WorldWideScience

Sample records for campaign cfc cruise-in

  1. Temperature-dependent infrared cross sections for CFC-11, CFC-12, CFC-13, CFC-14, CFC-22, CFC-113, CFC-114, and CFC-115. Technical report

    Energy Technology Data Exchange (ETDEWEB)

    Massie, S.T.; Goldman, A.; McDaniel, A.H.; Cantrell, C.A.; Davidson, J.A.

    1991-02-01

    The Technical Note presents absorption cross sections at temperatures of 293, 273, 253, 233, 213, and 203K for the chlorofluorocarbon species CFC-11, (CCI3F), CFC-12 (CCI2F2), CFC-13 (CCIF3), CFC-14 (CF4), CFC-22 (CHCIF2), CFC-113 (C2CI3FI3), CFC-114 (C2CI2F4), and CFC-115 (C2CIF5). The infrared cross sections are those reported by McDaniel et al. (1990), and are displayed in graphical form to facilitate quick identification and quantification of CFC gases in high and medium resolution remote sensing studies.

  2. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2009-10-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters from 188 previously non-publicly available cruises in the Arctic, Atlantic, and Southern Ocean have been retrieved and merged into a new database: CARINA (CARbon IN the Atlantic. The data have been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the data products, i.e. the three merged files with measured, calculated and interpolated values for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas.

    Here we present an overview of the QC of the CFC data for the Arctic Mediterranean Seas, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of some cruise data, while some other cruises were flagged with questionable quality, which excluded them from the final data product.

  3. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  4. CFC Outdoor Tournament 2011

    CERN Multimedia

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  5. Study of groundwater mixing using CFC data

    Institute of Scientific and Technical Information of China (English)

    韩良丰; 庞忠和

    2001-01-01

    CFCs (Chlorofluorocarbons) are sensitive tools in the study of groundwater mixing. Based on results of CFC concentrations, the extent of mixing can be identified by three methods: 1. discrepancy between apparent ages determined by individual CFC compounds; 2. inconsistency between CFC concentration ratios and their respective apparent ages; and 3. correlation between the concentrations of two CFC compounds for a group of samples. The principle of determination of mixing ratios and apparent CFC water age in the case of a two component mixing of CFC-containing water with CFC-free water is described.

  6. Dicty_cDB: CFC294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC294 (Link to dictyBase) - - - Contig-U16381-1 CFC294F (Link to Original site) CFC2...94F 124 - - - - - - Show CFC294 Library CF (Link to library) Clone ID CFC294 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC294Q.Seq.d/ Representative seq. ID CFC29...4F (Link to Original site) Representative DNA sequence >CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC294Q.Seq.d/ ATTGT...CFF876 (CFF876Q) /CSM/CF/CFF8-D/CFF876Q.Seq.d/ 157 5e-38 CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC2

  7. Dicty_cDB: CFC276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC276 (Link to dictyBase) - - - Contig-U16381-1 CFC276F (Link to Original site) CFC2...76F 124 - - - - - - Show CFC276 Library CF (Link to library) Clone ID CFC276 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC276Q.Seq.d/ Representative seq. ID CFC27...6F (Link to Original site) Representative DNA sequence >CFC276 (CFC276Q) /CSM/CF/CFC2-D/CFC276Q.Seq.d/ ATTGT...me 4, contig fragment No. 72. 40 0.026 5 AC148398 |AC148398.4 Medicago truncatula clone mth2-24c23, WORKING

  8. Dicty_cDB: CFC857 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC857 (Link to dictyBase) - - - Contig-U15579-1 CFC857P (Link... to Original site) CFC857F 163 CFC857Z 482 CFC857P 645 - - Show CFC857 Library CF (Link to library) Clone ID CFC857 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...NPINCTSTDPCIFSYCENGVCIP TYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPI Translated Amino Acid sequence (All Fram...CY YDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCIP TYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPI

  9. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  10. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    Directory of Open Access Journals (Sweden)

    S. J. Allin

    2014-12-01

    Full Text Available The stratospheric degradation of chlorofluorocarbons (CFCs releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O3. A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, similar to effects seen in nitrous oxide (N2O. Using air archives to obtain a long-term record of chlorine isotope ratios in CFCs could help to identify and quantify their sources and sinks. We analyse the three most abundant CFCs and show that CFC-11 (CCl3F and CFC-113 (CClF2CCl2F exhibit significant stratospheric chlorine isotope fractionation, in common with CFC-12. The apparent isotope fractionation (ϵapp for mid- and high-latitude stratospheric samples are (−2.4 ± 0.5 and (−2.3 ± 0.4‰ for CFC-11, (−12.2 ± 1.6 and (−6.8 ± 0.8‰ for CFC-12 and (−3.5 ± 1.5 and (−3.3 ± 1.2‰ for CFC-113, respectively. Assuming a constant source isotope composition, we estimate the expected trends in the tropospheric isotope signature of these gases due to their stratospheric 37Cl enrichment and stratosphere–troposphere exchange. We compare these model results to the long-term δ(37Cl trends of all three CFCs, measured on background tropospheric samples from the Cape Grim air archive (Tasmania, 1978–2010 and tropospheric firn air samples from Greenland (NEEM site and Antarctica (Fletcher Promontory site. Model trends agree with tropospheric measurements within analytical uncertainties. From 1970 to the present-day, we find no evidence for variations in chlorine isotope ratios associated with changes in CFC manufacturing processes. Our study increases the suite of trace gases amenable to direct isotope ratio measurements in small air volumes, using a single-detector gas chromatography-mass spectrometry system.

  11. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION

    Science.gov (United States)

    The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...

  12. 5 CFR 950.102 - Scope of the Combined Federal Campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Scope of the Combined Federal Campaign... Campaign. (a) The CFC is the only authorized solicitation of employees in the Federal workplace on behalf of charitable organizations. A campaign may be conducted during a period, as determined by the...

  13. Stable carbon isotope fractionation in the UV photolysis of CFC-11 and CFC-12

    Directory of Open Access Journals (Sweden)

    A. Zuiderweg

    2011-12-01

    Full Text Available The chlorofluorocarbons CFC-11 (CCl3F and CFC-12 (CCl2F2 are stable atmospheric compounds that are produced at the earth's surface, but removed only at high altitudes in the stratosphere, where their removal liberates atomic chlorine that then catalytically destroys stratospheric ozone. For such long-lived compounds, isotope effects in the stratospheric removal reactions have a large effect on their global isotope budgets. We have determined the photolytic isotope fractionation for stable carbon isotopes of CFC-11 and CFC-12 in laboratory experiments. 13C/12C isotope fractionations (ϵ range from (−23.7 ± 0.9 to (−17.5 ± 0.4‰ for CFC-11 and (−69.2 ± 3.4 to (−49.4 ± 2.3‰ for CFC-12 between 203 and 288 K, a temperature range relevant to conditions in the troposphere and stratosphere. These results suggest that CFCs should become strongly enriched in 13C with decreasing mixing ratio in the stratosphere, similar to what has been recently observed for CFC chlorine isotopes. In conjunction with the strong variations in CFC emissions before and after the Montréal Protocol, the stratospheric enrichments should also lead to a significant temporal increase in the 13C content of the CFCs at the surface over the past decades, which should be recorded in atmospheric air archives such as firn air.

  14. International research into chlorofluorocarbon (CFC) alternatives

    Energy Technology Data Exchange (ETDEWEB)

    Marseille, T.J.; Shankle, D.L.; Thurman, A.G.

    1992-05-01

    Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.

  15. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...

  16. Atmospheric Science and the CFC Industry

    Science.gov (United States)

    Steed, J. M.

    2012-12-01

    Industry involvement with developing atmospheric science and subsequent regulations to protect ozone was unusual. Chlorofluorocarbon manufacturers were research-based businesses accustomed to understanding the science behind product-related issues. When Lovelock's measurements in 1971 implied most of the cumulative production of CFCs remained in the atmosphere, global CFC producers funded academic research to identify natural sinks for the materials. The Fluorocarbon Program Panel (FPP) began in 1972, but changed focus to atmospheric photochemistry following Rowland and Molina's work in 1974. Despite early vociferous opposition, especially by the CFC-using aerosol industry, to any regulations, leaders among the producers worked to build their scientific understanding, expanding FPP funding and launching internal work in modeling and ozone trend analysis. The key first question for industry was not how much depletion might occur, but whether it would occur at all. If so, regardless of the amount, regulations and a major transition would be required in CFC-using industries, and the response would need to be global and prompt. So long as that basic question was in doubt, some businesses and countries would resist the economic cost of action. In the meantime, the producing industry worked to identify potential alternatives and to communicate atmospheric science to the downstream industries. Although the industry science effort was often disparaged as an attack on "real" science, my only assignment when I joined DuPont's Central Research Department in 1979 was to understand and contribute to the science, keeping both the company and our customers informed. Our modeling results were published freely. FPP funding led to better knowledge of the ClO + O rate constant, significantly increasing depletion in model calculations; supported the development of the techniques used to measure in situ atmospheric ClO, so important in later strengthening the case for chlorine

  17. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of...

  18. 77 FR 10004 - CFC-50 Commission

    Science.gov (United States)

    2012-02-21

    ...'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to the..., 78205. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  19. 76 FR 53159 - CFC-50 Commission Meeting

    Science.gov (United States)

    2011-08-25

    ... ``watchdog'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to... 20415. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  20. Construction of CFC-programs by LTL-specification

    Directory of Open Access Journals (Sweden)

    D. A. Ryabukhin

    2016-01-01

    Full Text Available This article continues a cycle of papers, which describe an approach to construction and verification of discrete PLC-programs by an LTL-specification. The approach provides a possibility of PLC-program correctness analysis by the model checking method. For the specification of the program behavior the linear-time temporal logic LTL is used. The correctness analysis of an LTL specification is performed automatically by the symbolic model checking tool Cadence SMV. Previously it was shown how ST-, LDand IL-programs are constructed by a correct (with verified program properties LTL-specification. In this article a technology of CFC-program construction by an LTL-specification is described. The language CFC (Continuous Function Chart is a variation of FBD (Function Block Diagram. FBD is a graphical language for microcircuits. CFC provides a possibility of free allocation of program components and connections on a screen. The approach to construction of CFC-programs is shown by an example. PLC-program representation on CFC within the approach to programming by LTL-specification differs from other representations. It gives the visualisation of a data flow from inputs to outputs. Influence and dependence between variables is explicitly shown during program execution within one PLC working cycle. In fact, CFC-program is a scheme of PLC-program data flow.

  1. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  2. A carbon fibre composite (CFC Byelorussian peat corer

    Directory of Open Access Journals (Sweden)

    L.G. Franzén

    2009-01-01

    Full Text Available The design specification, development and manufacture of a Byelorussian (Russian peat corer constructed from carbon fibre composite (CFC are described. The availability of this new composite material introduces new possibilities for constructing field instruments that are as strong as, or stronger than, equipment made from steel and other metals. One advantage is a significant weight reduction. A 10.5 metre coring set in standard stainless and soft steel weighs around 16 kg, whereas the total weight of a similar CFC set is 5.2 kg, giving a weight reduction of almost 70%. The CFC sample chamber is 500 mm long with internal diameter 65 mm, and so contains almost twice the volume of peat that can be collected with a standard 45 mm diameter steel corer. The diameter of the rods is 30 mm, which improves ergonomics, and the CFC has better thermic properties for winter use. Another advantage is that the contamination of samples (notably by chromium and nickel associated with the use of steel corers is eliminated. The CFC sampler works well in soft peats such as Sphagnum and Carex types. It is less suitable for little-decomposed fibrous and forest peats (e.g. Polytrichum type and those containing hardwood remains, especially in the more compacted bottom layers. It should be totally satisfactory for organic lake sediments, but probably not for stiff and coarse mineral deposits.

  3. Campaigns Matter

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Pedersen, Rasmus Tue

    2014-01-01

    Election campaigns are more than simple competitions for votes; they also represent an opportunity for voters to become politically knowledgeable and engaged. Using a large-scale web panel (n≈5,000), we track the development of political knowledge, internal efficacy and external efficacy among vo...... external efficacy. The findings suggest that positive campaign effects are universal across various media and party systems....... and the external efficacy increase over the course of the campaign, with gains found across different demographic groups, particularly narrowing the gaps in internal efficacy. The news media play a crucial role, as increased knowledge and efficacy are partly driven by media use, although tabloids actually decrease...

