculentum), cucumber (Colletotrichum lagenarium), cowpea (Vigna unguiculata), pumpkin (Cucurbita pepo L.), and eggplant (Solanum melongena)] were 0.020, 0.048, and 0.043 mg kg(-1), respectively. The Pb and Cr concentrations in all vegetable samples were below the threshold levels of the Food Quality Standard (0.3 and 0.5 mg kg(-1), respectively), except that two eggplant samples exceeded the threshold levels for Cd concentrations (0.05 mg kg(-1)). As and Hg contents in vegetables were below the detection level (0.005 and 0.002 mg kg(-1), respectively). Soil pollution conditions were assessed in accordance with the Chinese Soil Quality Criterion (GB15618-1995, Grade II); 50 and 68 soil samples from the investigated area exceeded the maximum allowable contents for Cd and Hg, respectively. Simple correlation analysis revealed that there were significantly positive correlations between the metal concentrations in vegetables and the corresponding soils, especially for the leafy and stem vegetables such as pakchoi, cabbage, and celery. Bio-concentration factor values for Cd are higher than those for Pb and Cr, which indicates that Cd is more readily absorbed by vegetables than Pb and Cr. Therefore, more attention should be paid to the possible pollution of heavy metals in vegetables, especially Cd.
Pseudoxanthomonas koreensis sp. nov. and Pseudoxanthomonas daejeonensis sp. nov.
Yang, Deok-Chun; Im, Wan-Taek; Kim, Myung Kyum; Lee, Sung-Taik
2005-03-01
Gram-negative, non-spore-forming, rod-shaped bacteria, T7-09(T) and TR6-08(T), were isolated from soil from a ginseng field in South Korea and characterized to determine their taxonomic position. 16S rRNA gene sequence analysis showed that the two isolates shared 99.5 % sequence similarity. Strains T7-09(T) and TR6-08(T) were shown to belong to the Proteobacteria and showed the highest levels of sequence similarity to Pseudoxanthomonas broegbernensis DSM 12573(T) (98.1 %), Pseudoxanthomonas mexicana AMX 26B(T) (97.4-97.5 %), Pseudoxanthomonas japonensis 12-3(T) (96.5-96.6 %), Pseudoxanthomonas taiwanensis ATCC BAA-404(T) (95.7 %) and Xanthomonas campestris ATCC 33913(T) (96.3-96.5 %). The sequence similarity values with respect to any species with validly published names in related genera were less than 96.5 %. The detection of a quinone system with Q-8 as the predominant compound and a fatty acid profile with C(15 : 0) iso as the predominant acid supported the assignment of the novel isolates to the order 'Xanthomonadales'. The two isolates could be distinguished from the established species of the genus Pseudoxanthomonas by the presence of quantitative unsaturated fatty acid C(17 : 1) iso omega9c and by their unique biochemical profiles. The results of DNA-DNA hybridization clearly demonstrated that T7-09(T) and TR6-08(T) represent separate species. On the basis of these data, it is proposed that T7-09(T) (=KCTC 12208(T)=IAM 15116(T)) and TR6-08(T) (=KCTC 12207(T)=IAM 15115(T)) be classified as the type strains of two novel Pseudoxanthomonas species, for which the names Pseudoxanthomonas koreensis sp. nov. and Pseudoxanthomonas daejeonensis sp. nov., respectively, are proposed.
Sharma, R; Manhas, R K
2015-07-01
Camel is an important mode of transportation in the hot and hilly tracts of Shiwaliks of Kathua districts. The camel owners of the region lack the modern veterinary facilities and therefore depend heavily upon local treatments for the animal. This ethnoveterinary knowledge of plants is acquired by them from their forefathers and generally moves from one generation to another orally. The oral mode of transferring this valuable knowledge is vulnerable to erosion with the passage of time and generations. Ethnoveterinary information was collected by interviewing 38 camel keepers and traditional healers as per the questionnaire. The data collected was analysed quantitatively using three indices viz. use-value (UV), informant consensus factor (ICF), and fidelity level (Fl %). A total of 41 plants were found to be of ethnoveterinary importance in the present study. Herbs and trees (41.5% each) were the most used life forms. The most used plant part was fruit (27.9%). Rhizome, root and whole plant parts collectively contributed to 18.6%. Most of the ethnoveterinary practices (65.9%) used oral mode of medication. The values of UV and Fl (%) shows that the most important species for curing the ailing camels were Curcuma longa, Trachyspermum ammi, Brassica campestris, Tamarindus indica, Phyllanthus emblica, Cassia fistula, Eruca sativa, Plumbago zeylanica etc. The high values of ICF (0.91-0.99) show that the informants share the knowledge for the treatment of camels amongst themselves on regular basis. A good number of plants are utilised by the informants to cure camels. Most of the preparations used fruits and leaves. Only 18.6% of the practices required destructive collection and such species need sustainable use and conservation. Some of the species like Tamarindus indica, Cassia fistula, Eruca sativa, Albizia lebbeck and Citrus medica require further phytochemical and pharmacological studies. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Carolin Mayer
Full Text Available Habitat fragmentation can have severe effects on plant pollinator interactions, for example changing the foraging behaviour of pollinators. To date, the impact of plant population size on pollen collection by pollinators has not yet been investigated. From 2008 to 2010, we monitored nine bumble bee species (Bombus campestris, Bombus hortorum s.l., Bombus hypnorum, Bombus lapidarius, Bombus pascuorum, Bombus pratorum, Bombus soroensis, Bombus terrestris s.l., Bombus vestalis s.l. on Vaccinium uliginosum (Ericaceae in up to nine populations in Belgium ranging in size from 80 m(2 to over 3.1 ha. Bumble bee abundance declined with decreasing plant population size, and especially the proportion of individuals of large bumble bee species diminished in smaller populations. The most remarkable and novel observation was that bumble bees seemed to switch foraging behaviour according to population size: while they collected both pollen and nectar in large populations, they largely neglected pollen collection in small populations. This pattern was due to large bumble bee species, which seem thus to be more likely to suffer from pollen shortages in smaller habitat fragments. Comparing pollen loads of bumble bees we found that fidelity to V. uliginosum pollen did not depend on plant population size but rather on the extent shrub cover and/or openness of the site. Bumble bees collected pollen only from three plant species (V.uliginosum, Sorbus aucuparia and Cytisus scoparius. We also did not discover any pollination limitation of V. uliginosum in small populations. We conclude that habitat fragmentation might not immediately threaten the pollination of V. uliginosum, nevertheless, it provides important nectar and pollen resources for bumble bees and declining populations of this plant could have negative effects for its pollinators. The finding that large bumble bee species abandon pollen collection when plant populations become small is of interest when
Zheng, Shirui; Ma, Zhiyuan; Han, Haixia; Ye, Jianfeng; Wang, Ruwei; Cai, Sheng; Zhou, Hui; Yu, Lushan; Zeng, Su; Jiang, Huidi
2014-07-01
Flavonoids are a group of important naturally occurring polyphenolic compounds with a wide range of biological effects. In this study, a sensitive liquid chromatography tandem mass spectrometry method was developed to simultaneously determine multiple active flavonoids, including quercetin (Que), kaempferol (Kae), apigenin (Api), isorhamnetin (Iso), luteolin (Lut), and naringenin (Nar), in rat plasma. To achieve a satisfied peak shape and LC separation, formic acid with the concentration between 0.05 and 0.2%, or in some case 5%, was generally used to acidify the LC mobile phase in reported studies. Here we found that even 0.05% formic acid could lead to strong mass signal suppression, and the absence of formic acid could reverse the signal suppression but cause serious peak tailing. There is an irreconcilable contradiction between liquid chromatography (LC) and mass spectrometry (MS). In order to simultaneously satisfy LC and MS, LC mobile phase with 0.00075% formic acid and post column mobile phase adjustment with 0.0677% ammonium solution in isopropanol were applied. Compared with the conventional method with mobile phase containing 0.05% formic acid, the mass signal response of Que, Kae, Api, Iso, Lut, Nar, and Oka increased 26.2, 18.6, 13.6, 23.5, 17.5, 15.6 and 15.4 fold, respectively. In addition, the post column mobile phase addition exhibited the better peak shape for the reduction of analytes longitudinal diffusion. The method has been fully validated according to FDA guidelines within the linear range between 0.328 ng mL⁻¹ and 168 ng mL⁻¹, and successfully applied to a pilot pharmacokinetic study of rats after administering 5.43 g kg⁻¹ Pollen of Brassica campestris. Copyright © 2014 Elsevier B.V. All rights reserved.
Gramss, Gerhard; Bergmann, Hans
2007-08-01
Non-symbiotic soil microorganisms which have been expensively engineered or selected to support plant nutrition, control root diseases, degrade xenobiotic hydrocarbons, and repress or stimulate heavy metal uptake of plants fail to survive in target soils. This prompted studies into the role of chemistry and microbial pre-colonization of 23 top soils in long-term growth of basidiomycetes. Fungi are seen as auxiliary agents in soil remediation. Untreated soils (1.5 L) were colonized by lignocellulose preferring ground fungi such as Agaricus aestivalis, A. bisporus, A. campestris, A. edulis, A. macrocarpus, A. porphyrizon, Agrocybe dura, A. praecox, Clitocybe sp., Coprinus comatus, Lepista nuda, L. sordida, Macrolepiota excoriata, M. procera, Stropharia coronilla, and S. rugoso-annulata. Spawn mycelia of fairy-ring-type fungi such as Agaricus arvensis, A. fissuratus, A. langei, A. lanipes, A. pilatianus, Lyophyllum sp., and Marasmius oreades died back in contact with non-sterile soils. Fungal growth correlated positively with the soils' Ct Ca K Mg content and negatively with microbial CO2 evolution. Pasteurization and autoclaving increased mycelial growth and life span in soils pH 6.6-8.2. Growth of pH-sensitive but not of pH-tolerant fungi was inhibited on the Ca-deficient soils pH 4-4.4 (-5.6) and was not improved by autoclaving. The pretended fungistasis of acid soils to pH-sensitive fungi was controlled by N P K mineral (pH not altering) or organic (pH increasing) fertilizing as well as by neutralization with NaOH or CaCO3. Although microbial competition was mortal to 33% of the fungal mycelia inserted into natural unplanted soils, further seriously antifungal effects beyond those pretended by low pH conditions and shortage in mineral macronutrients were not identified.