  4. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION

    Science.gov (United States)

    The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...

  5. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  6. Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions

    Science.gov (United States)

    Laube, Johannes C.; Hanif, Norfazrin Mohd; Martinerie, Patricia; Gallacher, Eileen; Fraser, Paul J.; Langenfelds, Ray; Brenninkmeijer, Carl A. M.; Schwander, Jakob; Witrant, Emmanuel; Wang, Jia-Lin; Ou-Yang, Chang-Feng; Gooch, Lauren J.; Reeves, Claire E.; Sturges, William T.; Oram, David E.

    2016-12-01

    Chlorofluorocarbons (CFCs) are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4). Of particular interest here is the differentiation between CFC-114 (CClF2CClF2) and its asymmetric isomeric form CFC-114a (CF3CCl2F) as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S), Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn) enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt) between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in international climate

  7. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  8. A carbon fibre composite (CFC) Byelorussian peat corer

    OpenAIRE

    2009-01-01

    The design specification, development and manufacture of a Byelorussian (Russian) peat corer constructed from carbon fibre composite (CFC) are described. The availability of this new composite material introduces new possibilities for constructing field instruments that are as strong as, or stronger than, equipment made from steel and other metals. One advantage is a significant weight reduction. A 10.5 metre coring set in standard stainless and soft steel weighs around 16 kg, whereas the tot...

  9. Performance and heat transfer characteristics of HFC-134a and CFC-12 in a water chiller

    Energy Technology Data Exchange (ETDEWEB)

    Devotta, S.; Parande, M.G.; Patwardhan, V.R. [National Chemical Lab., Pune (India)

    1998-07-01

    A water chiller with an open reciprocating compressor has been used to comparatively assess the performance of HFC-134a with reference to CFC-12 under as close to identical conditions as possible. Performance characteristics of the chiller under retrofit conditions show that HFC-134a offers better cooling load and coefficients of performance vis-a-vis CFC-12 for identical operating conditions. Further heat transfer analysis of data for the condenser shows that the condensing heat transfer coefficients for HFC-134a are superior to CFC-12. The better performance of HFC-134a may be ascribed to the better heat transfer coefficient of HFC-134a over CFC-12. (Author)

  10. Organizational Campaigning

    DEFF Research Database (Denmark)

    Hertel, Frederik

    2015-01-01

    This conference paper will explore the difference between communicating changes and changing communication. Based on a case study in which a manager applies two quite different approaches to organizational communication in order to change the organization he is leading. The first and failing...... approach will in be named: organizational campaigning and means (e.g. Kotter, 2012, p. 9 and Clegg, Kornberger & Pitsis, 2009) that the manager takes control with communication and communication cannels in order to ensure successful organizational changes. Since the changes were not succeeding the approach...... is replaced with a new approach which will be named organizing communication. During the case analysis we will see that this change in approach not only change the managers perception of communication but also his perception of the organization he is leading....

  11. CFC-11, CFC-12 and HCFC-22 ground-based remote sensing FTIR measurements at Réunion Island and comparisons with MIPAS/ENVISAT data

    Science.gov (United States)

    Zhou, Minqiang; Vigouroux, Corinne; Langerock, Bavo; Wang, Pucai; Dutton, Geoff; Hermans, Christian; Kumps, Nicolas; Metzger, Jean-Marc; Toon, Geoff; De Mazière, Martine

    2016-11-01

    Profiles of CFC-11 (CCl3F), CFC-12 (CCl2F2) and HCFC-22 (CHF2Cl) have been obtained from Fourier transform infrared (FTIR) solar absorption measurements above the Saint-Denis (St Denis) and Maïdo sites at Réunion Island (21° S, 55° E) with low vertical resolution. FTIR profile retrievals are performed by the well-established SFIT4 program and the detail retrieval strategies along with the systematic/random uncertainties of CFC-11, CFC-12 and HCFC-22 are discussed in this study. The FTIR data of all three species are sensitive to the whole troposphere and the lowermost stratosphere, with the peak sensitivity between 5 and 10 km. The ground-based FTIR data have been compared with the collocated Michelson Interferometer for Passive Atmospheric Sounding (MIPAS/ENVISAT) data and found to be in good agreement: the observed mean relative biases and standard deviations of the differences between the smoothed MIPAS and FTIR partial columns (6-30 km) are (-4.3 and 4.4 %), (-2.9 and 4.6 %) and (-0.7 and 4.8 %) for CFC-11, CFC-12 and HCFC-22, respectively, which are within the combined error budgets from both measurements. The season cycles of CFC-11, CFC-12 and HCFC-22 from FTIR measurements and MIPAS data show a similar variation: concentration is highest in February-April and lowest in August-October. The trends derived from the combined St Denis and Maïdo FTIR time series are -0.86 ± 0.12 and 2.84 ± 0.06 % year-1 for CFC-11 and HCFC-22, respectively, for the period 2004 to 2016, and -0.76 ± 0.05 % year-1 for CFC-12 for 2009 to 2016. These measurements are consistent with the trends observed by the National Oceanic and Atmospheric Administration (NOAA) Global Monitoring Division's (GMD) Halocarbons & other Atmospheric Trace Species Group (HATS) measurements at Samoa (14.2° S, 170.5° W) for CFC-11 (-0.87 ± 0.04 % year-1), but slightly weaker for HCFC-22 (3.46 ± 0.05 %) year-1 and stronger for CFC-12 (-0.60 ± 0.02 % year-1).

  12. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2016-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) aboard the European satellite Envisat have been retrieved from versions MIPAS/4.61 to MIPAS/4.62 and MIPAS/5.02 to MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon-borne cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS-STRatospheric aircraft (MIPAS-STR), the satellite-borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS), as well as the ground-based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (full resolution, FR: July 2002-March 2004) and were used to validate MIPAS CFC-11 and CFC-12 products during that time, as well as profiles from the Improved Limb Atmospheric Spectrometer, ILAS-II. In general, we find that MIPAS shows slightly higher values for CFC-11 at the lower end of the profiles (below ˜ 15 km) and in a comparison of HATS ground-based data and MIPAS measurements at 3 km below the tropopause. Differences range from approximately 10 to 50 pptv ( ˜ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11 and is not as obvious in the relative differences between MIPAS and any of the comparison instruments. Differences at the lower end of the profile (below ˜ 15 km) and in

  13. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11

    Science.gov (United States)

    The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...

  14. Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors.

    Directory of Open Access Journals (Sweden)

    Simon K Cheng

    2004-02-01

    Full Text Available Members of the EGF-CFC family play essential roles in embryonic development and have been implicated in tumorigenesis. The TGFbeta signals Nodal and Vg1/GDF1, but not Activin, require EGF-CFC coreceptors to activate Activin receptors. We report that the TGFbeta signaling antagonist Lefty also acts through an EGF-CFC-dependent mechanism. Lefty inhibits Nodal and Vg1 signaling, but not Activin signaling. Lefty genetically interacts with EGF-CFC proteins and competes with Nodal for binding to these coreceptors. Chimeras between Activin and Nodal or Vg1 identify a 14 amino acid region that confers independence from EGF-CFC coreceptors and resistance to Lefty. These results indicate that coreceptors are targets for both TGFbeta agonists and antagonists and suggest that subtle sequence variations in TGFbeta signals result in greater ligand diversity.

  15. Field Campaign Guidelines

    Energy Technology Data Exchange (ETDEWEB)

    Voyles, J. W. [DOE ARM Climate Research Facility, Washington, DC (United States); Chapman, L. A. [DOE ARM Climate Research Facility, Washington, DC (United States)

    2015-12-01

    This document establishes a common set of guidelines for the Atmospheric Radiation Measurement (ARM) Climate Research Facility for planning, executing, and closing out field campaigns. The steps that guide individual field campaigns are described in the Field Campaign Tracking System and are specifically tailored to meet the scope of each field campaign.

  16. Global CFC-11 (CFCl3 and CFC-12 (CF2Cl2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-07-01

    Full Text Available Vertical profiles of CFC-11 (CFCl3 and CFC-12 (CF2Cl2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  17. Global CFC-11 (CCl3F and CFC-12 (CCl2F2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-12-01

    Full Text Available Vertical profiles of CFC-11 (CCl3F and CFC-12 (CCl2F2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  18. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Ronald H. Brown Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Section A16S_2005 (11 January - 24 February, 2005)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-08-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb 14C system parameters performed during the A16S_2005 cruise, which took place from January 11 to February 24, 2005, aboard research vessel (R/V) Ronald H. Brown under the auspices of the National Oceanic and Atmospheric Administration (NOAA). The R/V Ronald H. Brown departed Punta Arenas, Chile, on January 11, 2005, and ended its cruise in Fortaleza, Brazil, on February 24, 2005. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and the National Science Foundation as part of the CLIVAR/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 121 stations. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), fugacity of CO2 (fCO2), total alkalinity (TALK), pH, dissolved organic carbon (DOC), CFC, 14C, hydrographic, and other chemical measurements. The R/V Ronald H. Brown A16S_2005 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  19. 77 FR 28639 - Meeting of the CFC-50 Commission

    Science.gov (United States)

    2012-05-15

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of Personnel Management,...

  20. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  1. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  2. CFC+: Improved dynamics and gravitational waveforms from relativistic core collapse simulations

    CERN Document Server

    Cerdá-Durán, P; Dimmelmeier, H; Font, J A; Ibáñez, J M; Müller, E; Schäfer, G

    2004-01-01

    Core collapse supernovae are a promising source of detectable gravitational waves. Most of the existing (multidimensional) numerical simulations of core collapse in general relativity have been done using approximations of the Einstein field equations. As recently shown by Dimmelmeier et al (2002a,b), one of the most interesting such approximation is the so-called conformal flatness condition (CFC) of Isenberg, Wilson and Mathews. Building on this previous work we present here new results from numerical simulations of relativistic rotational core collapse in axisymmetry, aiming at improving the dynamics and the gravitational waveforms. The computer code used for these simulations evolves the coupled system of metric and fluid equations using the 3+1 formalism, specialized to a new framework for the gravitational field equations which we call CFC+. In this approach we add new degrees of freedom to the original CFC equations, which extend them by terms of second post-Newtonian order. The corrections for CFC+ ar...

  3. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  4. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  5. Campaign Consultants - Client Payments

    Data.gov (United States)

    City of San Francisco — Campaign Consultants are required to report ���economic consideration�۝ promised by or received from clients in exchange for campaign consulting services during the...

  6. The "Know Stroke" Campaign

    Science.gov (United States)

    ... Current Issue Past Issues Special Section The "Know Stroke" Campaign Past Issues / Summer 2007 Table of Contents ... campaign for the U.S. Hispanic community. 1 Know Stroke A stroke occurs when the blood supply to ...

  7. Distribution and ventilation of water masses in the western Ross Sea inferred from CFC measurements

    Science.gov (United States)

    Rivaro, Paola; Ianni, Carmela; Magi, Emanuele; Massolo, Serena; Budillon, Giorgio; Smethie, William M.

    2015-03-01

    During the CLIMA Project (R.V. Italica cruise PNRA XVI, January-February 2001), hydrographic and chlorofluorocarbons (CFCs) observations were obtained, particularly in the western Ross Sea. Their distribution demonstrated water mass structure and ventilation processes in the investigated areas. In the surface waters (AASW) the CFC saturation levels varied spatially: CFCs were undersaturated in all the areas (range from 80 to 90%), with the exception of few stations sampled near Ross Island. In particular, the Terra Nova Bay polynya, where high salinity shelf water (HSSW) is produced, was a low-saturated surface area (74%) with respect to CFCs. Throughout most of the shelf area, the presence of modified circumpolar deep water (MCDW) was reflected in a mid-depth CFC concentration minima. Beneath the MCDW, CFC concentrations generally increased in the shelf waters towards the seafloor. We estimated that the corresponding CFCs saturation level in the source water region for HSSW was about 68-70%. Waters with high CFC concentrations were detected in the western Ross Sea on the down slope side of the Drygalski Trough, indicating that AABW was being supplied to the deep Antarctic Basin. Estimates of ventilation ages depend strongly on the saturation levels. We calculated ventilation ages using the saturation level calibrated tracer ratio, CFC11/CFC12. We deduced a mean residence time of the shelf waters of about 6-7 years between the western Ross Sea source and the shelf break.

  8. PERBANDINGAN IMPLEMENTASI ADVERTISING CAMPAIGN

    OpenAIRE

    Francisca Hanna , Febrianti

    2013-01-01

    Advertising campaign merupakan serangkaian bentuk iklan melalui berbagai media dan berpusat pada satu tema dalam satu waktu. Tujuan utama advertising campaign adalah menyampaikan pesan dalam suatu tema yang diluncurkan kepada masyarakat sehingga tema tersebut menjadi ciri khas produk. Peluncuran tema campaign oleh Coca Cola dan Pepsi yang merupakan rival dalam kategori beverage merupakan obyek dari penelitian ini. Kesuksesan sebuah tema advertising campaign dilihat dengan menggunakan paramet...

  9. Diversity: A Corporate Campaign

    Science.gov (United States)

    Akiyama, Diana D.

    2008-01-01

    In this article, the author calls for a "campaign" because she believes there is a need to build upon the successes of diversity initiatives with renewed commitment, in much the same way as capital campaigns build upon past successes and refocus campuses on their work. Just as a capital campaign invests in financial stability by stimulating…

  10. The Sprite 2003 Campaign

    DEFF Research Database (Denmark)

    Neubert, T.; Laursen, S.; Rasmussen, I. L.;

    2003-01-01

    During the northern hemisphere summer of 2003, from July 18 to September 18, a sprite observation campaign was conducted with measurements from Southern Europe, coordinated with measurements from the magnetically conjugate region in South Africa. The goal of the campaign was to investigate...... emissions. The presentation will give an overview of the campaign, the meteorological conditions, and present some first results....

  11. Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate

    Directory of Open Access Journals (Sweden)

    Gopala Krishna Murthy Talasila

    2013-06-01

    Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.

  12. TRACER: an EXCEL workbook to calculate mean residence time in groundwater by use of tracers CFC-11, CFC-12 and tritium

    Science.gov (United States)

    Bayari, Serdar

    2002-06-01

    An EXCEL workbook is presented for calculating the mean residence time of groundwater based on the environmental tracers, tritium, CFC-11 and CFC-12. The program TRACER is written in Visual Basic for Application language and uses piston, exponential, linear, exponential-piston and linear-piston flow types of lumped-parameter models. Input and output data are stored in worksheets and a graph of results that are best fitted to observations is drawn for visual evaluation. Recharge temperature and altitude are used to convert atmospheric partial pressures of CFC-11 and CFC-12 to dissolved concentrations to provide a direct comparison between the models' output and observed data. The model can also be used to check whether an inferred flow type could be valid in the groundwater system being investigated. Other radioactive and gaseous environmental tracers and reactions such as, sorption and degradation can be included either as decay constant or with modifications in the program code. TRACER matches, satisfactorily, the results obtained from other softwares.

  13. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  14. A Political Campaign Strategy and Campaign Theme : How to Win a Political Campaign

    OpenAIRE

    河村, 直幸; Kawamura, Naoyuki

    2004-01-01

    The aim of this research paper is to introduce a political campaign strategy. A political campaign should do on a scientific system and needs effective strategy. Before political campaign begin, a candidate and its campaigner needs to analyze election district and sample voter opinion. An election campaign needs campaign theme. The creation of campaign theme needs careful and elaborate planning. A style of campaign varies according to incumbent or challenger. The developing of an effective po...

  15. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  16. Surface damage characteristics of CFC and tungsten with repetitive ELM-like pulsed plasma irradiation

    Science.gov (United States)

    Kikuchi, Y.; Nishijima, D.; Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M.; Kawai, T.; Ueda, Y.; Fukumoto, N.; Doerner, R. P.

    2011-08-01

    Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of ˜0.5 ms, incident ion energy of ˜30 eV, and surface absorbed energy density of ˜0.3-0.7 MJ/m2. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of ˜0.7 MJ/m2, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.

  17. High RF power test of a CFC antenna module for lower hybrid current drive

    Energy Technology Data Exchange (ETDEWEB)

    Maebara, S.; Seki, M.; Ikeda, Y.; Kiyono, K.; Suganuma, K.; Imai, T. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment; Goniche, M.; Bibet, Ph.; Brossaud, J.; Cano, V.; Kazarian-Vibert, F.; Froissard, P.; Rey, G. [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. de Recherches sur la Fusion Controlee

    1998-07-01

    A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m{sup 2} were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m{sup 2}, could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10{sup -2} Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)

  18. Catalytic hydrolysis of CFC-12 over solid acid Ti(SO4)2

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The catalytic hydrolysis of dichlorodifluoromethane (CFC-12) was investigated over solid acid Ti(SO4)2. The catalytic activity decreased with the calcination temperature. When space velocity was 6 l h-1 g-cat-1, the CFC-12 conversion at 310oC over Ti(SO4)2 calcined at 350oC remained about 98.5% during 360 h on stream, and the selectivity to by-products remained zero. The findings enlarged the scope of traditional catalyst systems for the CFCs decomposition.

  19. Chlorofluorocarbons (CFC's): Regulation and replacement. (Latest citations from the PIRA Ppackaging, Paper, Printing, and Publishing, and Nonwovens abstracts database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The bibliography contains citations concerning chlorofluorocarbons (CFC's), and efforts to find substitute materials in response to the need to lessen the environmental impact of CFC on the ozone layer, as agreed to in the international Montreal Protocol. CFC alternatives are expected to be used as aerosol propellants, blowing agents, refrigerants, fire extinguishants, and solvents. References to the effects of CFC on ozone are found in separate bibliographies. (Contains 250 citations and includes a subject term index and title list.)

  20. 75 FR 43395 - Campaign Travel

    Science.gov (United States)

    2010-07-26

    ... Campaign Travel AGENCY: Federal Election Commission. ACTION: Announcement of effective date. SUMMARY: On... of the Honest Leadership and Open Government Act governing campaign travel on noncommercial aircraft.... SUPPLEMENTARY INFORMATION: On December 7, 2009, the Commission published final rules governing campaign...

  1. Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G., E-mail: gaelle.chevet@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Martin, E., E-mail: martin@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Camus, G., E-mail: camus@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Herb, V., E-mail: herb@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Schlosser, J., E-mail: jacques.schlosser@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Escourbiac, F., E-mail: frederic.escourbiac@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Missirlian, M., E-mail: marc.missirlian@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France)

    2011-10-01

    The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.

  2. Research on interactions of plasma streams with CFC targets in the Rod Plasma Injector facility

    Directory of Open Access Journals (Sweden)

    Zaloga Dobromil R.

    2016-06-01

    Full Text Available This paper present results of optical spectroscopy studies of interactions of intense plasma streams with a solid target made of carbon fibre composite (CFC. The experiments were carried out within the Rod Plasma Injector (RPI IBIS facility. The optical measurements were performed first for a freely propagating plasma stream in order to determine the optimal operational parameters of this facility. Optical emission spectra (OES were recorded for different operational modes of the RPI IBIS device, and spectral lines were identified originating from the working gas (deuterium as well as some lines from the electrode material (molybdenum. Subsequently, optical measurements of plasma interacting with the CFC target were performed. In the optical spectra recorded with the irradiated CFC samples, in addition to deuterium and molybdenum lines, many carbon lines, which enabled to estimate erosion of the investigated targets, were recorded. In order to study changes in the irradiated CFC samples, their surfaces were analysed (before and after several plasma discharges by means of scanning electron microscope (SEM and energy dispersive spectroscopy (EDS techniques. The analysis of the obtained SEM images showed that the plasma irradiation induces noticeable changes in the surface morphology, for example vaporisation of some carbon fibres and formation of microcracks. The obtained EDS images showed that upon the irradiated target surface, some impurity ions are also deposited, particularly molybdenum ions from the applied electrodes.

  3. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  4. The Eurosprite 2005 campaign

    DEFF Research Database (Denmark)

    Arnone, Enrico; Berg, Peter; Boberg, Fredrik

    2008-01-01

    at two locations in southern France. In total 64 sprite events were captured. Due to unfavourable conditions, none of these were captured simultaneously at both stations. The campaigns constitute a long-term effort but have already provided several new results, mainly concerning the correlation between...... optical and non-optical means of sprite detection. The campaigns will be extended into a global sprite-watch partnership and in addition space-borne instruments will be deployed....

  5. Development of residual thermal stress-relieving structure of CFC monoblock target for JT-60SA divertor

    Energy Technology Data Exchange (ETDEWEB)

    Tsuru, Daigo, E-mail: tsuru.daigo@jaea.go.jp; Sakurai, Shinji; Nakamura, Shigetoshi; Ozaki, Hidetsugu; Seki, Yohji; Yokoyama, Kenji; Suzuki, Satoshi

    2015-10-15

    Highlights: • We carried out numerical simulations on residual thermal stress of targets for the JT-60SA divertor. • We developed three measures to reduce residual thermal stress. • We proposed two structures of CFC monoblock target for the JT-60SA divertor. • We confirmed the effectiveness of the structure by infrared thermography inspection and high heat flux test. - Abstract: Carbon fibre-reinforced carbon composite (CFC) monoblock target for JT-60SA divertor is under development towards the mass-production. CFC monoblocks, WCu interlayers and a CuCrZr cooling tube at the centre of the monoblocks were bonded by vacuum brazing in a high temperature, to a target. If residual thermal stress due to difference of thermal expansions between CFC and CuCrZr exceeds the maximum allowable stress of the CFC after the bonding, cracks are generated in the CFC monoblock and heat removal capacity of the target degrades. In this paper, new structures of the targets were proposed, to reduce residual thermal stress and to mitigate the degradation of heat removal capacity of the targets. Some measures, including slitting of the CFC monoblock aside of the cooling tube, replacement of the interlayer material and shifting the position of the cooling tube, were implemented. The effectiveness of the measures was evaluated by numerical simulations. Target mock-ups with the proposed structures were manufactured. Infrared thermography inspection and high heat flux test were carried out on the mock-ups in order to evaluate the heat removal capacity.

  6. Kinetic characterization of Aspergillus niger chitinase CfcI using a HPAEC-PAD method for native chitin oligosaccharides.

    Science.gov (United States)

    van Munster, Jolanda M; Sanders, Peter; ten Kate, Geralt A; Dijkhuizen, Lubbert; van der Maarel, Marc J E C

    2015-04-30

    The abundant polymer chitin can be degraded by chitinases (EC 3.2.1.14) and β-N-acetyl-hexosaminidases (EC 3.2.1.52) to oligosaccharides and N-acetyl-glucosamine (GlcNAc) monomers. Kinetic characterization of these enzymes requires product quantification by an assay method with a low detection limit, preferably compatible with the use of native, non-labeled substrates. Here we report a quantitative HPAEC-PAD method that allows fast separation of chitin oligosaccharides (COS) ranging from (GlcNac)1-6 at detection limits of 1-3 pmol and a linear range of 5-250 pmol. Quantification under intra- and interday precision conditions was performed with 2.1-5.4% relative standard deviation (RSD) and 1.2-10.3% RSD, respectively. This method was successfully used for the determination of the kinetic parameters of the Aspergillus niger chitinase CfcI with native COS. CfcI was recently shown to release GlcNAc from the reducing end of COS, a new activity for fungal chitinases. A Carbohydrate Binding Module of family 18 (CBM18) is inserted in the CfcI catalytic domain. Site directed mutagenesis was used to assess the functionality of this CfcI-CBM18: four of its key amino acids were replaced by glycine residues, yielding CfcISYNF. Comparison of the kinetic parameters of CfcI and CfcISYNF confirmed that this CBM18 is functionally involved in catalysis.

  7. INTEGRATED ADVERTISING CAMPAIGN

    Directory of Open Access Journals (Sweden)

    Adina Claudia NEAMŢU

    2010-06-01

    Full Text Available Campaign and especially advertising campaign represents one of the variables of the marketing mix, an important one, being difficult to separate its contribution from the one of the other elements. Irrespective of the specific object that is behind an advertising company, the investment will be retrieved only if the right information is transmitted to the right persons in the right way. This is difficult to accomplish if the advertising responsible in that firm do not understand appropriately: the market nature; the product nature; the distribution channels nature; the communication channels nature – available advertising supports and their features

  8. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  9. Subtractive hybridization identifies chick-cripto, a novel EGF-CFC ortholog expressed during gastrulation, neurulation and early cardiogenesis.