Sendín, Lorena Noelia; Orce, Ingrid Georgina; Gómez, Rocío Liliana; Enrique, Ramón; Grellet Bournonville, Carlos Froilán; Noguera, Aldo Sergio; Vojnov, Adrián Alberto; Marano, María Rosa; Castagnaro, Atilio Pedro; Filippone, María Paula
2017-04-01
Transgenic expression of the pepper Bs2 gene confers resistance to Xanthomonas campestris pv. vesicatoria (Xcv) pathogenic strains which contain the avrBs2 avirulence gene in susceptible pepper and tomato varieties. The avrBs2 gene is highly conserved among members of the Xanthomonas genus, and the avrBs2 of Xcv shares 96% homology with the avrBs2 of Xanthomonas citri subsp. citri (Xcc), the causal agent of citrus canker disease. A previous study showed that the transient expression of pepper Bs2 in lemon leaves reduced canker formation and induced plant defence mechanisms. In this work, the effect of the stable expression of Bs2 gene on citrus canker resistance was evaluated in transgenic plants of Citrus sinensis cv. Pineapple. Interestingly, Agrobacterium-mediated transformation of epicotyls was unsuccessful when a constitutive promoter (2× CaMV 35S) was used in the plasmid construction, but seven transgenic lines were obtained with a genetic construction harbouring Bs2 under the control of a pathogen-inducible promoter, from glutathione S-transferase gene from potato. A reduction of disease symptoms of up to 70% was observed in transgenic lines expressing Bs2 with respect to non-transformed control plants. This reduction was directly dependent on the Xcc avrBs2 gene since no effect was observed when a mutant strain of Xcc with a disruption in avrBs2 gene was used for inoculations. Additionally, a canker symptom reduction was correlated with levels of the Bs2 expression in transgenic plants, as assessed by real-time qPCR, and accompanied by the production of reactive oxygen species. These results indicate that the pepper Bs2 resistance gene is also functional in a family other than the Solanaceae, and could be considered for canker control.
Energy Technology Data Exchange (ETDEWEB)
Goblirsch, Brandon R.; Jensen, Matthew R.; Mohamed, Fatuma A.; Wackett, Lawrence P.; Wilmot, Carrie M.
2016-11-04
Phylogenetically diverse microbes that produce long chain, olefinic hydrocarbons have received much attention as possible sources of renewable energy biocatalysts. One enzyme that is critical for this process is OleA, a thiolase superfamily enzyme that condenses two fatty acyl-CoA substrates to produce a β-ketoacid product and initiates the biosynthesis of long chain olefins in bacteria. Thiolases typically utilize a ping-pong mechanism centered on an active site cysteine residue. Reaction with the first substrate produces a covalent cysteine-thioester tethered acyl group that is transferred to the second substrate through formation of a carbon-carbon bond. Although the basics of thiolase chemistry are precedented, the mechanism by which OleA accommodates two substrates with extended carbon chains and a coenzyme moiety—unusual for a thiolase—are unknown. Gaining insights into this process could enable manipulation of the system for large scale olefin production with hydrocarbon chains lengths equivalent to those of fossil fuels. In this study, mutagenesis of the active site cysteine in Xanthomonas campestris OleA (Cys143) enabled trapping of two catalytically relevant species in crystals. In the resulting structures, long chain alkyl groups (C12 and C14) and phosphopantetheinate define three substrate channels in a T-shaped configuration, explaining how OleA coordinates its two substrates and product. The C143A OleA co-crystal structure possesses a single bound acyl-CoA representing the Michaelis complex with the first substrate, whereas the C143S co-crystal structure contains both acyl-CoA and fatty acid, defining how a second substrate binds to the acyl-enzyme intermediate. An active site glutamate (Gluβ117) is positioned to deprotonate bound acyl-CoA and initiate carbon-carbon bond formation.
Goblirsch, Brandon R; Jensen, Matthew R; Mohamed, Fatuma A; Wackett, Lawrence P; Wilmot, Carrie M
2016-12-23
Phylogenetically diverse microbes that produce long chain, olefinic hydrocarbons have received much attention as possible sources of renewable energy biocatalysts. One enzyme that is critical for this process is OleA, a thiolase superfamily enzyme that condenses two fatty acyl-CoA substrates to produce a β-ketoacid product and initiates the biosynthesis of long chain olefins in bacteria. Thiolases typically utilize a ping-pong mechanism centered on an active site cysteine residue. Reaction with the first substrate produces a covalent cysteine-thioester tethered acyl group that is transferred to the second substrate through formation of a carbon-carbon bond. Although the basics of thiolase chemistry are precedented, the mechanism by which OleA accommodates two substrates with extended carbon chains and a coenzyme moiety-unusual for a thiolase-are unknown. Gaining insights into this process could enable manipulation of the system for large scale olefin production with hydrocarbon chains lengths equivalent to those of fossil fuels. In this study, mutagenesis of the active site cysteine in Xanthomonas campestris OleA (Cys 143 ) enabled trapping of two catalytically relevant species in crystals. In the resulting structures, long chain alkyl groups (C 12 and C 14 ) and phosphopantetheinate define three substrate channels in a T-shaped configuration, explaining how OleA coordinates its two substrates and product. The C143A OleA co-crystal structure possesses a single bound acyl-CoA representing the Michaelis complex with the first substrate, whereas the C143S co-crystal structure contains both acyl-CoA and fatty acid, defining how a second substrate binds to the acyl-enzyme intermediate. An active site glutamate (Gluβ 117 ) is positioned to deprotonate bound acyl-CoA and initiate carbon-carbon bond formation. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Goblirsch, Brandon R.; Jensen, Matthew R.; Mohamed, Fatuma A.; Wackett, Lawrence P.; Wilmot, Carrie M.
2016-01-01
Phylogenetically diverse microbes that produce long chain, olefinic hydrocarbons have received much attention as possible sources of renewable energy biocatalysts. One enzyme that is critical for this process is OleA, a thiolase superfamily enzyme that condenses two fatty acyl-CoA substrates to produce a β-ketoacid product and initiates the biosynthesis of long chain olefins in bacteria. Thiolases typically utilize a ping-pong mechanism centered on an active site cysteine residue. Reaction with the first substrate produces a covalent cysteine-thioester tethered acyl group that is transferred to the second substrate through formation of a carbon-carbon bond. Although the basics of thiolase chemistry are precedented, the mechanism by which OleA accommodates two substrates with extended carbon chains and a coenzyme moiety—unusual for a thiolase—are unknown. Gaining insights into this process could enable manipulation of the system for large scale olefin production with hydrocarbon chains lengths equivalent to those of fossil fuels. In this study, mutagenesis of the active site cysteine in Xanthomonas campestris OleA (Cys143) enabled trapping of two catalytically relevant species in crystals. In the resulting structures, long chain alkyl groups (C12 and C14) and phosphopantetheinate define three substrate channels in a T-shaped configuration, explaining how OleA coordinates its two substrates and product. The C143A OleA co-crystal structure possesses a single bound acyl-CoA representing the Michaelis complex with the first substrate, whereas the C143S co-crystal structure contains both acyl-CoA and fatty acid, defining how a second substrate binds to the acyl-enzyme intermediate. An active site glutamate (Gluβ117) is positioned to deprotonate bound acyl-CoA and initiate carbon-carbon bond formation. PMID:27815501
Li, Le; Miao, Weiguo; Liu, Wenbo; Zhang, Shujian
2017-01-01
Harpins, encoded by hrp (hypersensitive response and pathogenicity) genes of Gram-negative plant pathogens, are elicitors of hypersensitive response (HR). HpaXm is a novel harpin-like protein described from cotton leaf blight bacteria, Xanthomonas citri subsp. malvacearum-a synonym of X. campestris pv. malvacearum (Smith 1901-1978). A putative signal peptide (1-MNSLNTQIGANSSFL-15) of hpaXm was predicted in the nitroxyl-terminal (N-terminal)by SignalP (SignalP 3.0 server). Here, we explored the function of the N-terminal leader peptide like segment of hpaXm using transgenic tobacco (Nicotiana tabacum cv. Xanthi nc.). Transgenic tobacco lines expressing the full-length hpaXm and the signal peptide-like segment-deleted mutant hpaXmΔLP were developed using transformation mediated by Agrobacterium tumefaciens. The target genes were confirmed integrated into the tobacco genomes and expressed normally. Using immune colloidal-gold detection technique, hpaXm protein was found to be transferred to the cytoplasm, the cell membrane, and organelles such as chloroplasts, mitochondria, and nucleus, as well as the cell wall. However, the deletion mutant hpaXmΔLP expressed in transgenic tobacco was found unable to cross the membrane to reach the cell wall. Additionally, soluble proteins extracted from plants transformed with hpaXm and hpaXmΔLP were bio-active. Defensive micro-HR induced by the transgene expression of hpaXm and hpaXmΔLP were observed on transgenic tobacco leaves. Disease resistance bioassays to tobacco mosaic virus (TMV) showed that tobacco plants transformed with hpaXm and with hpaXmΔLP exhibited enhanced resistance to TMV. In summary, the N-terminal signal peptide-like segment (1-45 bp) in hpaXm sequence is not necessary for transgene expression, bioactivity of hpaXm and resistance to TMV in transgenic tobacco, but is required for the protein to be translocated to the cell wall.
Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups.
Rahimi, Salman; Mashhadi, Hamid Rahimian; Banadaky, Mehdi Dehghan; Mesgaran, Mohsen Beheshtian
2016-01-01
Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus) to 76 h (P. aviculare). Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; Pweed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure.
Kim, Nak Hyun; Hwang, Byung Kook
2015-01-01
Xanthomonas campestris pv. vesicatoria (Xcv) type III effector AvrBsT triggers programmed cell death (PCD) and activates the hypersensitive response (HR) in plants. Here, we isolated and identified the plasma membrane localized pathogenesis-related (PR) protein 4c gene (CaPR4c) from pepper (Capsicum annuum) leaves undergoing AvrBsT-triggered HR cell death. CaPR4c encodes a protein with a signal peptide and a Barwin domain. Recombinant CaPR4c protein expressed in Escherichia coli exhibited cysteine protease-inhibitor activity and ribonuclease (RNase) activity. Subcellular localization analyses revealed that CaPR4c localized to the plasma membrane in plant cells. CaPR4c expression was rapidly and specifically induced by avirulent Xcv (avrBsT) infection. Transient expression of CaPR4c caused HR cell death in pepper leaves, which was accompanied by enhanced accumulation of H2 O2 and significant induction of some defense-response genes. Deletion of the signal peptide from CaPR4c abolished the induction of HR cell death, indicating a requirement for plasma membrane localization of CaPR4c for HR cell death. CaPR4c silencing in pepper disrupted both basal and AvrBsT-triggered resistance responses, and enabled Xcv proliferation in infected leaves. H2 O2 accumulation, cell-death induction, and defense-response gene expression were distinctly reduced in CaPR4c-silenced pepper. CaPR4c overexpression in transgenic Arabidopsis plants conferred greater resistance against infection by Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis. These results collectively suggest that CaPR4c plays an important role in plant cell death and defense signaling. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Abi S.A. Marques
2008-01-01
Full Text Available The phenotypic characteristics and genetic fingerprints of a collection of 120 bacterial strains, belonging to Pseudomonas syringae sensu lato group, P. viridiflava and reference bacteria were evaluated, with the aim of species identification. The numerical analysis of 119 nutritional characteristics did not show patterns that would help with identification. Regarding the genetic fingerprinting, the results of the present study supported the observation that BOX-PCR seems to be able to identify bacterial strains at species level. After numerical analyses of the bar-codes, all pathovars belonging to each one of the nine described genomospecies were clustered together at a distance of 0.72, and could be separated at genomic species level. Two P. syringae strains of unknown pathovars (CFBP 3650 and CFBP 3662 and the three P. syringae pv. actinidiae strains were grouped in two extra clusters and might eventually constitute two new species. This genomic species clustering was particularly evident for genomospecies 4, which gathered P. syringae pvs. atropurpurea, coronafaciens, garçae, oryzae, porri, striafaciens, and zizaniae at a noticeably low distance.