    Science.gov (United States)

    Colas, J F; Schoenwolf, G C

    2000-09-19

    EGF-CFC genes encode a novel class of extracellular, membrane-associated proteins that notably play an important role during vertebrate gastrulation. Whereas the two cysteine-rich domains that characterize these proteins, namely the extracellular EGF-like and the CFC domain, are known to be encoded by two evolutionarily conserved exons, it is generally assumed, based on weak primary sequence identity, that the remaining parts of the protein differ among vertebrates, suggesting that known members of the EGF-CFC family do not represent true orthologs. Here, by characterizing the full cDNA and genomic sequences of a new EGF-CFC gene in chick, and by comparing them with their counterparts in human (CRIPTO), mouse (cripto and cryptic), Xenopus (FRL-1) and zebrafish (one-eyed pinhead), we show that all EGF-CFC genes share an identical genomic organization over the entire coding region. Not only are the central two exons (coding for the EGF-like and CFC motifs) conserved, but also conserved are the total number of exons, their size, their intron phase and their correlation with discrete protein modules, in particular those modules that allow the EGF-CFC motif to become membrane-associated. Therefore, despite apparent divergence between their 5' and 3'-terminal exons, all known CRIPTO-related genes are structurally orthologous. We named this novel ortholog in bird, chick-cripto. We report the mRNA distribution of chick-cripto, which begins in the epiblast of the gastrula, with a pattern similar to EGF-CFC genes of other vertebrates.

  10. Results of the JET real-time disruption predictor in the ITER-like wall campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Jesús, E-mail: jesus.vega@ciemat.es [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Dormido-Canto, Sebastián [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); López, Juan M. [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Murari, Andrea [Consorzio RFX, Associazione EURATOM/ENEA per la Fusione, Padua (Italy); Ramírez, Jesús M. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Moreno, Raúl [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Ruiz, Mariano [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Alves, Diogo [Associação EURATOM/IST, Instituto de Plasmas e Fusão Nuclear – Laboratório Associado, Instituto Superior Técnico, P-1049-001 Lisboa (Portugal); Felton, Robert [EURATOM/CCFE Fusion Association, Culham Science Center, Abingdon, Oxon OX14 3DB (United Kingdom)

    2013-10-15

    Highlights: •JET real-time disruption predictor with metallic wall 991 discharges analyzed. •Predictor training has been carried out with JET C wall data. •Success, false alarm and missed alarm rates are 98.4%, 0.9% and 1.6%, respectively. •Alarms are triggered in average 426 ms before the disruption. -- Abstract: The impact of disruptions in JET became even more important with the replacement of the previous Carbon Fiber Composite (CFC) wall with a more fragile full metal ITER-like wall (ILW). The development of robust disruption mitigation systems is crucial for JET (and also for ITER). Moreover, a reliable real-time (RT) disruption predictor is a pre-requisite to any mitigation method. The Advance Predictor Of DISruptions (APODIS) has been installed in the JET Real-Time Data Network (RTDN) for the RT recognition of disruptions. The predictor operates with the new ILW but it has been trained only with discharges belonging to campaigns with the CFC wall. 7 real-time signals are used to characterize the plasma status (disruptive or non-disruptive) at regular intervals of 32 ms. After the first 3 JET ILW campaigns (991 discharges), the success rate of the predictor is 98.36% (alarms are triggered in average 426 ms before the disruptions). The false alarm and missed alarm rates are 0.92% and 1.64%.

  11. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  12. Tungsten coatings electro-deposited on CFC substrates from oxide molten salt

    Science.gov (United States)

    Sun, Ningbo; Zhang, Yingchun; Lang, Shaoting; Jiang, Fan; Wang, Lili

    2014-12-01

    Tungsten is considered as plasma facing material in fusion devices because of its high melting point, its good thermal conductivity, its low erosion rate and its benign neutron activation properties. On the other hand, carbon based materials like C/C fiber composites (CFC) have been used for plasma facing materials (PFMs) due to their high thermal shock resistance, light weight and high strength. Tungsten coatings on CFC substrates are used in the JET divertor in the frame of the JET ITER-like wall project, and have been prepared by plasma spray (PS) and other techniques. In this study, tungsten coatings were electro-deposited on CFC from Na2WO4-WO3 molten salt under various deposition parameters at 900 °C in air. In order to obtain tungsten coatings with excellent performance, the effects of pulse duration ratio and pulse current density on microstructures and crystal structures of tungsten coatings were investigated by X-ray diffraction (XRD, Rigaku Industrial Co., Ltd., D/MAX-RB) and a scanning electron microscope (SEM, JSM 6480LV). It is found that the pulsed duration ratio and pulse current density had a significant influence on tungsten nucleation and electro-crystallization phenomena. SEM observation revealed that intact, uniform and dense tungsten coatings formed on the CFC substrates. Both the average grain size and thickness of the coating increased with the pulsed current density. The XRD results showed that the coatings consisted of a single phase of tungsten with the body centered cubic (BCC) structure. The oxygen content of electro-deposited tungsten coatings was lower than 0.05%, and the micro-hardness was about 400 HV.

  13. CFC/Cu bond damage in actively cooled plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Schlosser, J [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Martin, E [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Pessac (France); Henninger, C [LMM, CNRS UMR 7607, Universite P. et M. Curie, Paris (France); Boscary, J [IPP-Euratom Association, Garching (Germany); Camus, G [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Pessac (France); Escourbiac, F [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Leguillon, D [LMM, CNRS UMR 7607, Universite P. et M. Curie, Paris (France); Missirlian, M [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Mitteau, R [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France)

    2007-03-15

    Carbon fibre composite (CFC) armours have been successfully used for actively cooled plasma facing components (PFCs) of the Tore Supra (TS) tokamak. They were also selected for the divertor of the stellarator W7-X under construction and for the vertical target of the ITER divertor. In TS and W7-X a flat tile design for heat fluxes of 10 MW m{sup -2} has been chosen. To predict the lifetime of such PFCs, it is necessary to analyse the damage mechanisms and to model the damage propagation when the component is exposed to thermal cycling loads. Work has been performed to identify a constitutive law for the CFC and parameters to model crack propagation from the edge singularity. The aim is to predict damage rates and to propose geometric or material improvements to increase the strength and the lifetime of the interfacial bond. For ITER a tube-in-tile concept (monoblock), designed to sustain heat fluxes up to 20 MW m{sup -2}, has been developed. The optimization of the CFC/Cu bond, proposed for flat tiles, could be adopted for the monoblock concept.

  14. Thermal fatigue characterization of CFC divertor modules using a one step brazing process

    Science.gov (United States)

    Pintsuk, G.; Casalegno, V.; Ferraris, M.; Koppitz, T.; Salvo, M.

    2012-07-01

    From the European side, three directional carbon fiber composites (CFCs) are foreseen to be used as plasma facing material for the strike point region of the initial ITER divertor installed for the non-tritium operational phase. For such divertor components two designs, the flat tile and the monoblock concept, are feasible, comprising a joint of the CFC with a Cu/Cu-alloy heat sink. This paper deals with the qualification of a reliable and cheap joining technology for such components, i.e. the simultaneous joining of the CuCrZr heat sink to a compliant Cu layer for the accommodation of thermal stresses and of the Cu layer and the CFC using a non-active Cu-Ge brazing material. For this purpose flat tile and monoblock mock-ups were manufactured, microstructurally analyzed, and subsequently exposed to cyclic high heat flux tests in the electron beam facility JUDITH. Applying hundreds of cycles at up to 20 MW/m2 the tested mock-ups underwent partial damaging, which was characterized in post-mortem microstructural investigations to analyze occurring degradation mechanisms, e.g. partial delamination at the CFC/Cu-interface.

  15. New computer security campaign

    CERN Multimedia

    Alizée Dauvergne

    2010-01-01

    A new campaign is taking shape to promote computer security. The slogan “SEC_RITY is not complete without U!” reminds users of the importance of their contribution. The campaign kicks off on 10 June with a public awareness day in the Council Chamber.   The new campaign, organised by CERN’s computer security team, will focus on prevention and involving the user. “This is an education and awareness-raising campaign for all users at CERN,” explains Stefan Lueders, in charge of computer security. “Every day, we register thousands of computer attacks against CERN: there are attempts to tamper with web pages, hack into user accounts, take over servers, and much more. A successful attack could mean confidential user information being divulged, services being interrupted or data being lost. It could even affect operations at CERN. Another factor is the damage that a successful attack could inflict on the Organization’s reputation. &...

  16. Real Warriors Campaign

    Science.gov (United States)

    ... 966-1020 Live Chat MILITARY CRISIS LINE For crisis intervention 800-273-8255 , press 1 Find Care Seek Help Live Chat ABOUT US The Real Warriors Campaign is an initiative launched by the Defense Centers of Excellence for Psychological Health and Traumatic Brain Injury (DCoE) to promote ...

  17. Antipiracy Campaign Exasperates Colleges

    Science.gov (United States)

    Rampell, Catherine

    2008-01-01

    This article reports on the withdrawal of some universities' support of a music industry's campaign against music piracy on their campuses. Talk to the chief information officer at just about any American university, and he will probably say that his institution has bent over backward to help the Recording Industry Association of America curb…

  18. BLOOD DONORS CAMPAIGN

    CERN Multimedia

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion Sanguine of Geneva will be held at CERN on Tuesday 13 March 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  19. BLOOD DONORS CAMPAIGN

    CERN Multimedia

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion d'Annemasse will be held at CERN on Tuesday 14 November 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  20. BLOOD DONORS CAMPAIGN

    CERN Multimedia

    Medical Service

    2002-01-01

    Tuesday 19 March 2002 in restaurant nr 2, from 9.00 to 16.30 hrs A blood donors campaign, organized by the Centre de Transfusion sanguine of Geneva If you already have a card giving your blood group, please bring this with you.

  1. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2000-01-01

    A blood donors campaign, organized by the Établissement de Transfusion de Rhône-Alpes will be held at CERN on Tuesday 14 November 2000 in restaurant nr 2, from 8.30 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  2. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2002-01-01

    Wednesday 13 November 2002 in restaurant nr 2, from 8.30 to 16.30 hrs will be held a blood donors campaign, organized by the Etablissement de Transfusion de Haute-Savoie If you already have a card giving your blood group, please bring this with you.

  3. Twitter and political campaigning

    NARCIS (Netherlands)

    Vergeer, M.R.M.

    2015-01-01

    The use of Twitter by politicians, parties, and the general audience in politics, particularly during election campaigns, has become an extremely popular research field almost overnight. Even though Twitter, a medium that emerged early in 2006 – the first tweet was posted on 21 March 2006 by Jack Do

  4. Singapore's Speak Mandarin Campaign.

    Science.gov (United States)

    Newman, John

    1988-01-01

    Reviews the "Speak Mandarin Campaign," that is intended to persuade the Singaporean ethnic Chinese to use Mandarin in place of Chinese dialects. The purported educational, cultural, and practical advantages are discussed, and the support of higher education and the media is evaluated. (Author/CB)

  5. Campaign Finance: Reporter Guide

    Science.gov (United States)

    Wieder, Ben

    2014-01-01

    Campaign finance might seem like the exclusive province of political reporters, but there are many good reasons why authors should be paying attention--both in races for education positions and in other key races at the local, state, and federal levels with implications for education. Basic math is a necessary skill and familiarity with a…

  6. Campaigns in Agricultural Extension Programs.

    Science.gov (United States)

    Spaven, John W.

    A booklet designed to aid those who use agricultural campaigns in their educational and advisory programs is presented. It is pointed out that a good campaign works as a chain reaction, inciting enthusiasm among workers and planners. The five steps in a well-organized campaign are: (1) planning, (2) preparing people for their jobs, (3) producing…

  7. Surviving Sepsis Campaign

    DEFF Research Database (Denmark)

    Rhodes, Andrew; Evans, Laura E; Alhazzani, Waleed

    2017-01-01

    OBJECTIVE: To provide an update to "Surviving Sepsis Campaign Guidelines for Management of Sepsis and Septic Shock: 2012". DESIGN: A consensus committee of 55 international experts representing 25 international organizations was convened. Nominal groups were assembled at key international meetings...... and among the entire committee served as an integral part of the development. METHODS: The panel consisted of five sections: hemodynamics, infection, adjunctive therapies, metabolic, and ventilation. Population, intervention, comparison, and outcomes (PICO) questions were reviewed and updated as needed...