Bender, C L; Palmer, D A; Peñaloza-Vázquez, A; Rangaswamy, V; Ullrich, M
1998-01-01
Many P. syringae pathovars are known to produce low-molecular-weight, diffusible toxins in infected host plants. These phytotoxins reproduce some of the symptoms of the relevant bacterial disease and are effective at very low concentrations. Phytotoxins generally enhance the virulence of the P. syringae pathovar which produces them, but are not required for pathogenesis. Genes encoding phytotoxin production have been identified and cloned from several P. syringae pathovars. With the exception of coronatine, toxin biosynthetic gene clusters are generally chromosomally encoded. In several pathovars, the toxin biosynthetic gene cluster also contains a resistance gene which functions to protect the producing strain from the biocidal effects of the toxin. In the case of phaseolotoxin, a resistance gene (argK) has been utilized to engineer phaseolotoxin-resistant tobacco plants. Although P. syringae phytotoxins can induce very similar effects in plants (chlorosis and necrosis), their biosynthesis and mode of action can be quite different. Knowledge of the biosynthetic pathways to these toxins and the cloning of the structural genes for their biosynthesis has relevance to the development of new bioactive compounds with altered specificity. For example, polyketides constitute a huge family of structurally diverse natural products including antibiotics, chemotherapeutic compounds, and antiparasitics. Most of the research on polyketide synthesis in bacteria has focused on compounds synthesized by Streptomyces or other actinomycetes. It is also important to note that it is now possible to utilize a genetic rather than synthetic approach to biosynthesize novel polyketides with altered biological properties (Hutchinson and Fujii, 1995; Kao et al., 1994; Donadio et al., 1993; Katz and Donadio, 1993). Most of the reprogramming or engineering of novel polyketides has been done using actinomycete PKSs, but much of this technology could also be applied to polyketides synthesized by
Directory of Open Access Journals (Sweden)
Shampa Dutta
2017-12-01
Full Text Available A field experiment had been carried out in the Crop Research and Seed Multiplication Farm of The University of Burdwan, West Bengal, India during the two consecutive winter seasons of 2011-2012 and 2012-2013 to study the effect of indigenous rhizospheric bacterial strains on growth, physiology and yield of mustard variety. Pseudomonas putida, Burkholderia cepacia, Burkholderia sp. and their mixture were used as seed inoculants for mustard cultivation. The experiment was laid down in a randomized complete block design (RCBD with three replications. Results revealed that indigenous inoculation (with reduced dose of chemical fertilizer significantly increased (p < 0.05 the yield of mustard as compared to uninoculated control (full recommended dose of NPK fertilizers. A combination treatment of biofertilizer and chemical fertilizer also increased plant height, plant biomass and other yield components compared to control. The comprehensive approach of plant growth promoting rhizobacteria (PGPR in agriculturally important crops should be carried out to explore the hidden potential of PGPR and to promote the quality and yield of crop under field conditions. Keywords: Indigenous rhizobacteria, Mustard, PGPR, Yield
Directory of Open Access Journals (Sweden)
R Nasri
2016-02-01
Full Text Available Introduction There are about 160 species in Brassica genus, which are mostly annuals and biennials. The plants in this genus have potential for fodder uses. The progress in plant breeding science has produced new crop varieties for oil and forage usages. Perko varieties are derived from crosses between tetraploid plants of winter rapeseed (Brassica napus L.Var. napus and Chinese cabbage (Brassica campestris L. var. sensulato. The new plants are superior to their parents from various aspects. Buko varieties are new amphiploid plants obtained by crossing between tetraploid winter rapeseed, Chinese cabbage and turnips (Brassica campestris L. var. Rapa. Oilseed radish with scientific name (Raphanus sativus L. is a genus of the Brassica and consumption, oil, green manure, feed and fodder (24. This plant in many countries, including Canada, is cultivated in gardens as cover crop. Oilseed radish grows fast in the cool seasons. Ramtil (Guizotia abyssinica belongs to the Compositae family, Phasilia (Phaceli atanacetifolia L. belongs to Boraginaceae family and clover is from Fabaceae family that is grown for feeding purposes. Materials and Methods A field experiment was conducted from 2011 to 2012 in the Karezan region of Ilam, Iran (42º33′N, 33º46′E on a silty-clay with low organic carbon (1.26% and slightly alkaline soil (pH=7.9. This site is characterized as temperate climate with 370 mm annual precipitation. The experiment was arranged in a split plot based on randomized complete block design with four replications. The main plots consisted of 6 pre-sowing plant treatments (control, Perko PVH, Buko, Clover and Oilseed radish and combination of three plants Ramtil, Phaselia andclover, and sub plots covered four N fertilizer rates including no fertilizer N (Control, 50% lower than recommended N rate, recommended N rate and 50% more than recommended N rate. Winter wheat (cv. Pishtaz was sown on mid-November with the row spacing of 15 cm and a
Wang, Jun; Zeng, Xuan; Tian, Dongsheng; Yang, Xiaobei; Wang, Lanlan; Yin, Zhongchao
2018-03-30
Transcription activator-like effector (TALE)-dependent dominant disease resistance (R) genes in plants, also referred to as executor R genes, are induced on infection by phytopathogenic bacteria of the genus Xanthomonas harbouring the corresponding TALE genes. Unlike the traditional R proteins, the executor R proteins do not determine the resistance specificity and may function broadly in different plant species. The executor R gene Bs4C-R in the resistant genotype PI 235047 of the pepper species Capsicum pubescens (CpBs4C-R) confers disease resistance to Xanthomonas campestris pv. vesicatoria (Xcv) harbouring the TALE genes avrBsP/avrBs4. In this study, the synthetic genes of CpBs4C-R and two other Bs4C-like genes, the susceptible allele in the genotype PI585270 of C. pubescens (CpBs4C-S) and the CaBs4C-R homologue gene in the cultivar 'CM334' of Capsicum annum (CaBs4C), were characterized in tobacco (Nicotiana benthamiana) and rice (Oryza sativa). The Bs4C genes induced cell death in N. benthamiana. The functional Bs4C-eCFP fusion proteins were localized to the endoplasmic reticulum (ER) membrane in the leaf epidermal cells of N. benthamiana. The Xa10 promoter-Bs4C fusion genes in transgenic rice conferred strain-specific disease resistance to Xanthomonas oryzae pv. oryzae (Xoo), the causal agent of bacterial blight in rice, and were specifically induced by the Xa10-incompatible Xoo strain PXO99 A (pHM1avrXa10). The results indicate that the Bs4C proteins from pepper species function broadly in rice and the Bs4C protein-mediated cell death from the ER is conserved between dicotyledonous and monocotyledonous plants, which can be utilized to engineer novel and enhanced disease resistance in heterologous plants. © 2018 TEMASEK LIFE SCIENCES LABORATORY. MOLECULAR PLANT PATHOLOGY © 2018 JOHN WILEY & SONS LTD.
Directory of Open Access Journals (Sweden)
Karasiński Dariusz
2015-12-01
Full Text Available The Białowieża Forest (BF is one of the best-preserved lowland deciduous and mixed forest complexes in Europe, rich in diverse fungi. This paper summarizes what is known about the poroid fungi of the Polish part of the Białowieża Forest, based on literature data, a re-examination of herbarium materials, and the authors’ studies from 1990–2014. An annotated catalogue of polypores recorded in the forest is presented, including 80 genera with 210 species. All literature and herbarium records are enumerated, and 160 species are illustrated with color pictures. Fourteen species previously reported in the literature have uncertain status because they lack voucher specimens and were not confirmed in recent field studies. Antrodiella subradula (Pilát Niemelä & Miettinen, previously known from Asia, is reported for the first time from Europe. Fourteen species are newly reported from the Białowieża Forest (mainly from Białowieża National Park, including 8 species with first records in Poland (Antrodia hyalina Spirin, Miettinen & Kotir., Antrodia infirma Renvall & Niemelä, Antrodiella subradula, Junghuhnia fimbriatella (Peck Ryvarden, Postia folliculocystidiata (Kotl. & Vampola Niemelä & Vampola, Postia minusculoides (Pilát ex Pilát Boulet, Skeletocutis chrysella Niemelä, Skeletocutis papyracea A. David, and 6 species reported previously from other localities in Poland [Antrodiella faginea Vampola & Pouzar, Dichomitus campestris (Quél. Domański & Orlicz, Loweomyces fractipes (Berk. & M. A. Curtis Jülich, Oxyporus latemarginatus (Durieu & Mont. Donk, Perenniporia narymica (Pilát Pouzar, Phellinus nigricans (Fr. P. Karst.]. Several very rare European polypores already reported from the Białowieża Forest in the 20th century, such as Antrodia albobrunnea (Romell Ryvarden, Antrodiella foliaceodentata (Nikol. Gilb. & Ryvarden, Buglossoporus pulvinus (Pers. Donk, Dichomitus albidofuscus (Domański Domański and Gelatoporia subvermispora
Elshafie, Hazem Salaheldin; Ghanney, Nadia; Mang, Stefania Mirela; Ferchichi, Ali; Camele, Ippolito
2016-03-01
Growing concerns about food safety and environmental protection enhanced the need for new and safe plant disease control strategies. The chemical composition of the three essential oils (EOs) extracted from leaves and fruits of Schinus terebinthifolius and leaves of Schinus molle, growing in Tunisia, was studied by GC and GC-MS. In all, 12 compounds were identified. The oils were mainly composed of terpene compounds. α-Pinene, α-phellandrene, and D-limonene were the major constituents. The aim of the current study was to evaluate the in vitro antimicrobial effectiveness of three EOs derived from plants of genus Schinus and extracted from leaves and fruits of S. terebinthifolius and leaves of S. molle. Both antifungal and antibacterial activities of the EOs were examined. The antifungal activity of the studied EOs was investigated against Colletotrichum acutatum and Botrytis cinerea in comparison with the systemic fungicide azoxystrobin used at 0.8 μL mL(-1). The antibacterial activity was evaluated against three strains of Gram-positive (G+ve) bacteria (Bacillus megaterium, Bacillus mojavensis and Clavibacter michiganensis) and four strains of Gram-negative (G-ve) bacteria (Escherichia coli, Xanthomonas campestris, Pseudomonas savastanoi, and Pseudomonas syringae pv. phaseolicola) compared with the synthetic antibiotic tetracycline at a concentration of 1600 μg mL(-1). The minimum inhibitory concentration of the studied EOs has been evaluated against the above microorganisms using the 96-well microplate method. Tested microorganisms exhibited different levels of sensitivity to each tested EO. All investigated EOs reduced the fungal mycelial growth when used at low concentrations from 250 to 1000 ppm and from 2000 to 8000 ppm against C. acutatum and B. cinerea, respectively. Higher concentrations of the same EOs exhibited a fungicidal effect against both mitosporic fungi. The EO extracted from leaves of S. terebinthifolius significantly inhibited the growth
Analysis of supercooling activity of tannin-related polyphenols.
Kuwabara, Chikako; Wang, Donghui; Endoh, Keita; Fukushi, Yukiharu; Arakawa, Keita; Fujikawa, Seizo
2013-08-01
Based on the discovery of novel supercooling-promoting hydrolyzable gallotannins from deep supercooling xylem parenchyma cells (XPCs) in Katsura tree (see Wang et al. (2012) [38]), supercooling capability of a wide variety of tannin-related polyphenols (TRPs) was examined in order to find more effective supercooling-promoting substances for their applications. The TRPs examined were single compounds including six kinds of hydrolyzable tannins, 11 kinds of catechin derivatives, two kinds of structural analogs of catechin and six kinds of phenolcarboxylic acid derivatives, 11 kinds of polyphenol mixtures and five kinds of crude plant tannin extracts. The effects of these TRPs on freezing were examined by droplet freezing assays using various solutions containing different kinds of identified ice nucleators such as the ice nucleation bacterium (INB) Erwinia ananas, the INB Xanthomonas campestris, silver iodide and phloroglucinol as well as a solution containing only unintentionally included unidentified airborne ice nucleators. Among the 41 kinds of TRPs examined, all of the hydrolyzable tannins, catechin derivatives, polyphenol mixtures and crude plant tannin extracts as well as a few structural analogs of catechin and phenolcarboxylic acid derivatives exhibited supercooling-promoting activity (SCA) with significant differences (p>0.05) from at least one of the solutions containing different kinds of ice nucleators. It should be noted that there were no TRPs exhibiting ice nucleation-enhancing activity (INA) in all solutions containing identified ice nucleators, whereas there were many TRPs exhibiting INA with significant differences in solutions containing unidentified ice nucleators alone. An emulsion freezing assay confirmed that these TRPs did not essentially affect homogeneous ice nucleation temperatures. It is thought that not only SCA but also INA in the TRPs are produced by interactions with heterogeneous ice nucleators, not by direct interaction with water
Riparian Vegetation Mapping Along the Hanford Reach
International Nuclear Information System (INIS)
FOGWELL, T.W.
2003-01-01
During the biological survey and inventory of the Hanford Site conducted in the mid-1990s (1995 and 1996), preliminary surveys of the riparian vegetation were conducted along the Hanford Reach. These preliminary data were reported to The Nature Conservancy (TNC), but were not included in any TNC reports to DOE or stakeholders. During the latter part of FY2001, PNNL contracted with SEE Botanical, the parties that performed the original surveys in the mid 1990s, to complete the data summaries and mapping associated with the earlier survey data. Those data sets were delivered to PNNL and the riparian mapping by vegetation type for the Hanford Reach is being digitized during the first quarter of FY2002. These mapping efforts provide the information necessary to create subsequent spatial data layers to describe the riparian zone according to plant functional types (trees, shrubs, grasses, sedges, forbs). Quantification of the riparian zone by vegetation types is important to a number of DOE'S priority issues including modeling contaminant transport and uptake in the near-riverine environment and the determination of ecological risk. This work included the identification of vegetative zones along the Reach by changes in dominant plant species covering the shoreline from just to the north of the 300 Area to China Bar near Vernita. Dominant and indicator species included Agropyron dasytachyudA. smithii, Apocynum cannabinum, Aristida longiseta, Artemisia campestris ssp. borealis var scouleriana, Artemisa dracunculus, Artemisia lindleyana, Artemisia tridentata, Bromus tectorum, Chrysothamnus nauseosus, Coreopsis atkinsoniana. Eleocharis palustris, Elymus cinereus, Equisetum hyemale, Eriogonum compositum, Juniperus trichocarpa, Phalaris arundinacea, Poa compressa. Salk exigua, Scirpus acutus, Solidago occidentalis, Sporobolus asper,and Sporobolus cryptandrus. This letter report documents the data received, the processing by PNNL staff, and additional data gathered in FY2002
Zheng, Shun-An; Wu, Zeying; Chen, Chun; Liang, Junfeng; Huang, Hongkun; Zheng, Xiangqun
2018-01-01
Mercury (Hg) can evaporate and enter the plants through the stomata of plant leaves, which will cause a serious threat to local food safety and human health. For the risk assessment, this study aimed to investigate the concentration and accumulation of total gaseous mercury (TGM) in five typical leafy vegetables (Chinese chives (Allium tuberosum Rottler), amaranth (Amaranthus mangostanus L.), rape (Brassica campestris L.), lettuce (Lactuca sativa L.), and spinach (Spinacia oleracea L.)) grown on sewage-irrigated areas in Tianjin, China. The following three sites were chosen to biomonitor Hg pollution: a paddy field receiving sewage irrigation (industrial and urban sewage effluents) for the last 30 years, a vegetable field receiving sewage irrigation for 15 years, and a grass field which did not receive sewage irrigation in history. Results showed that the total Hg levels in the paddy (0.65 mg kg -1 ) and vegetation fields (0.42 mg kg -1 ) were significantly higher than the local background level (0.073 mg kg -1 ) and the China national soil environment quality standard for Hg in grade I (0.30 mg kg -1 ). The TGM levels in ambient air were significantly higher in the paddy (71.3 ng m -3 ) and vegetable fields (39.2 ng m -3 ) relative to the control (9.4 ng m -3 ) and previously reported levels (1.45 ng m -3 ), indicating severe Hg pollution in the atmospheric environment of the sewage-irrigated areas. Furthermore, gaseous mercury was the dominant form of Hg uptake in the leaves or irreversibly bound to leaves. The comparison of Hg uptake levels among the five vegetables showed that the gradient of Hg accumulation followed the order spinach > red amaranth > Chinese chives > rape > lettuce. These results suggest that gaseous Hg exposure in the sewage-irrigated areas is a dominant Hg uptake route in leafy vegetables and may pose a potential threat to agricultural food safety and human health.
Riparian Vegetation Mapping Along the Hanford Reach
Energy Technology Data Exchange (ETDEWEB)
FOGWELL, T.W.
2003-07-11
During the biological survey and inventory of the Hanford Site conducted in the mid-1990s (1995 and 1996), preliminary surveys of the riparian vegetation were conducted along the Hanford Reach. These preliminary data were reported to The Nature Conservancy (TNC), but were not included in any TNC reports to DOE or stakeholders. During the latter part of FY2001, PNNL contracted with SEE Botanical, the parties that performed the original surveys in the mid 1990s, to complete the data summaries and mapping associated with the earlier survey data. Those data sets were delivered to PNNL and the riparian mapping by vegetation type for the Hanford Reach is being digitized during the first quarter of FY2002. These mapping efforts provide the information necessary to create subsequent spatial data layers to describe the riparian zone according to plant functional types (trees, shrubs, grasses, sedges, forbs). Quantification of the riparian zone by vegetation types is important to a number of DOE'S priority issues including modeling contaminant transport and uptake in the near-riverine environment and the determination of ecological risk. This work included the identification of vegetative zones along the Reach by changes in dominant plant species covering the shoreline from just to the north of the 300 Area to China Bar near Vernita. Dominant and indicator species included Agropyron dasytachyudA. smithii, Apocynum cannabinum, Aristida longiseta, Artemisia campestris ssp. borealis var scouleriana, Artemisa dracunculus, Artemisia lindleyana, Artemisia tridentata, Bromus tectorum, Chrysothamnus nauseosus, Coreopsis atkinsoniana. Eleocharis palustris, Elymus cinereus, Equisetum hyemale, Eriogonum compositum, Juniperus trichocarpa, Phalaris arundinacea, Poa compressa. Salk exigua, Scirpus acutus, Solidago occidentalis, Sporobolus asper,and Sporobolus cryptandrus. This letter report documents the data received, the processing by PNNL staff, and additional data gathered in FY
Cardinal Temperatures of Brassica sp. and How to Determine It
Directory of Open Access Journals (Sweden)
D. K. SUANDA SUANDA
2013-08-01
Full Text Available Cardinal temperatures consist of minimum, optimum and maximum of plant growth, and might beable to be determined by assessing effect of temperature on seed germination. An experiment ofseed germination was conducted in laboratory, using thermal gradient plate for ten days. To test hypothesisthat rapeseed genotypes vary in their response to temperatures. The design of this experiment was asplit plot with four replications. The main-treatments were 14 different temperatures: 0.4°C, 3.3°C,7.8°C, 11.6°C, 13.3°C, 15.0°C, 16.8°C, 18.3°C, 20.9°C, 21.1°C, 25.6°C, 29.0°C, 33.0°C and36.3°C. Sub-treatments were 6 brassica genotypes: Brassica napus genotypes (Tatyoon and Marnoo;B. campestris (Jumbuck and Chinoli B; B. juncea (No. 81797 and Zero Erusic Mustard (ZEM 2.Each treatment was using 50 seeds. Germinations were observed daily for ten days and data wereanalyzed with regression and correlation. Genotypes responded differently to temperatures with Jumbuckthe most sensitive to low temperature with minimum temperature (7.90°C, then respectively followedby Chinoli B (6.36°C, ZEM 2 (4.77°C, Tatyoon (4.63°C, No. 81797 (2.59°C, and Marnoo(1.00°C. For high temperature the most sensitive was No. 81797 with maximum temperature 38.61°C.and then respectively followed by Marnoo (39.76°C, Chinoli B (42.93°C, Tatyoon (43.79°C,Jumbuck (44.58°C and ZEM 2 (45.88°C. Optimum temperatures were for Jumbuck was 24.56°C,ZEM 2 (26.95°C, Tatyoon (27.12°C, No. 81797 (28.12°C, Chinoli B (29.74°C and Marnoo(30.48°C.
Ulicsni, Viktor; Svanberg, Ingvar; Molnár, Zsolt
2016-10-11
There is scarce information about European folk knowledge of wild invertebrate fauna. We have documented such folk knowledge in three regions, in Romania, Slovakia and Croatia. We provide a list of folk taxa, and discuss folk biological classification and nomenclature, salient features, uses, related proverbs and sayings, and conservation. We collected data among Hungarian-speaking people practising small-scale, traditional agriculture. We studied "all" invertebrate species (species groups) potentially occurring in the vicinity of the settlements. We used photos, held semi-structured interviews, and conducted picture sorting. We documented 208 invertebrate folk taxa. Many species were known which have, to our knowledge, no economic significance. 36 % of the species were known to at least half of the informants. Knowledge reliability was high, although informants were sometimes prone to exaggeration. 93 % of folk taxa had their own individual names, and 90 % of the taxa were embedded in the folk taxonomy. Twenty four species were of direct use to humans (4 medicinal, 5 consumed, 11 as bait, 2 as playthings). Completely new was the discovery that the honey stomachs of black-coloured carpenter bees (Xylocopa violacea, X. valga) were consumed. 30 taxa were associated with a proverb or used for weather forecasting, or predicting harvests. Conscious ideas about conserving invertebrates only occurred with a few taxa, but informants would generally refrain from harming firebugs (Pyrrhocoris apterus), field crickets (Gryllus campestris) and most butterflies. We did not find any mythical creatures among invertebrate folk taxa. Almost every invertebrate species was regarded as basically harmful. Where possible, they were destroyed or at least regarded as worth eradicating. However, we could find no evidence to suggest any invertebrate species had suffered population loss as a result of conscious destruction. Sometimes knowledge pertaining to the taxa could have more
ROLL, Rutilene Jacondino
2005-01-01
Entre o vasto número de tipos de polissacarídeos produzidos naturalmente, por plantas, algas e bactérias, xantana é um dos poucos que tem propriedades funcionais com amplo espectro de uso bem como produção industrial em grande escala. É o segundo biopolímero a ser desenvolvido por um processo economicamente viável, e continua a ser o mais importante biopolímero na aplicação em alimentos devido às suas propriedades funcionais. As propriedades químicas e físicas da xantana com...