  8. Safety Campaign Continues

    CERN Multimedia

    2002-01-01

    If you see this poster, stop and read it! This is the third poster produced by TIS Division as part of its information campaign on health and safety in the workplace. It provides statistics on occupational accidents at CERN. You will see that, as in the rest of Europe, falls, slips and trips continue to be the main cause of accident. So, eyes open and take care! For more information : http://safety.cern.ch/

  9. The Movember campaign

    DEFF Research Database (Denmark)

    Thomsen, Frederik B; Mikkelsen, Marta K; Hansen, Rikke B;

    2016-01-01

    AIMS: The aims of the present study were to investigate referral patterns and the diagnosis of prostate cancer (PCa) before and after the Movember campaign was initiated in Denmark. METHODS: All men (n=2817) referred to the Department of Urology at Frederiksberg Hospital with suspicion of having....../100.000 in the Movember period (RR 1.25 [95% CI 1.16-1.35]). In contrast to what we anticipated, there was no increase in referral in the months following the campaign. The incidence rates of men diagnosed with PCa and low-risk PCa were similar in the Movember period and the pre-Movember period (PCa: RR 1.08 [0.......97-1.21]; low-risk PCa: RR 1.29 [0.98-1.73]). CONCLUSIONS: After the initiation of the Movember campaign a significant decline in the PSA level at referral and an increase in the number of patients referred under suspicion of PCa was observed; however, only minor differences in referral patterns and PCa...

  10. How campaigns polarize the electorate

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2015-01-01

    The minimal effect theory of campaign studies stipulates that intense political competition during campaigns assures and reinforces the initial party choice of the electorate. We find that this reinforcement is two-fold. During the campaign, the party preference of the voters’ in-group party...... resulting in stronger political polarization after the campaign than before the campaign. The data utilized in this study is a large six-wave panel-study of Danish voters’ party preferences during the Danish parliamentary election of 2011. Thus, the analysis provides evidence of the minimal effect theory...

  11. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system.

  12. Campaigning and Contestation

    DEFF Research Database (Denmark)

    Schwartz, Sander Andreas

    2015-01-01

    This article is a critical study of the Facebook pages of politicians as public spheres using Dahlberg’s notion of contestation. A method is implemented inspired by qualitative content analysis and including focus groups in order to study citizen comments on eight main political candidates......’ Facebook pages during the 2011 Danish election campaign. An analytical framework is presented that conceptualizes the particular platform as a dinner party, with a dinner table, a host, and the invited guests. The dinner party exhibits the interplay between these elements and how they limit the option...... of contesting the dominating discourse in favor of a supportive marketing logic....

  13. Initiation and propagation of damage in actively cooled CFC armoured high heat flux components in fusion machines

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France); Escourbiac, F. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France)

    2009-06-15

    Plasma facing components (PFCs) in magnetic confinement controlled fusion machines are armoured with carbon fibre composite (CFC) bonded to a copper alloy heat sink. The manufacturing process induces high level of residual stresses due to the thermal expansion mismatch between CFC and copper and PFCs have to withstand strong stress ranges during operation. To study the initiation and propagation of damage in the CFC part, the ONERA damage model is used to describe the behaviour of the N11 material. The finite element simulations show that the damage is located near the interface and develops during the manufacturing of the PFCs as a consequence of the high amplitude of shear stresses. Under high heat flux, stresses decrease and the damage does not evolve. Further studies will take into account the damageable behaviour of the composite/copper interface, which will lead to geometrical optimisations and better knowledge of the link between damage and conductivity.

  14. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V John V. Vickers Cruise in the Pacific Ocean (WOCE Section P13, NOAA CGC92 Cruise, August 4 - October 21, 1992)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, A.

    2001-01-11

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) and total alkalinity (TALK) at hydrographic stations during the R/V John V. Vickers oceanographic cruise in the Pacific Ocean (Section P13). Conducted as part of the World Ocean Circulation Experiment (WOCE) and the National Oceanic and Atmospheric Administration's Climate and Global Change Program, the cruise began in Los Angeles, California, on August 4, 1992, with a transit line (Leg 0) to Dutch Harbor, Alaska. On August 16, the ship departed Dutch Harbor on Leg 1 of WOCE section P13. On September 15, the R/V John V. Vickers arrived in Kwajalein, Marshall Islands, for emergency repairs, and after 11 days in port departed for Leg 2 of Section P13 on September 26. The cruise ended on October 21 in Noumea, New Caledonia. Measurements made along WOCE Section P13 included pressure, temperature, salinity [measured by a conductivity, temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO{sub 2} , and TALK. The TCO{sub 2} was measured by coulometry using a Single-Operator Multiparameter Metabolic Analyzer (SOMMA). The overall precision and accuracy of the analyses was {+-}2 {micro}mol/kg. Samples collected for TALK were measured by potentiometric titration; precision was {+-}2 {micro}mol/kg. The CO{sub 2} -related measurements aboard the R/V John V. Vickers were supported by the U.S. Department of Energy. The WOCE Section P13 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center. The NDP consists of two oceanographic data files, two FORTRAN 90 data-retrieval routine files, a documentation file, and this printed report, which describes the contents and format of all files as well as the procedures and methods used to obtain the data. Instructions on how to access the data are provided.

  15. CFCl3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime Uncertainty

    Science.gov (United States)

    McGillen, M.; Fleming, E. L.; Jackman, C. H.; Burkholder, J. B.

    2013-12-01

    CFCl3 (CFC-11) is both a major ozone-depleting substance and a potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95-230 nm) and temperature (216-296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using the NASA Goddard Space Flight Center 2-D coupled chemistry-radiation-dynamics model and the spectrum parameterization developed in this work. The modeled global annually averaged lifetime was 58.1 × 0.7 years (2σ uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current UV spectrum recommendations. CFCl 3 (CFC-11) 2-D model results: Left: Global annually averaged loss rate coefficient (local lifetime) and photolysis and reaction contributions (see legend). Middle: Molecular loss rate and uncertainty limits; the slow and fast profiles were calculated using the 2σ uncertainty estimates in the CFC-11 UV absorption spectrum from this work. Right: CFC-11 concentration profile. CFC-11 loss process contribution to the overall local lifetime uncertainty (2σ) calculated using the 2-D model (see text). Left: Results obtained from this work. Right: Results obtained using model input from Sander et al. [2011] and updates in SPARC [2013].

  16. Cyber-campaigning in Denmark

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2014-01-01

    We set out to analyze the application and effect of cyber-campaigning among candidates at the 2011 Danish general election campaign in order to provide hard evidence on whether new technologies are electorally decisive, or whether traditional off-line campaigning still makes sense. First, both web...... sites and Facebook sites are popular among candidates but other features such as blogs, feeds, newsletter, video uploads, SMS and twitter are used by less than half the candidates. Second, only age and possibly education seem to matter when explaining the uptake of cyber-campaigning. The prominent...... candidates are not significantly more likely to use cyber-campaigning tools and activities. Third, the analysis of the effect of cyber-campaigning shows that the online score has an effect on the inter-party competition for personal votes, but it does not have a significant effect when controlling for other...

  17. Strategic campaigns and redistributive politics

    DEFF Research Database (Denmark)

    Schultz, Christian

    2007-01-01

    The article investigates strategic, informative campaigning by two parties when politics concern redistribution. Voters are uncertain about whether parties favour special groups. Parties will target campaigns on groups where most votes are gained by informing about policies. In equilibrium......, campaigning will be most intensive in groups where the uncertainty is largest and where voters are most mobile, most likely to vote, most receptive to campaigns and relatively uninformed initially. These groups will become more informed about policy. Parties will therefore gain more votes by treating...

  18. The Ocean Literacy Campaign

    Science.gov (United States)

    Schoedinger, S. E.; Strang, C.

    2008-12-01

    "Ocean Literacy is an understanding of the ocean's influence on you and your influence on the ocean." This simple statement captures the spirit of a conceptual framework supporting ocean literacy (COSEE et al., 2005). The framework comprises 7 essential principles and 44 fundamental concepts an ocean literate person would know (COSEE et al., 2005). The framework is the result of an extensive grassroots effort to reach consensus on (1) a definition for ocean literacy and (2) an articulation of the most important concepts to be understood by ocean-literate citizen (Cava et al., 2005). In the process of reaching consensus on these "big ideas" about the ocean, what began as a series of workshops has emerged as a campaign "owned" by an ever-expanding community of individuals, organizations and networks involved in developing and promoting the framework. The Ocean Literacy Framework has provided a common language for scientists and educators working together and serves as key guidance for the ocean science education efforts. This presentation will focus on the impact this Ocean Literacy Campaign has had to date as well as efforts underway to provide additional tools to enable educators and educational policy makers to further integrate teaching and learning about the ocean and our coasts into formal K-12 education and informal education. COSEE, National Geographic Society, NOAA, College of Exploration (2005). Ocean Literacy: The Essential Principles of Ocean Sciences Grades K-12, a jointly published brochure, URL: http://www.coexploration.org/oceanliteracy/documents/OceanLitChart.pdf Cava, F., S. Schoedinger , C. Strang, and P. Tuddenham (2005). Science Content and Standards for Ocean Literacy: A Report on Ocean Literacy, URL: http://www.coexploration.org/oceanliteracy/documents/OLit2004-05_Final_Report.pdf.

  19. Multistage Campaigning in Social Networks

    CERN Document Server

    Farajtabar, Mehrdad; Harati, Sahar; Song, Le; Zha, Hongyuan

    2016-01-01

    We consider the problem of how to optimize multi-stage campaigning over social networks. The dynamic programming framework is employed to balance the high present reward and large penalty on low future outcome in the presence of extensive uncertainties. In particular, we establish theoretical foundations of optimal campaigning over social networks where the user activities are modeled as a multivariate Hawkes process, and we derive a time dependent linear relation between the intensity of exogenous events and several commonly used objective functions of campaigning. We further develop a convex dynamic programming framework for determining the optimal intervention policy that prescribes the required level of external drive at each stage for the desired campaigning result. Experiments on both synthetic data and the real-world MemeTracker dataset show that our algorithm can steer the user activities for optimal campaigning much more accurately than baselines.

  20. Complex Contagion of Campaign Donations

    CERN Document Server

    Traag, V A

    2016-01-01

    Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50 000 elites and examine how connectivity among previous donors reinforces contagion. We find the diffusion of donations to be driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the via...

  1. Solar Energy Campaign. 2008 Norwegian student-based web campaign

    Energy Technology Data Exchange (ETDEWEB)

    Randall, Scott

    2009-07-01

    Student research campaigns (forskningskampanjer) have been an annual event in connection to Research Days (Forskningsdagene) since 2003 in Norway. The campaigns invite students from all over the country to participate in a common scientific research event, always connected to a special environmentally related theme - for example Air Quality in the Classroom (2003), Pollution along Roads (2004), Bacteria in Drinking Water (2005), and The Rain Check (2006). The year 2008, as with previous years, was overshadowed by the topic of climate change, and the specific role of humans. The research campaign theme for 2008 fit well into this focus: the potential benefits of solar energy as an alternative energy source. The campaign also was aligned with the Research Days theme of alternative energy sources and technologies. The campaign included the hands-on activity of assembling a solar panel and taking measurements with the device to determine efficiency, as well as a questionnaire to record the results and ask deeper questions regarding alternative energy and climate change. The results gained from data analysis of the campaign show that students were able to gain maximum efficient solar power from the devices they constructed, which gave them a solid understanding of solar power technology. Analysis of the campaign questionnaire in regards to the activity shows that students believe that solar energy should be better utilized as an energy source in Norway. (Also in Norwegian OR 24/2009). (Author)

  2. The articulation of transnational campaigns

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2011-01-01

    The article traces the complex series of relations that are constitutive of transnational campaigning through empirical research, focusing on political campaigning critical of the WTO's General Agreement on Trade-in-Services. Applying the methodology of post-structuralist discourse theory......, as developed by Laclau and Mouffe, the article is able to move beyond the search for a ‘Global Civil Society' or ‘Transnational Advocacy Network', and instead focus on the articulatory process in which the relations central to transnational campaigning are produced. This empowers an analysis that is able...

  3. The Sprite 2005 Observation Campaign

    DEFF Research Database (Denmark)

    Chanrion, Olivier Arnaud; Crosby, Norma; Armone, Enrico

    2007-01-01

    The four year "Coupling of Atmospheric Layers (CAL)" EU FP5 Research Training Network project studied unanswered questions related to transient luminous events (sprites, jets and elves) in the upper atmosphere. Consisting of ten scientific work-packages CAL also included intensive training and ou......, to develop their organisational skills, and to enhance their ability to communicate their activities. The campaign was a unique opportunity to train and strengthen skills that will be an asset to their future careers and, overall, was most successful.......-month duration of this campaign, all of them took turns in operating the system and making their own night observations. The ongoing campaign activities were constantly advertised and communicated via an Internet blog. In summary the campaign required all the CAL young scientists to embark on experimental work...

  4. What influences crowdfunding campaign success.

    OpenAIRE

    Drabløs, Christian

    2015-01-01

    Crowdfunding is a recently emerged market for entrepreneurs; it represents a new and growing source of potential capital. The potential crowdfunding is starting to reach it potential, and has beginning to go mainstream. There is a gap in the research on crowdfunding and within the field of what separates a successful campaign from a failed one. To explore the variables influencing crowdfunding campaign this paper looks into academic articles, the crowdfunding platforms, general...

  5. CFCI3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime and Uncertainty

    Science.gov (United States)

    Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2014-01-01

    CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations

  6. High-performance, non-CFC-based thermal insulation: Gas filled panels

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, B.T.; Arasteh, D.; Selkowitz, S.

    1992-04-01

    Because of the forthcoming phase-out of CFCs and to comply with the more stringent building and appliance energy-use standards, researchers in industry and in the public sector are pursuing the development of non-CFC-based, high-performance insulation materials. This report describes the results of research and development of one alternative insulation material: highly insulating GFPs. GFPs insulate in two ways: by using a gas barrier envelope to encapsulate a low-thermal-conductivity gas or gas mixture (at atmospheric pressure), and by using low-emissivity baffles to effectively eliminate convective and radiative heat transfer. This approach has been used successfully to produce superinsulated windows. Unlike foams or fibrous insulations, GFPs are not a homogeneous material but rather an assembly of specialized components. The wide range of potential applications of GFPs (appliances, manufactured housing, site-built buildings, refrigerated transport, and so on) leads to several alternative embodiments. While the materials used for prototype GFPs are commercially available, further development of components may be necessary for commercial products. With the exception of a description of the panels that were independently tested, specific information concerning panel designs and materials is omitted for patent reasons; this material is the subject of a patent application by Lawrence Berkeley Laboratory.

  7. New and improved infrared absorption cross sections for dichlorodifluoromethane (CFC-12

    Directory of Open Access Journals (Sweden)

    J. J. Harrison

    2015-03-01

    Full Text Available Despite its widespread commercial use throughout the twentieth century, primarily in the refrigeration industry, dichlorodifluoromethane (CFC-12 is now known to have the undesirable effect of depleting stratospheric ozone. As this long-lived molecule slowly degrades in the atmosphere, monitoring its vertical concentration profile using infrared sounders on satellite platforms crucially requires accurate laboratory spectroscopic data. This work describes new high-resolution infrared absorption cross sections of dichlorodifluoromethane over the spectral range 800–1270 cm−1, determined from spectra recorded using a high-resolution Fourier transform spectrometer (Bruker IFS 125HR and a 26 cm-pathlength cell. Spectra of dichlorodifluoromethane/dry synthetic air mixtures were recorded at resolutions between 0.01 and 0.03 cm−1 (calculated as 0.9/MOPD; MOPD = maximum optical path difference over a range of temperatures and pressures (7.5–761 Torr and 190–294 K appropriate for atmospheric conditions. This new cross-section dataset improves upon the one currently available in the HITRAN and GEISA databases.

  8. The Effect of Political Campaigns

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller

    Abstract There are many somewhat competing models for measuring political campaign effects. This paper discusses six types of campaign effects. 1) The civic engagement effect that argues people will learn and become more political engaged due to the campaign. 2) The priming studies argue...... choice is based on sampling of the available information filtered through the voters' predisposition and in the light of their political awareness and sophistication. 5) Online based models argue that voters continuously incorporate the political discourses in their vote choice and then soon forget...... these discourses. 6) The shortcut based models highlight the various shortcuts to political choice (e.g. basic likes and dislikes). By reviewing how the models are applied in the literature the paper aims to focus on how the models are presented theoretically and carried out empirical, as well as on the validity...

  9. South Africa: defiance campaign continues.

    Science.gov (United States)

    2002-03-01

    The Treatment Action Campaign (TAC) has continued its "defiance campaign against patent abuse and AIDS profiteering." In partnership with Médecins Sans Frontières (Doctors Without Borders), and with the support of Oxfam and the Council of South African Trade Unions (COSATU), on 28 January 2002 three TAC members returned to South Africa from Brazil carrying generic versions of the antiretroviral drugs zidovudine (AZT), lamivudine (3TC), and nevirapine (NVP). Some of the imported capsules contain a combination of AZT and 3TC.

  10. Safety campaigns. TIS Launches New Safety Information Campaign

    CERN Multimedia

    2001-01-01

    Need to start a new installation and worried about safety aspects? Or are you newly responsible for safety matters in a CERN building? Perhaps you're simply interested in how to make the working environment safer for yourself and your colleagues. Whatever the case, a new information campaign launched by TIS this week can help. The most visible aspects of the new campaign will be posters distributed around the Laboratory treating a different subject each month. The Web site - http://safety.cern.ch/ - which provides all safety related information. But these are not the only aspects of the new campaign. Members of the TIS/GS group, whose contact details can be found on the safety web site, are available to give information and advice on a one-to-one basis at any time. The campaign's launch has been timed to coincide with European Safety Week, organized by the European Agency for Safety and Health at Work and the subject treated in the first posters is safety inspection. This particular topic only concerns thos...

  11. Keep Your Campaign Aim True

    Science.gov (United States)

    Collins, Mary Ellen

    2009-01-01

    Asking constituents to rally around a cause and make stretch gifts when they're already suffering unprecedented hits to their personal finances sounds more like a fool's errand than a best practice in fundraising. The economic crisis has added a tricky new aspect to operating in campaign mode, but savvy fundraisers haven't given up, scaled back,…

  12. Advanced Fuels Campaign 2012 Accomplishments

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2012-11-01

    The Advanced Fuels Campaign (AFC) under the Fuel Cycle Research and Development (FCRD) program is responsible for developing fuels technologies to support the various fuel cycle options defined in the DOE Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. The fiscal year 2012 (FY 2012) accomplishments are highlighted below. Kemal Pasamehmetoglu is the National Technical Director for AFC.

  13. Reprieve for Thailand's AIDS campaign.

    Science.gov (United States)

    Clements, A

    1992-07-25

    A promilitary coalition began to govern Thailand in March 1992. It reduced the budget for the original proposed national AIDS awareness campaign from 30 million British pounds to almost 15 million British pounds. The Ministry of Health professed that the campaign had exaggerated the problem of AIDS in Thailand and had damaged tourism. Yet prodemocracy demonstrations in Bangkok in which troops killed many protesters restored the politicians who started the AIDS campaign to power in May 1992. There were to remain in power until new elections in September 1992. In July, the Minister of Health, Mechai Viravaidya, said he would step down if the government did not completely restore the 30 million British pounds for the AIDS campaign. It then increased the budget to almost that amount. Mr. Viravaidya initiated Thailand's open policy on the AIDS crisis and was known as Mr. Condom. He claimed that at the present HIV prevalence rate, Thailand may have between 2-4 million HIV infected people by 2000. If the country would take on anti-AIDS efforts now, however, they could cut the spread of HIV by 75%. As of mid-1992, about 400,000 people living in Thailand were HIV positive. The AIDS campaign planned to sue the mass media to inform people about AIDS especially those in universities and schools and high risk occupational groups. The increasing number of construction workers in Bangkok and existing sex workers were a high risk occupational group. At the 2nd national seminar of AIDS, the Minister of Health reproached tourists who come to Thailand for its sex industry. He said that Thailand does not need the 1 billion British pounds they bring to Thailand annually, and Thais do not want their homeland to be referred to as the sex capital.

  14. News Media Framing of Negative Campaigning

    DEFF Research Database (Denmark)

    Pedersen, Rasmus Tue

    2014-01-01

    that news coverage of negative campaigning does apply the strategic game frame to a significantly larger degree than articles covering positive campaigning. This finding has significant implications for campaigning politicians and for scholars studying campaign and media effects.......News media coverage of election campaigns is often characterized by use of the strategic game frame and a focus on politicians’ use of negative campaigning. However, the exact relationship between these two characteristics of news coverage is largely unexplored. This article theorizes that consumer...... demand and norms of journalistic independence might induce the news media outlets to cover negative campaigning with a strategic game frame. A comprehensive content analysis based on several newspaper types, several election campaigns, and several different measurements of media framing confirms...

  15. Heart Health: The Heart Truth Campaign 2009

    Science.gov (United States)

    ... Past Issues Cover Story Heart Health The Heart Truth Campaign 2009 Past Issues / Winter 2009 Table of ... of the celebrities supporting this year's The Heart Truth campaign. Both R&B singer Ashanti (center) and ...

  16. Atmospheric lifetimes, infrared absorption spectra, radiative forcings and global warming potentials of NF3 and CF3CF2Cl (CFC-115)

    Science.gov (United States)

    Totterdill, Anna; Kovács, Tamás; Feng, Wuhu; Dhomse, Sandip; Smith, Christopher J.; Gómez-Martín, Juan Carlos; Chipperfield, Martyn P.; Forster, Piers M.; Plane, John M. C.

    2016-09-01

    Fluorinated compounds such as NF3 and C2F5Cl (CFC-115) are characterised by very large global warming potentials (GWPs), which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry-climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21) years and (492 ± 22) years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.

  17. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools.

  18. Abortion Rights: Anatomy of a Negative Campaign.

    Science.gov (United States)

    Olasky, Marvin N.

    1987-01-01

    Analyzes a highly successful negative public relations campaign carried on by major pro-choice organizations from October 1985 through March 1987. Explores the effectiveness of this campaign (much of it carried on in the media), and questions the ethics of such a campaign. (NKA)

  19. Weaving the Web into Your Campaign

    Science.gov (United States)

    Broman, Claudia

    2009-01-01

    Like anything else, there are good fundraising campaign Web sites and bad fundraising campaign Web sites. The author took a closer look at fundraising campaign sites to see if her intuitive judgments about these could be translated into a logical, research-supported set of best practices. She set up a study that gauged the ease of use and…

  20. Granny's Campaign for Safe Science

    OpenAIRE

    1991-01-01

    What is the thread tying together all of Jerry Fodor's vigorous and influential campaigns over the years? Consider the diversity of his btes noirs. In Chihara and Fodor, 1965, it was Wittgenstein and the "no private language" gang; in Psychological Explanation (1968) and The Language of Thought (1975), it was Ryle, Skinner and other behaviorists; in "Tom Swift and his Procedural Grandmother" (1978 reprinted in 1981) it was AI in general and procedural semantics in particular; in "Three Cheers...