Ott, Mark; Yang, J; Barilla, J.; Crabbe, A.; Sarker, S. F.; Liu, Y.
2017-01-01
Three-dimensional/3-D organotypic models of human intestinal epithelium mimic the differentiated form and function of parental tissues often not exhibited by 2-D monolayers and respond to Salmonella in ways that reflect in vivo infections. To further enhance the physiological relevance of 3-D models to more closely approximate in vivo intestinal microenvironments during infection, we developed and validated a novel 3-D intestinal co-culture model containing multiple epithelial cell types and phagocytic macrophages, and applied to study enteric infection by different Salmonella pathovars.
Energy Technology Data Exchange (ETDEWEB)
Feil, Helene; Feil, William S.; Chain, Patrick; Larimer, Frank; DiBartolo, Genevieve; Copeland, Alex; Lykidis, Athanasios; Trong,Stephen; Nolan, Matt; Goltsman, Eugene; Thiel, James; Malfatti,Stephanie; Loper, Joyce E.; Lapidus, Alla; Detter, John C.; Land, Miriam; Richardson, Paul M.; Kyrpides, Nikos C.; Ivanova, Natalia; Lindow, StevenE.
2005-04-01
The complete genomic sequence of Pseudomonas syringaepathovar syringae B728a (Pss B728a), has been determined and is comparedwith that of Pseudomonas syringae pv. tomato DC3000 (Pst DC3000). Thesetwo pathovars of this economically important species of plant pathogenicbacteria differ in host range and apparent patterns of interaction withplants, with Pss having a more pronounced epiphytic stage of growth andhigher abiotic stress tolerance and Pst DC3000 having a more pronouncedapoplastic growth habitat. The Pss B728a genome (6.1 megabases) containsa circular chromosome and no plasmid, whereas the Pst DC3000 genome is6.5 mbp in size, composed of a circular chromosome and two plasmids.While a high degree of similarity exists between the two sequencedPseudomonads, 976 protein-encoding genes are unique to Pss B728a whencompared to Pst DC3000, including large genomic islands likely tocontribute to virulence and host specificity. Over 375 repetitiveextragenic palindromic sequences (REPs) unique to Pss B728a when comparedto Pst DC3000 are widely distributed throughout the chromosome except in14 genomic islands, which generally had lower GC content than the genomeas a whole. Content of the genomic islands vary, with one containing aprophage and another the plasmid pKLC102 of P. aeruginosa PAO1. Among the976 genes of Pss B728a with no counterpart in Pst DC3000 are thoseencoding for syringopeptin (SP), syringomycin (SR), indole acetic acidbiosynthesis, arginine degradation, and production of ice nuclei. Thegenomic comparison suggests that several unique genes for Pss B728a suchas ectoine synthase, DNA repair, and antibiotic production may contributeto epiphytic fitness and stress tolerance of this organism. Pseudomonassyringae, a member of the gamma subgroup of the Proteobacteria, is awidespread bacterial pathogen of many plant species. The species P.syringae is subdivided into approximately 50 pathovars based onpathogenicity and host range. P. syringae is capable of
Triplett, Lindsay R; Cohen, Stephen P; Heffelfinger, Christopher; Schmidt, Clarice L; Huerta, Alejandra I; Tekete, Cheick; Verdier, Valerie; Bogdanove, Adam J; Leach, Jan E
2016-09-01
The rice pathogens Xanthomonas oryzae pathovar (pv.) oryzae and pv. oryzicola produce numerous transcription activator-like (TAL) effectors that increase bacterial virulence by activating expression of host susceptibility genes. Rice resistance mechanisms against TAL effectors include polymorphisms that prevent effector binding to susceptibility gene promoters, or that allow effector activation of resistance genes. This study identifies, in the heirloom variety Carolina Gold Select, a third mechanism of rice resistance involving TAL effectors. This resistance manifests through strong suppression of disease development in response to diverse TAL effectors from both X. oryzae pathovars. The resistance can be triggered by an effector with only 3.5 central repeats, is independent of the composition of the repeat variable di-residues that determine TAL effector binding specificity, and is independent of the transcriptional activation domain. We determined that the resistance is conferred by a single dominant locus, designated Xo1, that maps to a 1.09 Mbp fragment on chromosome 4. The Xo1 interval also confers complete resistance to the strains in the African clade of X. oryzae pv. oryzicola, representing the first dominant resistance locus against bacterial leaf streak in rice. The strong phenotypic similarity between the TAL effector-triggered resistance conferred by Xo1 and that conferred by the tomato resistance gene Bs4 suggests that monocots and dicots share an ancient or convergently evolved mechanism to recognize analogous TAL effector epitopes. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Tamura, Hiroto; Hotta, Yudai; Sato, Hiroaki
2013-08-01
Matrix-assisted laser-desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) is one of the most widely used mass-based approaches for bacterial identification and classification because of the simple sample preparation and extremely rapid analysis within a few minutes. To establish the accurate MALDI-TOF MS bacterial discrimination method at strain level, the ribosomal subunit proteins coded in the S 10-spc-alpha operon, which encodes half of the ribosomal subunit protein and is highly conserved in eubacterial genomes, were selected as reliable biomarkers. This method, named the S10-GERMS method, revealed that the strains of genus Pseudomonas were successfully identified and discriminated at species and strain levels, respectively; therefore, the S10-GERMS method was further applied to discriminate the pathovar of P. syringae. The eight selected biomarkers (L24, L30, S10, S12, S14, S16, S17, and S19) suggested the rapid discrimination of P. syringae at the strain (pathovar) level. The S10-GERMS method appears to be a powerful tool for rapid and reliable bacterial discrimination and successful phylogenetic characterization. In this article, an overview of the utilization of results from the S10-GERMS method is presented, highlighting the characterization of the Lactobacillus casei group and discrimination of the bacteria of genera Bacillus and Sphingopyxis despite only two and one base difference in the 16S rRNA gene sequence, respectively.
Ethnomedicines used in Trinidad and Tobago for reproductive problems.
Lans, Cheryl
2007-03-15
Throughout history women have tried to control or enhance their fertility using herbal remedies, with various levels of societal support. Caribbean folk medicine has been influenced by European folk medicine, either through the early Spanish and French settlers or through the continuous immigration of Spanish-speaking peoples from Venezuela. Some folk uses are ancient and were documented by Galen and Pliny the Elder. Thirty respondents, ten of whom were male were interviewed from September 1996 to September 2000. The respondents were obtained by snowball sampling, and were found in thirteen different sites, 12 in Trinidad (Paramin, Talparo, Sangre Grande, Mayaro, Carapichaima, Kernahan, Newlands, Todd's Road, Arima, Guayaguayare, Santa Cruz, Port of Spain and Siparia) and one in Tobago (Mason Hall). Snowball sampling was used because there was no other means of identifying respondents and to cover the entire islands. The validation of the remedies was conducted with a non-experimental method. Plants are used for specific problems of both genders. Clusea rosea, Urena sinuata and Catharanthus roseus are used for unspecified male problems. Richeria grandis and Parinari campestris are used for erectile dysfunction. Ageratum conyzoides, Scoparia dulcis, Cucurbita pepo, Cucurbita maxima, Gomphrena globosa and Justicia pectoralis are used for prostate problems. The following plants are used for childbirth and infertility: Mimosa pudica, Ruta graveolens, Abelmoschus moschatus, Chamaesyce hirta, Cola nitida, Ambrosia cumanenesis, Pilea microphylla, Eryngium foetidum, Aristolochia rugosa, Aristolochia trilobata, Coleus aromaticus, Laportea aestuans and Vetiveria zizanioides. The following plants are used for menstrual pain and unspecified female complaints: Achyranthes indica, Artemisia absinthium, Brownea latifolia, Eleutherine bulbosa, Hibiscus rosa-sinensis, Eupatorium macrophyllum, Justicia secunda, Parthenium hysterophorus, Wedelia trilobata, Abelmoschus moschatus
Quiñónez-Martínez, Miroslava; Ruan-Soto, Felipe; Aguilar-Moreno, Ivonne Estela; Garza-Ocañas, Fortunato; Lebgue-Keleng, Toutcha; Lavín-Murcio, Pablo Antonio; Enríquez-Anchondo, Irma Delia
2014-09-17
The Sierra Madre Occidental of Chihuahua in Northern Mexico is inhabited by indigenous Raramuris, mestizos, and other ethnic groups. The territory consists of canyons and ravines with pine, oak and pine-oak forests in the higher plateaus. A great diversity of potentially edible mushrooms is found in forests of the Municipalities of Bocoyna and Urique. Their residents are the only consumers of wild mushrooms in the Northern Mexico; they have a long tradition of collecting and eating these during the "rainy season." However, despite the wide diversity of edible mushrooms that grow in these areas, residents have a selective preference. This paper aims to record evidence of the knowledge and use of wild potentially edible mushroom species by inhabitants of towns in the Sierra Tarahumara of Chihuahua, Mexico. Using a semi-structured technique, we surveyed 197 habitants from seven locations in Urique, Bocoyna, and the Cusarare area from 2010 to 2012. Known fungi, local nomenclature, species consumed, preparation methods, appreciation of taste, forms of preservation, criteria for differentiating toxic and edible fungi, other uses, economic aspects, and traditional teaching were recorded. To identify the recognized species, photographic stimuli of 22 local edible species and two toxic species were used. The respondents reported preference for five species: Amanita rubescens, Agaricus campestris, Ustilago maydis, Hypomyces lactifluorum, and the Amanita caesarea complex. No apparent differences were found between ethnic groups in terms of preference, although mestizos used other species in Bocoyna (Boletus edulis and B. pinophilus). Some different uses of fungi are recognized by respondents, i.e. home decorations, medicine, as food in breeding rams, etc. The studied population shows a great appreciation towards five species, mainly the A. caesarea complex, and an apparent lack of knowledge of nearly 20 species which are used as food in other areas of Mexico. There are no
Characterization of Pseudomonas pathovars isolated from rosaceous fruit trees in East Algeria.
Harzallah, D; Sadallah, S; Larous, L
2004-01-01
A survey of bacterial diseases due to Pseudomonas on rosaceous fruit trees was conducted. In forty two orchards located in the Constantine region ( East Algeria). Pseudomonas isolates were identified on the bases of their cultural and biochemical characteristics . A total of fifty nine phytopathogenic bacteria were isolated from diseased pome and stone fruit trees. Thirty one strains comparable to Pseudomonas syringae pv. syringae were isolated from cherry (Prunus avium L.), plum (P. domestica L.), apricot (P. armeniaca L.), almond (P. dulcis L.) and pear trees (Pirus communis L.); sixteen strains comparable to Pseudomonas syringae pv. morsprunorum were obtained from samples of cherry and plum. Twelve strains of Pseudomonas viridiflava were isolated from cherry, apricot and peach (Prunus persica L.).
Dey, Sanjukta; Wenig, Marion; Langen, Gregor; Sharma, Sapna; Kugler, Karl G.; Knappe, Claudia; Hause, Bettina; Bichlmeier, Marlies; Babaeizad, Valiollah; Imani, Jafargholi; Janzik, Ingar; Stempfl, Thomas; Hückelhoven, Ralph; Kogel, Karl-Heinz; Mayer, Klaus F.X.
2014-01-01
Leaf-to-leaf systemic immune signaling known as systemic acquired resistance is poorly understood in monocotyledonous plants. Here, we characterize systemic immunity in barley (Hordeum vulgare) triggered after primary leaf infection with either Pseudomonas syringae pathovar japonica (Psj) or Xanthomonas translucens pathovar cerealis (Xtc). Both pathogens induced resistance in systemic, uninfected leaves against a subsequent challenge infection with Xtc. In contrast to systemic acquired resistance in Arabidopsis (Arabidopsis thaliana), systemic immunity in barley was not associated with NONEXPRESSOR OF PATHOGENESIS-RELATED GENES1 or the local or systemic accumulation of salicylic acid. Instead, we documented a moderate local but not systemic induction of abscisic acid after infection of leaves with Psj. In contrast to salicylic acid or its functional analog benzothiadiazole, local applications of the jasmonic acid methyl ester or abscisic acid triggered systemic immunity to Xtc. RNA sequencing analysis of local and systemic transcript accumulation revealed unique gene expression changes in response to both Psj and Xtc and a clear separation of local from systemic responses. The systemic response appeared relatively modest, and quantitative reverse transcription-polymerase chain reaction associated systemic immunity with the local and systemic induction of two WRKY and two ETHYLENE RESPONSIVE FACTOR (ERF)-like transcription factors. Systemic immunity against Xtc was further associated with transcriptional changes after a secondary/systemic Xtc challenge infection; these changes were dependent on the primary treatment. Taken together, bacteria-induced systemic immunity in barley may be mediated in part by WRKY and ERF-like transcription factors, possibly facilitating transcriptional reprogramming to potentiate immunity. PMID:25332505
Dey, Sanjukta; Wenig, Marion; Langen, Gregor; Sharma, Sapna; Kugler, Karl G; Knappe, Claudia; Hause, Bettina; Bichlmeier, Marlies; Babaeizad, Valiollah; Imani, Jafargholi; Janzik, Ingar; Stempfl, Thomas; Hückelhoven, Ralph; Kogel, Karl-Heinz; Mayer, Klaus F X; Vlot, A Corina
2014-12-01
Leaf-to-leaf systemic immune signaling known as systemic acquired resistance is poorly understood in monocotyledonous plants. Here, we characterize systemic immunity in barley (Hordeum vulgare) triggered after primary leaf infection with either Pseudomonas syringae pathovar japonica (Psj) or Xanthomonas translucens pathovar cerealis (Xtc). Both pathogens induced resistance in systemic, uninfected leaves against a subsequent challenge infection with Xtc. In contrast to systemic acquired resistance in Arabidopsis (Arabidopsis thaliana), systemic immunity in barley was not associated with NONEXPRESSOR OF PATHOGENESIS-RELATED GENES1 or the local or systemic accumulation of salicylic acid. Instead, we documented a moderate local but not systemic induction of abscisic acid after infection of leaves with Psj. In contrast to salicylic acid or its functional analog benzothiadiazole, local applications of the jasmonic acid methyl ester or abscisic acid triggered systemic immunity to Xtc. RNA sequencing analysis of local and systemic transcript accumulation revealed unique gene expression changes in response to both Psj and Xtc and a clear separation of local from systemic responses. The systemic response appeared relatively modest, and quantitative reverse transcription-polymerase chain reaction associated systemic immunity with the local and systemic induction of two WRKY and two ETHYLENE RESPONSIVE FACTOR (ERF)-like transcription factors. Systemic immunity against Xtc was further associated with transcriptional changes after a secondary/systemic Xtc challenge infection; these changes were dependent on the primary treatment. Taken together, bacteria-induced systemic immunity in barley may be mediated in part by WRKY and ERF-like transcription factors, possibly facilitating transcriptional reprogramming to potentiate immunity. © 2014 American Society of Plant Biologists. All Rights Reserved.
Carrión, Víctor J; Gutiérrez-Barranquero, José A; Arrebola, Eva; Bardaji, Leire; Codina, Juan C; de Vicente, Antonio; Cazorla, Francisco M; Murillo, Jesús
2013-02-01
Mangotoxin production was first described in Pseudomonas syringae pv. syringae strains. A phenotypic characterization of 94 P. syringae strains was carried out to determine the genetic evolution of the mangotoxin biosynthetic operon (mbo). We designed a PCR primer pair specific for the mbo operon to examine its distribution within the P. syringae complex. These primers amplified a 692-bp DNA fragment from 52 mangotoxin-producing strains and from 7 non-mangotoxin-producing strains that harbor the mbo operon, whereas 35 non-mangotoxin-producing strains did not yield any amplification. This, together with the analysis of draft genomes, allowed the identification of the mbo operon in five pathovars (pathovars aptata, avellanae, japonica, pisi, and syringae), all of which belong to genomospecies 1, suggesting a limited distribution of the mbo genes in the P. syringae complex. Phylogenetic analyses using partial sequences from housekeeping genes differentiated three groups within genomospecies 1. All of the strains containing the mbo operon clustered in groups I and II, whereas those lacking the operon clustered in group III; however, the relative branching order of these three groups is dependent on the genes used to construct the phylogeny. The mbo operon maintains synteny and is inserted in the same genomic location, with high sequence conservation around the insertion point, for all the strains in groups I and II. These data support the idea that the mbo operon was acquired horizontally and only once by the ancestor of groups I and II from genomospecies 1 within the P. syringae complex.
Genomes-based phylogeny of the genus Xanthomonas
Directory of Open Access Journals (Sweden)
Rodriguez-R Luis M
2012-03-01
Full Text Available Abstract Background The genus Xanthomonas comprises several plant pathogenic bacteria affecting a wide range of hosts. Despite the economic, industrial and biological importance of Xanthomonas, the classification and phylogenetic relationships within the genus are still under active debate. Some of the relationships between pathovars and species have not been thoroughly clarified, with old pathovars becoming new species. A change in the genus name has been recently suggested for Xanthomonas albilineans, an early branching species currently located in this genus, but a thorough phylogenomic reconstruction would aid in solving these and other discrepancies in this genus. Results Here we report the results of the genome-wide analysis of DNA sequences from 989 orthologous groups from 17 Xanthomonas spp. genomes available to date, representing all major lineages within the genus. The phylogenetic and computational analyses used in this study have been automated in a Perl package designated Unus, which provides a framework for phylogenomic analyses which can be applied to other datasets at the genomic level. Unus can also be easily incorporated into other phylogenomic pipelines. Conclusions Our phylogeny agrees with previous phylogenetic topologies on the genus, but revealed that the genomes of Xanthomonas citri and Xanthomonas fuscans belong to the same species, and that of Xanthomonas albilineans is basal to the joint clade of Xanthomonas and Xylella fastidiosa. Genome reduction was identified in the species Xanthomonas vasicola in addition to the previously identified reduction in Xanthomonas albilineans. Lateral gene transfer was also observed in two gene clusters.
Marcelletti, Simone; Scortichini, Marco
2015-01-01
The European hazelnut (Corylus avellana) is threatened in Europe by several pseudomonads which cause symptoms ranging from twig dieback to tree death. A comparison of the draft genomes of nine Pseudomonas strains isolated from symptomatic C. avellana trees was performed to identify common and distinctive genomic traits. The thorough assessment of genetic relationships among the strains revealed two clearly distinct clusters: P. avellanae and P. syringae. The latter including the pathovars avellanae, coryli and syringae. Between these two clusters, no recombination event was found. A genomic island of approximately 20 kb, containing the hrp/hrc type III secretion system gene cluster, was found to be present without any genomic difference in all nine pseudomonads. The type III secretion system effector repertoires were remarkably different in the two groups, with P. avellanae showing a higher number of effectors. Homologue genes of the antimetabolite mangotoxin and ice nucleation activity clusters were found solely in all P. syringae pathovar strains, whereas the siderophore yersiniabactin was only present in P. avellanae. All nine strains have genes coding for pectic enzymes and sucrose metabolism. By contrast, they do not have genes coding for indolacetic acid and anti-insect toxin. Collectively, this study reveals that genomically different Pseudomonas can converge on the same host plant by suppressing the host defence mechanisms with the use of different virulence weapons. The integration into their genomes of a horizontally acquired genomic island could play a fundamental role in their evolution, perhaps giving them the ability to exploit new ecological niches. PMID:26147218
Hazen, Tracy H; Leonard, Susan R; Lampel, Keith A; Lacher, David W; Maurelli, Anthony T; Rasko, David A
2016-08-01
Enteroinvasive Escherichia coli (EIEC) is a unique pathovar that has a pathogenic mechanism nearly indistinguishable from that of Shigella species. In contrast to isolates of the four Shigella species, which are widespread and can be frequent causes of human illness, EIEC causes far fewer reported illnesses each year. In this study, we analyzed the genome sequences of 20 EIEC isolates, including 14 first described in this study. Phylogenomic analysis of the EIEC genomes demonstrated that 17 of the isolates are present in three distinct lineages that contained only EIEC genomes, compared to reference genomes from each of the E. coli pathovars and Shigella species. Comparative genomic analysis identified genes that were unique to each of the three identified EIEC lineages. While many of the EIEC lineage-specific genes have unknown functions, those with predicted functions included a colicin and putative proteins involved in transcriptional regulation or carbohydrate metabolism. In silico detection of the Shigella virulence plasmid (pINV), which is essential for the invasion of host cells, demonstrated that a form of pINV was present in nearly all EIEC genomes, but the Mxi-Spa-Ipa region of the plasmid that encodes the invasion-associated proteins was absent from several of the EIEC isolates. The comparative genomic findings in this study support the hypothesis that multiple EIEC lineages have evolved independently from multiple distinct lineages of E. coli via the acquisition of the Shigella virulence plasmid and, in some cases, the Shigella pathogenicity islands. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Pseudomonas savastanoi pv. savastanoi: some like it knot.
Ramos, Cayo; Matas, Isabel M; Bardaji, Leire; Aragón, Isabel M; Murillo, Jesús
2012-12-01
Pseudomonas savastanoi pv. savastanoi is the causal agent of olive (Olea europaea) knot disease and an unorthodox member of the P. syringae complex, causing aerial tumours instead of the foliar necroses and cankers characteristic of most members of this complex. Olive knot is present wherever olive is grown; although losses are difficult to assess, it is assumed that olive knot is one of the most important diseases of the olive crop. The last century witnessed a large number of scientific articles describing the biology, epidemiology and control of this pathogen. However, most P. savastanoi pv. savastanoi strains are highly recalcitrant to genetic manipulation, which has effectively prevented the pathogen from benefitting from the scientific progress in molecular biology that has elevated the foliar pathogens of the P. syringae complex to supermodels. A number of studies in recent years have made significant advances in the biology, ecology and genetics of P. savastanoi pv. savastanoi, paving the way for the molecular dissection of its interaction with other nonpathogenic bacteria and their woody hosts. The selection of a genetically pliable model strain was soon followed by the development of rapid methods for virulence assessment with micropropagated olive plants and the analysis of cellular interactions with the plant host. The generation of a draft genome of strain NCPPB 3335 and the closed sequence of its three native plasmids has allowed for functional and comparative genomic analyses for the identification of its pathogenicity gene complement. This includes 34 putative type III effector genes and genomic regions, shared with other pathogens of woody hosts, which encode metabolic pathways associated with the degradation of lignin-derived compounds. Now, the time is right to explore the molecular basis of the P. savastanoi pv. savastanoi-olive interaction and to obtain insights into why some pathovars like it necrotic and why some like it knot
Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.