  1. Potential groundwater age tracer found: Halon-1301 (CF3Br), as previously identified as CFC-13 (CF3Cl)

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2014-09-01

    Groundwater dating using anthropogenic and natural tracer substances is a powerful tool for understanding groundwater dynamics for improved management of groundwater resources. Due to limitations in individual dating methods, often multiple tracers are used to reduce ambiguities. It is commonly accepted that there is a need for further complementary age tracers, in addition to current ones (e.g., tritium, SF6, and CFCs). We propose a potential new groundwater age tracer, Halon-1301 (CF3Br), which can easily be determined using gas chromatography with an attached electron capture detector (GC/ECD) developed by Busenberg and Plummer (2008). Its peak was noted by Busenberg and Plummer (2008), but they believed it to be CFC-13 (CF3Cl) at that time. We performed rigorous tests on gases containing or excluding Halon-1301 and CFC-13 and modern water samples and concluded that the two compounds have extremely similar retention times. Additionally, we found that the ECD response of CFC-13 is far too low to be detected in groundwater or air using standard volumes and sampling techniques. However, the peak areas and concentrations Busenberg and Plummer (2008) reported are in line with what would be expected for Halon-1301. Thus, we are confident that the peak formerly identified as CFC-13 is actually Halon-1301. Busenberg agrees with our findings. We further suggest that Halon-1301 has potential as a (complementary) age tracer, due to its established atmospheric history, and could hypothetically be used to date groundwater recharged in the 1970s or onward. We discuss known relevant properties, such as solubility and stability of Halon-1301 in the context of how these effect its potential application as a groundwater age tracer. Some open questions remain concerning how conservative Halon-1301 is—is it subject to degradation, retardation, and/or local contamination in groundwater. We are confident that Halon-1301 possesses important tracer relevant properties, but further

  2. Overview of the CINDI campaign

    Science.gov (United States)

    van Roozendael, Michel; Piters, Ankie; Boersma, Folkert; Wittrock, Folkard; Hains, Jennifer; Kroon, Mark; Roscoe, Howard

    2010-05-01

    The Cabauw Intercomparison Campaign of Nitrogen Dioxide measuring Instruments (CINDI) took place in June-July 2009 at the Cabauw meteorological observatory, a semi-rural site located in the Netherlands, 30 km South of Utrecht. Its main objective was to intercompare a broad range of NO2 measuring instruments that can be used in support of the validation of tropospheric NO2 column measurements from satellites with, as primary focus, the assessment of tropospheric NO2 column and profile measurements using the DOAS and MAXDOAS techniques. The campaign included a formal semi-blind exercise following standards from the Network for the Detection of Atmospheric Composition Change (NDACC), and was followed by a number of additional activities. In total measurements from 32 NO2 instruments, most of them of DOAS-type but also a NO2 Lidar, in-situ sensors and a new-developed NO2 sonde, were collected and intercompared. In addition, a number of other parameters were measured, among them aerosol, HCHO, CHOCHO and BrO. Measurements were also dedicated to the study of horizontal gradients in the NO2 field and their impact on remote-sensing observations. Various working groups were set up to analyse results, establish uncertainties and progress towards improved and standardized retrieval algorithms. The campaign should result in consolidated trace gas and aerosol data products from both remote-sensing and in-situ techniques, thereby contributing to fulfill the needs for improved vertically-resolved monitoring of the air quality.

  3. Campaigning

    Science.gov (United States)

    1997-08-01

    to lower, in fact the command struc- ture is often more like a spider web: a tug at any point may have an impact throughout the structure...Strategy. the Argentine mainland or to overthrow its government in order to recover the disputed islands. In the area of operations, how- ever, the...British isolated and annihilated the Argentine forces. Strategies of annihilation have the virtue of conceptual sim- plicity. The focus of our

  4. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  5. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  6. Tritium retention measurements by accelerator mass spectrometry and full combustion of W-coated and uncoated CFC tiles from the JET divertor

    Science.gov (United States)

    Stan-Sion, C.; Bekris, N.; Kizane, G.; Enachescu, M.; Likonen, J.; Halitovs, M.; Petre, A.; contributors, JET

    2016-04-01

    Accelerator mass spectrometry (AMS) and the full combustion method (FCM) followed by liquid scintillation counting were applied to quantitatively determine the tritium retention in the tungsten-coated carbon fibre composites (CFC), in comparison to uncoated CFC tiles from the JET divertor. The tiles were adjacent and exposed to plasma operations between 2007 and 2009. The tritium depth profiles are showing that the tritium retention on the W-coated tile was reduced by a factor of 13.5 in comparison to the uncoated tile whereas the bulk tritium concentration is approximately the same for both tiles.

  7. WO3/ZrO2 Strong Acid as a Catalyst for the Decomposition of Chlorofluorocarbon (CFC-12)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction Chlorofluorocarbons (CFCs) diffusing to the stratosphere is a major reason for ozone depletion[1]. Also CFCs has been claimed to be notorious for its greenhouse effect[2]. So, recently it has become very important to eliminate CFCs as far as protecting the ozone layer surrounding the earth is concerned. Among various kinds of approaches to do destruction to CFCs, the catalytic decomposition seems to be the most practical and energetically favorable one, especially for treating small amounts of CFCs[3,4]. Recently, Fu et al.[3] reported that TiO2 modified with H2SO4 was much more active than TiO2 for the decomposition of CFC-12 in the presence of water vapor, and they attributed this tremendous enhancement in activity to the superacidic property of the sulfated catalyst. Their research results substantially stimulate us to investigate the catalytic decomposition of CFC-12 in the presence of water vapor over WO3/ZrO2 strong acid, which is more thermally stable than the sulfated oxides superacids[5].

  8. 40 CFR Appendix E to Subpart B of... - The Standard for Automotive Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and...

    Science.gov (United States)

    2010-07-01

    ... weight) moisture at 21 °C and 45,000 ppm (by weight) mineral oil 525 suspension viscosity nominal and 770... consist of CFC-12 with 200,000 ppm (by weight) mineral oil 525 suspension viscosity nominal. 8.1.5After... liquid phase only. 4.2Seat Leakage Test 4.2.1 Valves, including electrically operated solenoid...

  9. The CHUVA Lightning Mapping Campaign

    Science.gov (United States)

    Goodman, Steven J.; Blakeslee, Richard J.; Bailey, Jeffrey C.; Carey, Lawrence D.; Hoeller, Hartmut; Albrecht, Rachel I.; Morales, Carlos; Pinto, Osmar; Saba, Marcelo M.; Naccarato, Kleber; Hembury, Nikki; Nag, Amitabh; Heckman, Stan; Holzworth, Robert H.; Rudlosky, Scott D.; Betz, Hans-Dieter; Said, Ryan; Rauenzahn, Kim

    2011-01-01

    The primary science objective for the CHUVA lightning mapping campaign is to combine measurements of total lightning activity, lightning channel mapping, and detailed information on the locations of cloud charge regions of thunderstorms with the planned observations of the CHUVA (Cloud processes of tHe main precipitation systems in Brazil: A contribUtion to cloud resolVing modeling and to the GPM (GlobAl Precipitation Measurement) field campaign. The lightning campaign takes place during the CHUVA intensive observation period October-December 2011 in the vicinity of S o Luiz do Paraitinga with Brazilian, US, and European government, university and industry participants. Total lightning measurements that can be provided by ground-based regional 2-D and 3-D total lightning mapping networks coincident with overpasses of the Tropical Rainfall Measuring Mission Lightning Imaging Sensor (LIS) and the SEVIRI (Spinning Enhanced Visible and Infrared Imager) on the Meteosat Second Generation satellite in geostationary earth orbit will be used to generate proxy data sets for the next generation US and European geostationary satellites. Proxy data, which play an important role in the pre-launch mission development and in user readiness preparation, are used to develop and validate algorithms so that they will be ready for operational use quickly following the planned launch of the GOES-R Geostationary Lightning Mapper (GLM) in 2015 and the Meteosat Third Generation Lightning Imager (LI) in 2017. To date there is no well-characterized total lightning data set coincident with the imagers. Therefore, to take the greatest advantage of this opportunity to collect detailed and comprehensive total lightning data sets, test and validate multi-sensor nowcasting applications for the monitoring, tracking, warning, and prediction of severe and high impact weather, and to advance our knowledge of thunderstorm physics, extensive measurements from lightning mapping networks will be collected

  10. Contextual Influences and Campaign Awareness Among Young Adults: Evidence from the National truth® Campaign.

    Science.gov (United States)

    Vallone, Donna M; Ilakkuvan, Vinu; Xiao, Haijun; Cantrell, Jennifer; Rath, Jessica; Hair, Elizabeth

    2015-01-01

    Mass media campaigns have been found to shape the public's knowledge, attitudes, beliefs, and behavior around tobacco. This study examines the influence of contextual factors with respect to awareness of the national truth® campaign, a mass media, branded tobacco use prevention campaign, among a sample of young adults (n = 2,804) aged 24-34 years old; these respondents were within the age range for both the primary and secondary targets of the campaign during the period (2000-2007) when the campaign was airing television advertising at consistently high levels. Mulitvariable models reveal lower educational attainment and Hispanic ethnicity as significant contextual factors predictive of lower campaign awareness, controlling for media use. In contrast, gender, state tobacco control policy, sensation-seeking, current smoking status, and community-level SES variables were not significantly associated with campaign awareness. Further research is needed to identify the mechanisms through which public education campaigns operate, particularly among disadvantaged communities.

  11. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2011-09-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the 'Grand Challenge' for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  12. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2010-10-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the “Grand Challenge” for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  13. Characterization of the starvation-induced chitinase CfcA and α-1,3-glucanase AgnB of Aspergillus niger.

    Science.gov (United States)

    van Munster, Jolanda M; Dobruchowska, Justyna M; Veloo, Ruud; Dijkhuizen, Lubbert; van der Maarel, Marc J E C

    2015-03-01

    The common saprophyte Aspergillus niger may experience carbon starvation in nature as well as during industrial fermentations. Starvation survival strategies, such as conidiation or the formation of exploratory hyphae, require energy and building blocks, which may be supplied by autolysis. Glycoside hydrolases are key effectors of autolytic degradation of fungal cell walls, but knowledge on their identity and functionality is still limited. We recently identified agnB and cfcA as two genes encoding carbohydrate-active enzymes that had notably increased transcription during carbon starvation in A. niger. Here, we report the biochemical and functional characterization of these enzymes. AgnB is an α-1,3-glucanase that releases glucose from α-1,3-glucan substrates with a minimum degree of polymerization of 4. CfcA is a chitinase that releases dimers from the nonreducing end of chitin. These enzymes thus attack polymers that are found in the fungal cell wall and may have a role in autolytic fungal cell wall degradation in A. niger. Indeed, cell wall degradation during carbon starvation was reduced in the double deletion mutant ΔcfcA ΔagnB compared to the wild-type strain. Furthermore, the cell walls of the carbon-starved mycelium of the mutant contained a higher fraction of chitin or chitosan. The function of at least one of these enzymes, CfcA, therefore appears to be in the recycling of cell wall carbohydrates under carbon limiting conditions. CfcA thus may be a candidate effector for on demand cell lysis, which could be employed in industrial processes for recovery of intracellular products.

  14. Twitter Campaigns Around the Fifth IPCC Report: Campaign Spreading, Shared Hashtags, and Separate Communities

    NARCIS (Netherlands)

    Holmberg, K.; Hellsten, I.

    2016-01-01

    In this article, we analyzed campaigning on Twitter around the publication of the fifth Intergovernmental Panel for Climate Change (IPCC) Working Group 1 report in September, 2013. In particular, we analyzed how participation in a specific campaign and use of hashtags connected to the campaign devel

  15. 3H/3He ages, CFC ages and He isotopes in the fractured bedrock of the Mirror Lake Basin, NH

    Science.gov (United States)

    Torgersen, T.; Stute, M.; Drenkard, S.; Schlosser, P.; Busenberg, E.; Plummer, N.; Shapiro, A.

    2001-05-01

    Tritium/3He and CFC (chlorofluorocarbon) analyses were conducted on groundwater samples from the fractured bedrock and the overlying drift of Mirror Lake watershed in central New Hampshire. These groundwaters have a significant terrigenic helium component that increases with depth. The 3He/4He ratio of the terrigenic helium indicates the presence of two groundwater types. Where terrigenic sources of 3He are no more than 10 times the 3He signal produced by 3H decay (tritiogenic 3He), 3H/3He ages can be calculated. However, drift age profiles cannot be interpreted as recharge rates because the 2D, 2-layer coupled bedrock/drift system violates the simple homogeneous 1D conditions necessary to interpret age profiles as recharge rates. Secondly, while some agreement is seen between 3H/3He ages and CFC ages, the reconstruction of the 1963 'bomb' 3H peak yields a maximum that is significantly less (1/10) than expected. This apparent loss of 3H is cannot be attributed to dispersion or dual hydraulic conductivity but is consistent with the models of dual porosity. The data also demonstrate that '3H/3Hetri calibrated 4He ages' are invalid and cannot be used to extend the 'age' information contained in He isotope analysis. The results of this study again demonstrate that tracers have an important role in the calibration and definition of flow models for complex groundwater systems. However, it is suggested that tracers should be routinely inserted into groundwater flow models to determine (I) which tracers are best suited to the problem and (ii) where to sample for tracers to best differentiate among model possibilities as well as which parameters constitute the best descriptions of the groundwater system. Such coupling of multiple tracers and flow models at the earliest stages will provide the highest probability for determining the best flow model.