Zdżalik, Daria; Domańska, Anna; Prorok, Paulina; Kosicki, Konrad; van den Born, Erwin; Falnes, Pål Ø; Rizzo, Carmelo J; Guengerich, F Peter; Tudek, Barbara
2015-06-01
AlkB proteins are evolutionary conserved Fe(II)/2-oxoglutarate-dependent dioxygenases, which remove alkyl and highly promutagenic etheno(ɛ)-DNA adducts, but their substrate specificity has not been fully determined. We developed a novel assay for the repair of ɛ-adducts by AlkB enzymes using oligodeoxynucleotides with a single lesion and specific DNA glycosylases and AP-endonuclease for identification of the repair products. We compared the repair of three ɛ-adducts, 1,N(6)-ethenoadenine (ɛA), 3,N(4)-ethenocytosine (ɛC) and 1,N(2)-ethenoguanine (1,N(2)-ɛG) by nine bacterial and two human AlkBs, representing four different structural groups defined on the basis of conserved amino acids in the nucleotide recognition lid, engaged in the enzyme binding to the substrate. Two bacterial AlkB proteins, MT-2B (from Mycobacterium tuberculosis) and SC-2B (Streptomyces coelicolor) did not repair these lesions in either double-stranded (ds) or single-stranded (ss) DNA. Three proteins, RE-2A (Rhizobium etli), SA-2B (Streptomyces avermitilis), and XC-2B (Xanthomonas campestris) efficiently removed all three lesions from the DNA substrates. Interestingly, XC-2B and RE-2A are the first AlkB proteins shown to be specialized for ɛ-adducts, since they do not repair methylated bases. Three other proteins, EcAlkB (Escherichia coli), SA-1A, and XC-1B removed ɛA and ɛC from ds and ssDNA but were inactive toward 1,N(2)-ɛG. SC-1A repaired only ɛA with the preference for dsDNA. The human enzyme ALKBH2 repaired all three ɛ-adducts in dsDNA, while only ɛA and ɛC in ssDNA and repair was less efficient in ssDNA. ALKBH3 repaired only ɛC in ssDNA. Altogether, we have shown for the first time that some AlkB proteins, namely ALKBH2, RE-2A, SA-2B and XC-2B can repair 1,N(2)-ɛG and that ALKBH3 removes only ɛC from ssDNA. Our results also suggest that the nucleotide recognition lid is not the sole determinant of the substrate specificity of AlkB proteins. Copyright © 2015 Elsevier B
Application of phytoextraction for uranium contaminated soil in korea
Ryu, Y.; Han, Y.; Lee, M.
2013-12-01
The soils having high concentration of uranium, sampled from Goesan Deokpyungri area in Korea, were identified with the uranium removal efficiency of phytoextraction by using several plants. According to the results of physicochemical properties, uranium concentration from soil was 28.85mg/kg, pH 5.43 and soil texture was "Sand". Results of SEP(Sequential Extraction Procedure) test, uranium concentrations ratio of soil in the status of exchangeable/carbonate was 13.4%. Five plants such as Lettuce (Lactuca sativa L.), Chinese cabbage (Brassica campestris L.), Sweet potato (Ipomoea batatas (L.) Lam), Radish (Raphanus sativus), Sesame (Perilla frutescens var. japonica) were cultivated during 56 days in phytotron. All the cultivation processes were conducted in a growth chamber at 25 degrees celsius, 70% relative humidity, 4000 Lux illumination (16 hours/day) and CO2 concentration of 600 ppm. Four times at intervals of 2 weeks leaves and roots collected were analyzed for uranium concentration. Ranges of uranium concentration of the roots and leaves from the five plants were measured to 206.81-721.22μg/kg and 3.45-10.21μg/kg respectively. The majority of uranium was found to accumulate in the roots. Uranium concentration in the leaves, regardless of the type of plants were presented below standard of drinking water(30μg/l) by U.S EPA. Phytoextraction pot experiments with citric acid were conducted. Citric acid as chelating agent was applied to soil to enhance uranium accumulation in five crop plants. 6 days before harvest crops, Each citric acid 25mM and 50mM was injected into the soil by 300ml. After injecting citric acid 25mM , pH of the soil was reduced to 4.95. Uranium concentration of leaves and roots collected from five plants was increased to 2-4times and 7-30times compared to control soil. Injected with citric acid 50mM , pH of the soil was reduced to 4.79. Uranium concentration of leaves and roots collected from five plants was increased to 3-10times and 10
Ethnomedicines used in Trinidad and Tobago for reproductive problems
Directory of Open Access Journals (Sweden)
Lans Cheryl
2007-03-01
Full Text Available Abstract Background Throughout history women have tried to control or enhance their fertility using herbal remedies, with various levels of societal support. Caribbean folk medicine has been influenced by European folk medicine, either through the early Spanish and French settlers or through the continuous immigration of Spanish-speaking peoples from Venezuela. Some folk uses are ancient and were documented by Galen and Pliny the Elder. Methods Thirty respondents, ten of whom were male were interviewed from September 1996 to September 2000. The respondents were obtained by snowball sampling, and were found in thirteen different sites, 12 in Trinidad (Paramin, Talparo, Sangre Grande, Mayaro, Carapichaima, Kernahan, Newlands, Todd's Road, Arima, Guayaguayare, Santa Cruz, Port of Spain and Siparia and one in Tobago (Mason Hall. Snowball sampling was used because there was no other means of identifying respondents and to cover the entire islands. The validation of the remedies was conducted with a non-experimental method. Results Plants are used for specific problems of both genders. Clusea rosea, Urena sinuata and Catharanthus roseus are used for unspecified male problems. Richeria grandis and Parinari campestris are used for erectile dysfunction. Ageratum conyzoides, Scoparia dulcis, Cucurbita pepo, Cucurbita maxima, Gomphrena globosa and Justicia pectoralis are used for prostate problems. The following plants are used for childbirth and infertility: Mimosa pudica, Ruta graveolens, Abelmoschus moschatus, Chamaesyce hirta, Cola nitida, Ambrosia cumanenesis, Pilea microphylla, Eryngium foetidum, Aristolochia rugosa, Aristolochia trilobata, Coleus aromaticus, Laportea aestuans and Vetiveria zizanioides. The following plants are used for menstrual pain and unspecified female complaints: Achyranthes indica, Artemisia absinthium, Brownea latifolia, Eleutherine bulbosa, Hibiscus rosa-sinensis, Eupatorium macrophyllum, Justicia secunda, Parthenium
Zhugunissov, K; Bulatov, Ye; Taranov, D; Yershebulov, Z; Koshemetov, Zh; Abduraimov, Ye; Kondibayeva, Zh; Samoltyrova, A; Amanova, Zh; Khairullin, B; Sansyzbay, A
2017-11-01
In this study the safety and protective immunity of an oral rabies vaccine, based on the live, modified rabies virus strain VRC-RZ2, was examined in stray dogs (Canis Sp.), corsacs (Vulpes corsac) and steppe wolves (Canis lupus campestris). In the safety group (dogs, n=6; corsacs, n=3; wolves, n=3) which was vaccinated with a 10-times field dose/animal, no animals showed any signs of disease or changes in behavior or appetite during the period of clinical observation, similar to the animals in the negative control group. Saliva samples taken from animals prior and post (5 th and 10 th days) vaccination failed to demonstrate rabies virus antigen. Observations of immunogenicity in vaccinated carnivores (dogs, corsacs and wolves) during a 180 day period showed the titers of virus neutralizing antibodies (VNA) in the blood sera of vaccinated dogs to be within 0.59-1.37 IU/mL. On 14 days post vaccination (dpv), all the wild carnivores had detectable levels of neutralizing antibodies, with mean titers ranging from 0.50 ± 0.07 IU/mL (for wolves) to 0.59 ± 0.10 IU/mL (for corsacs). Weeks after vaccination, all the vaccinated wolves and corsacs had higher levels of neutralizing antibodies: 0.70 ± 0.10 - 0.71 ± 0.08 IU/mL at 30 dpv, 1.06 ± 0.08 - 1.28 ± 0.21 IU/mL at 60 dpv and 0.41 ± 0.09 - 047 ± 0.06 at 180 dpv. The highest level of VNA (˃1.0 IU/ml) was detected at 60 dpv, in all vaccinated animals. After challenge all vaccinated dogs remained healthy for 180 days. Control animals (unvaccinated dogs) developed symptoms of rabies on day 6 post administration of a virulent virus and died of rabies on days 11-13. Of note, the VNA titers in all the wild carnivores (corsacs and wolves) immunized with VRC-RZ2 were higher than 0.5 IU/ml (0.59 ± 0.11 IU/ml), even as early as 14 days post vaccination. These, presumably protective, titers of antibodies to rabies virus were present in the dogs and wild carnivores examined in this study for at
Jacobs, Melisa
2014-01-01
Muchas bacterias producen polisacáridos extracelulares que pueden asociarse a la superficie celular o ser secretados al medio extracelular. Numerosos polisacáridos bacterianos se encuentran asociados al desarrollo de patogenicidad, convirtiéndose en un importante factor de virulencia. Por otro lado, existe un gran interés industrial sobre muchos polisacáridos bacterianos debido a sus amplias aplicaciones. En general, se ha descripto en detalle los primeros pasos de la síntesis de polisacárido...
Characterization of a new pathovar of Agrobacterium vitis causing banana leaf blight in China.
Huang, Siliang; Long, Mengling; Fu, Gang; Lin, Shanhai; Qin, Liping; Hu, Chunjin; Cen, Zhenlu; Lu, Jie; Li, Qiqin
2015-01-01
A new banana leaf blight was found in Nanning city, China, during a 7-year survey (2003-2009) of the bacterial diseases on banana plants. Eight bacterial strains were isolated from affected banana leaves, and identified as an intraspecific taxon of Agrobacterium vitis based on their 16S rDNA sequence similarities with those of 37 randomly selected bacterial strains registered in GenBank database. The representative strain Ag-1 was virulent on banana leaves and shared similar growth and biochemical reactions with the reference strain IAM14140 of A. vitis. The strains causing banana leaf blight were denominated as A. vitis pv. musae. The traditional A. vitis strains virulent to grapevines were proposed to be revised as A. vitis pv. vitis. This is the first record of a new type of A. vitis causing banana leaf blight in China. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
In planta gene expression analysis of Xanthomonas oryzae pathovar oryzae, African strain MAI1
Directory of Open Access Journals (Sweden)
Verdier Valérie
2010-06-01
Full Text Available Abstract Background Bacterial leaf blight causes significant yield losses in rice crops throughout Asia and Africa. Although both the Asian and African strains of the pathogen, Xanthomonas oryzae pv. oryzae (Xoo, induce similar symptoms, they are nevertheless genetically different, with the African strains being more closely related to the Asian X. oryzae pv. oryzicola (Xoc. Results Changes in gene expression of the African Xoo strain MAI1 in the susceptible rice cultivar Nipponbare were profiled, using an SSH Xoo DNA microarray. Microarray hybridization was performed comparing bacteria recovered from plant tissues at 1, 3, and 6 days after inoculation (dai with bacteria grown in vitro. A total of 710 bacterial genes were found to be differentially expressed, with 407 up-regulated and 303 down-regulated. Expression profiling indicated that less than 20% of the 710 bacterial transcripts were induced in the first 24 h after inoculation, whereas 63% were differentially expressed at 6 dai. The 710 differentially expressed genes were one-end sequenced. 535 sequences were obtained from which 147 non-redundant sequences were identified. Differentially expressed genes were related to metabolism, secretion and transport, pathogen adherence to plant tissues, plant cell-wall degradation, IS elements, and virulence. In addition, various other genes encoding proteins with unknown function or showing no similarity to other proteins were also induced. The Xoo MAI1 non-redundant set of sequences was compared against several X. oryzae genomes, revealing a specific group of genes that was present only in MAI1. Numerous IS elements were also found to be differentially expressed. Quantitative real-time PCR confirmed 86% of the identified profile on a set of 14 genes selected according to the microarray analysis. Conclusions This is the first report to compare the expression of Xoo genes in planta across different time points during infection. This work shows that as-yet-unidentified and potentially new virulence factors are appearing in an emerging African pathogen. It also confirms that African Xoo strains do differ from their Asian counterparts, even at the transcriptional level.
Directory of Open Access Journals (Sweden)
Juliana Domingues dos Santos Carvalho
2014-06-01
Full Text Available O objetivo deste trabalho foi determinar as características fisicoquímicas e a qualidade microbiológica de picles de pepino e de nabo como alternativa para geração de renda para a Agricultura Familiar. As olerícolas submetidas ao sistema de cultivo orgânico foram produzidas por agricultores familiares de Seropédica, Rio de Janeiro, Brasil. Foram analisados os teores de umidade, proteínas, lipídeos, cinzas, fibras, de carboidratos totais, além do pH, a acidez total e o teor de sódio das amostras de picles estudadas. Também foi avaliada a qualidade microbiológica de acordo com a Legislação vigente para esta categoria de produto. Os picles estudados não puderam ser denominados “picles orgânicos”, uma vez que a quantidade de vinagre convencional ficou acima do limite máximo estipulado pela Legislação, que permite o uso de matéria-prima de origem não orgânica em quantidade não superior a 5%. De forma geral, os picles estudados apresentaram elevada umidade (acima de 90 %, e pequena quantidade de nutrientes calóricos (carboidratos totais, proteínas e lipídeos, resultando em um produto com baixo teor calórico. Quanto ao teor de sódio, verificou-se que a conserva de pepino e de nabo apresentaram teor de sódio semelhante. O picles de pepino e de nabo estavam dentro dos padrões microbiológicos de qualidade exigidos pela Agência Nacional de Vigilância Sanitária (ANVISA, sugerindo que as normas de Boas Práticas de Fabricação (BPF foram seguidas pelos agricultores de forma satisfatória. Quanto aos aspectos nutricionais, apesar das amostras de picles terem apresentado baixo valor calórico, o consumo de uma porção diária da conserva de picles de pepino e de nabo foi suficiente para fornecer 30% e 65 % de sódio, respectivamente do valor diário (%VD recomendado, sugerindo a necessidade de ajuste na formulação dos produtos estudados. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}
Ionescu, Michael; Yokota, Kenji; Antonova, Elena; Garcia, Angelica; Beaulieu, Ellen; Hayes, Terry; Iavarone, Anthony T; Lindow, Steven E
2016-07-19
Cell density-dependent regulation of gene expression in Xylella fastidiosa that is crucial to its switching between plant hosts and insect vectors is dependent on RpfF and its production of 2-enoic acids known as diffusible signal factor (DSF). We show that X. fastidiosa produces a particularly large variety of similar, relatively long-chain-length 2-enoic acids that are active in modulating gene expression. Both X. fastidiosa itself and a Pantoea agglomerans surrogate host harboring X. fastidiosa RpfF (XfRpfF) is capable of producing a variety of both saturated and unsaturated free fatty acids. However, only 2-cis unsaturated acids were found to be biologically active in X. fastidiosa X. fastidiosa produces, and is particularly responsive to, a novel DSF species, 2-cis-hexadecanoic acid that we term XfDSF2. It is also responsive to other, even longer 2-enoic acids to which other taxa such as Xanthomonas campestris are unresponsive. The 2-enoic acids that are produced by X. fastidiosa are strongly affected by the cellular growth environment, with XfDSF2 not detected in culture media in which 2-tetradecenoic acid (XfDSF1) had previously been found. X. fastidiosa is responsive to much lower concentrations of XfDSF2 than XfDSF1. Apparently competitive interactions can occur between various saturated and unsaturated fatty acids that block the function of those agonistic 2-enoic fatty acids. By altering the particular 2-enoic acids produced and the relative balance of free enoic and saturated fatty acids, X. fastidiosa might modulate the extent of DSF-mediated quorum sensing. X. fastidiosa, having a complicated lifestyle in which it moves and multiplies within plants but also must be vectored by insects, utilizes DSF-based quorum sensing to partition the expression of traits needed for these two processes within different cells in this population based on local cellular density. The finding that it can produce a variety of DSF species in a strongly
Mehrbani, Mehrzad; Choopani, Rasool; Fekri, Alireza; Mehrabani, Mitra; Mosaddegh, Mahmoud; Mehrabani, Mehrnaz
2015-08-22
Atopic dermatitis is a common chronic inflammatory skin condition that is on the rise and adversely affects quality of life of the affected individual. Dry skin and pruritus, major characteristics of this disease, are associated with the dysfunction of the skin barrier. Though mild cases of the disease can be controlled with antihistamines and topical corticosteroids, moderate-to-severe cases often require treatment with immunomodulatory drugs, which have many side effects. It is now more common to use complementary and alternative medicines in the treatment of atopic dermatitis. In traditional Iranian medicine, the use of whey with the aqueous extract of field dodder (Cuscuta campestris Yunck.) seeds in severe and refractory cases of atopic dermatitis is common and has no side effects. The aim of this study was to assess the efficacy and safety of whey associated with dodder seed extract in the treatment of moderate-to-severe atopic dermatitis in adults. The study was a randomized, double-blind placebo control trial that was conducted on 52 patients with moderate-to-severe atopic dermatitis for 30 days. In this study patients received freeze dried whey powder with spray dried water extract of field dodder or the placebo for 15 days. At baseline (week zero), after the end of the 15 day treatment period (week three) and 15 days after stopping the drug or placebo (follow-up/week five), patients were evaluated in terms of skin moisture, elasticity, pigmentation, surface pH and sebum content on the forearm with Multi Skin Test Center® MC1000 (Courage & Khazaka, Germany) and the degree of pruritus and sleep disturbance in patients were also recorded. 42 patients completed 30 days of treatment with the medicine and the follow-up period. At the end of the follow-up period a significant increase in skin moisture and elasticity in the group receiving whey with dodder was observed compared with the placebo group (pwhey associated with dodder seed extract over time (pwhey
Directory of Open Access Journals (Sweden)
Chia-Fong Wei
Full Text Available A new pathogen, Pseudomonas syringae pv. averrhoi (Pav, which causes bacterial spot disease on carambola was identified in Taiwan in 1997. Many strains of this pathovar have been isolated from different locations and several varieties of hosts. Some of these strains, such as HL1, are nonmotile and elicit a strong hypersensitive response (HR in nonhost tobacco leaves, while other strains, such as PA5, are motile and elicit a weak HR. Based on the image from a transmission electron microscope, the results showed that HL1 is flagellum-deficient and PA5 has normal flagella. Here we cloned and analyzed the fliC gene and glycosylation island from Pav HL1 and PA5. The amino acid sequences of FliC from HL1 and PA5 are identical to P. s. pvs. tabaci (Pta, glycinea and phaseolicola and share very high similarity with other pathovars of P. syringae. In contrast to the flagellin mutant PtaΔfliC, PA5ΔfliC grows as well as wild type in the host plant, but it elicits stronger HR than wild type does in non-host plants. Furthermore, the purified Pav flagellin, but not the divergent flagellin from Agrobacterium tumefaciens, is able to impair the HR induced by PA5ΔfliC. PA5Δfgt1 possessing nonglycosylated flagella behaved as its wild type in both bacterial growth in host and HR elicitation. Flagellin was infiltrated into tobacco leaves either simultaneously with flagellum-deficient HL1 or prior to the inoculation of wild type HL1, and both treatments impaired the HR induced by HL1. Moreover, the HR elicited by PA5 and PA5ΔfliC was enhanced by the addition of cycloheximide, suggesting that the flagellin is one of the PAMPs (pathogen-associated molecular patterns contributed to induce the PAMP-triggered immunity (PTI. Taken together, the results shown in this study reveal that flagellin in Pav is capable of suppressing HR via PTI induction during an incompatible interaction.
Wei, Chia-Fong; Hsu, Shih-Tien; Deng, Wen-Ling; Wen, Yu-Der; Huang, Hsiou-Chen
2012-01-01
A new pathogen, Pseudomonas syringae pv. averrhoi (Pav), which causes bacterial spot disease on carambola was identified in Taiwan in 1997. Many strains of this pathovar have been isolated from different locations and several varieties of hosts. Some of these strains, such as HL1, are nonmotile and elicit a strong hypersensitive response (HR) in nonhost tobacco leaves, while other strains, such as PA5, are motile and elicit a weak HR. Based on the image from a transmission electron microscope, the results showed that HL1 is flagellum-deficient and PA5 has normal flagella. Here we cloned and analyzed the fliC gene and glycosylation island from Pav HL1 and PA5. The amino acid sequences of FliC from HL1 and PA5 are identical to P. s. pvs. tabaci (Pta), glycinea and phaseolicola and share very high similarity with other pathovars of P. syringae. In contrast to the flagellin mutant PtaΔfliC, PA5ΔfliC grows as well as wild type in the host plant, but it elicits stronger HR than wild type does in non-host plants. Furthermore, the purified Pav flagellin, but not the divergent flagellin from Agrobacterium tumefaciens, is able to impair the HR induced by PA5ΔfliC. PA5Δfgt1 possessing nonglycosylated flagella behaved as its wild type in both bacterial growth in host and HR elicitation. Flagellin was infiltrated into tobacco leaves either simultaneously with flagellum-deficient HL1 or prior to the inoculation of wild type HL1, and both treatments impaired the HR induced by HL1. Moreover, the HR elicited by PA5 and PA5ΔfliC was enhanced by the addition of cycloheximide, suggesting that the flagellin is one of the PAMPs (pathogen-associated molecular patterns) contributed to induce the PAMP-triggered immunity (PTI). Taken together, the results shown in this study reveal that flagellin in Pav is capable of suppressing HR via PTI induction during an incompatible interaction. PMID:22911741