  16. The Devon NUT Campaign against Trust Schools

    Science.gov (United States)

    Clinch, Dave

    2008-01-01

    When the Devon County Council announced that six secondary schools in the South Devon area were to become "Pathfinder Schools" for trust status, the Devon National Union of Teachers set about organising a campaign to defend the county's comprehensive schools. This campaign has proved successful in the case of Tavistock College, causing other…

  17. Energy efficiency public service advertising campaign

    Energy Technology Data Exchange (ETDEWEB)

    Gibson-Grant, Amanda [Advertising Council, New York, NY (United States)

    2015-06-12

    The Advertising Council (“the Ad Council”) and The United States Department of Energy (DOE) created and launched a national public service advertising campaign designed to promote energy efficiency. The objective of the Energy Efficiency campaign was to redefine how consumers approach energy efficiency by showing that saving energy can save homeowners money.

  18. The replanting campaign has begun

    CERN Multimedia

    GS-SEM Group - General Infrastructure and Services Department

    2010-01-01

    The poplars on the border of CERN's Prévessin site were felled, according to plan, on Friday, 26 February. The work was essential as the trees were showing signs of serious ageing problems (broken and dead branches, weakened trunks and root systems, etc.) and needed to be felled to ensure the safety of drivers on the D35 The trees that have been cut will be transformed into renewable energy wood chips and used to heat local schools and crèches. They will be replaced by a hedge of hornbeams, a native fast-growing tree, which will be planted in the spring.     The felling operation was entrusted to the French national forestry authorities, with the support of the Bellegarde-Pays de Gex Agence Routière et Technique. It marks the start of a vast poplar-felling and replanting campaign, which will be extended to CERN's Meyrin site.  The work is part of CERN's general renovation and site planning scheme for the future.    

  19. ADVANCED FUELS CAMPAIGN 2013 ACCOMPLISHMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2013-10-01

    The mission of the Advanced Fuels Campaign (AFC) is to perform Research, Development, and Demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This includes development of a state-of-the art Research and Development (R&D) infrastructure to support the use of “goal-oriented science-based approach.” In support of the Fuel Cycle Research and Development (FCRD) program, AFC is responsible for developing advanced fuels technologies to support the various fuel cycle options defined in the Department of Energy (DOE) Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. Accomplishments made during fiscal year (FY) 2013 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section.

  20. AAU-DLR 2010 Indoor Measurement Campaign

    DEFF Research Database (Denmark)

    Steinböck, Gerhard; Pedersen, Troels; Wang, Wei

    2011-01-01

    A measurement campaign, not part of the WHERE2 project, with the focus on indoor multilink and reverberant in-room channels was conducted by DLR and AAU. The measurement data is used from both parties within the WHERE2 project and can be shared upon request. The measurement campaign has two main...... Channels". For the measurement campaign the measurement platform for time-variant wireless channels from DLR was used. The high spatial resolution of the platform allows for combining several transmitter positions to a virtual array. Together with the circular receiver array, this enables a bi...

  1. Evaluation of a brief anti-stigma campaign in Cambridge: do short-term campaigns work?

    Directory of Open Access Journals (Sweden)

    Henderson Claire

    2010-06-01

    Full Text Available Abstract Background In view of the high costs of mass-media campaigns, it is important to understand whether it is possible for a media campaign to have significant population effects over a short period of time. This paper explores this question specifically in reference to stigma and discrimination against people with mental health problems using the Time to Change Cambridge anti-stigma campaign as an example. Methods 410 face-to-face interviews were performed pre, during and post campaign activity to assess campaign awareness and mental health-related knowledge, attitudes and behaviours. Results Although campaign awareness was not sustained following campaign activity, significant and sustained shifts occurred for mental health-related knowledge items. Specifically, there was a 24% (p If a friend had a mental health problem, I know what advice to give them to get professional help, following the campaign. Additionally, for the statement: Medication can be an effective treatment for people with mental health problems, there was a 10% rise (p = 0.05 in the proportion of interviewees responding 'agree' or 'strongly agree' following the campaign. These changes, however, were not evident for attitudinal or behaviour related questions. Conclusions Although these results only reflect the impact of one small scale campaign, these preliminary findings suggest several considerations for mass-media campaign development and evaluation strategies such as: (1 Aiming to influence outcomes pertaining to knowledge in the short term; (2 Planning realistic and targeted outcomes over the short, medium and long term during sustained campaigns; and (3 Monitoring indirect campaign effects such as social discourse or other social networking/contact in the evaluation.

  2. Performance testing of a semi-hermetic compressor with HFC-236EA and CFC-114 at chiller conditions. Report for December 1993-May 1994

    Energy Technology Data Exchange (ETDEWEB)

    Kazachki, G.S.; Hendriks, R.V.

    1994-12-31

    The paper gives results of tests of both HFC-236ea and CFC-114 at a range of temperatures covering surface craft and submarine chiller conditions. Evaporating temperatures ranged from 1.7 to 12.8 C, and condensing temperatures from 40.6 to 65.6 C, in order to develop a nine-point test map. Polyol ester oil was used with the refrigerants. The tests evaluated suction and discharge pressures, their difference and ratio, cooling capacity, electric power input, compressor energy efficiency ratio (coefficient of performance), electric current, and compressor volumetric and isentropic energy efficiency. Compressor discharge, motor winding, and oil temperature were also monitored. HFC-236ea is one of the strongest candidates for a CFC-114 alternative in surface craft and submarine chillers. Some material compatibility and oil miscibility work has also been performed in support of HFC-236ea as a refrigerant.

  3. Analysis of multicomopnent groundwater flow in karst aquifer by CFC, tritium, tracer test and modelling, case study at Skaistkalnes vicinity, Latvia

    Science.gov (United States)

    Bikshe, Janis; Babre, Alise; Delina, Aija; Popovs, Konrads

    2014-05-01

    Groundwater in karst environments tends to have difficulties to distinguish multiple flows if several sources of water are present. Skaistkalne vicinity faces with such situation where old groundwater, fresh groundwater and inflow from river Iecava occurs. Attempts were made to distinguish groundwater residence time of multiple components of water applying CFC and tritium dating techniques supplied by tracer test and numerical model of study area. Study area covers territory between two rivers Iecava and Memele with water level difference of 7 meters and horizontal distance of 2.2 kilometres between both. Study area consists of karst affected Devonian gypsum and carbonaceous rocks covered by Quaternary low to high permeable deposits. Confined groundwater at depth of 10-25 meters where analysed by CFC's and tritium. At this depth groundwater exhibits anoxic reducing environment that has caused degradation of CFC's at similar degree in all samples. Taking it into account, mean residence time based on CFC piston flow model is 22 - 42 years and 28 - 34 years based on binary mixing model. Tritium results show signs of incensement of groundwater residence time towards discharge area. CFC combined with tritium proved increased vertical velocity in middle part between the rivers likely caused by hydrogeological window in Quaternary deposits created by karst processes. Numerical model (Delina et al. 2012) was applied and calculations yielded groundwater flow velocity rate at 0.3 - 1 m/day in area between the rivers. Investigation of CFC data resulted in possible groundwater flow rate of at a minimum of 0.2 m/day although it's not applicable to all sampled wells due to specific hydrogeological conditions. Tracer test was made between the rivers in order to distinguish main water flow paths and flow velocity. Results showed that very high permeable conduits connect rivers and karst lakes with velocity rates of 800 - 1300 m/day. Complex investigation leads to conclude that

  4. Effects of mesoscale eddies on global ocean distributions of CFC-11, CO2, and Δ14C

    Directory of Open Access Journals (Sweden)

    P. Delecluse

    2007-10-01

    Full Text Available Global-scale tracer simulations are typically made at coarse resolution without explicitly modelling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of transient tracers. We made global anthropogenic transient-tracer simulations in coarse-resolution (2°cosφ×2°, ORCA2 and eddy-permitting (½°cosφ×½°, ORCA05 versions of the ocean general circulation model OPA9. Our focus is on surface-to-intermediate waters of the southern extratropics where air-sea tracer fluxes, tracer storage, and meridional tracer transport are largest. Eddies have little effect on global and regional bomb Δ14C uptake and storage. Yet for anthropogenic CO2 and CFC-11, refining the horizontal resolution reduced southern extratropical uptake by 25% and 28%, respectively. There is a similar decrease in corresponding inventories, which yields better agreement with observations. With higher resolution, eddies strengthen upper ocean vertical stratification and reduce excessive ventilation of intermediate waters by 20% between 60° S and 40° S. By weakening the residual circulation, i.e., the sum of Eulerian mean flow and the opposed eddy-induced flow, eddies reduce the supply of tracer-impoverished deep waters to the surface near the Antarctic divergence, thus reducing the air-sea tracer flux. Thus in the eddy permitting model, surface waters in that region have more time to equilibrate with the atmosphere before they are transported northward and subducted. As a result, the eddy permitting model's inventories of CFC-11 and anthropogenic CO2 are lower in that region because mixed-layer concentrations of both tracers equilibrate with the atmosphere on relatively short time scales (15 days and 6 months, respectively; conversely, bomb Δ14C's air-sea equilibration time of 6 years is so slow that, even in the eddy permitting model, there is little time for surface concentrations to equilibrate with the atmosphere, i.e., before

  5. SEPARATIONS AND WASTE FORMS CAMPAIGN IMPLEMENTATION PLAN

    Energy Technology Data Exchange (ETDEWEB)

    Vienna, John D.; Todd, Terry A.; Peterson, Mary E.

    2012-11-26

    This Separations and Waste Forms Campaign Implementation Plan provides summary level detail describing how the Campaign will achieve the objectives set-forth by the Fuel Cycle Reasearch and Development (FCRD) Program. This implementation plan will be maintained as a living document and will be updated as needed in response to changes or progress in separations and waste forms research and the FCRD Program priorities.

  6. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    OpenAIRE

    I MADE RASTA; I.W. Kasa; I Gede Mahardika

    2015-01-01

    CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 co...

  7. Florida's "truth" campaign: a counter-marketing, anti-tobacco media campaign.

    Science.gov (United States)

    Zucker, D; Hopkins, R S; Sly, D F; Urich, J; Kershaw, J M; Solari, S

    2000-05-01

    The "truth" campaign was created to change youth attitudes about tobacco and to reduce teen tobacco use throughout Florida by using youth-driven advertising, public relations, and advocacy. Results of the campaign include a 92 percent brand awareness rate among teens, a 15 percent rise in teens who agree with key attitudinal statements about smoking, a 19.4 percent decline in smoking among middle school students, and a 8.0 percent decline among high school students. States committed to results-oriented youth anti-tobacco campaigns should look to Florida's "truth" campaign as a model that effectively places youth at the helm of anti-tobacco efforts.

  8. Schistosomiasis and the Philippine campaign

    Institute of Scientific and Technical Information of China (English)

    Cristóbal S.Berry-Cabá

    2008-01-01

    ,relapses were rare.It was a successful campaign against schistosomiasis in the army.

  9. Heat flux distribution and gyro-radius smoothing effect on misaligned CFC tile in the Tore Supra tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Corre, Yann, E-mail: yann.corre@cea.fr [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Dejarnac, Renaud [Institute of Plasma Physics AS CR v.v.i., Za Slovankou 3, 18200 Prague (Czech Republic); Gardarein, Jean-Laurent; Gaspar, Jonathan [Aix-Marseille Université, CNRS, IUSTI UMR 7343, 13013 Marseille (France); Escourbiac, Frédéric [ITER Organization, CS 90 046, 13067 St Paul-lez-Durance Cedex (France); Gauthier, Eric; Gunn, James-Paul [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Komm, Mickael [Institute of Plasma Physics AS CR v.v.i., Za Slovankou 3, 18200 Prague (Czech Republic); Lipa, Manfred; Loarer, Thierry; Missirlian, Marc [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Rigollet, Fabrice [Aix-Marseille Université, CNRS, IUSTI UMR 7343, 13013 Marseille (France)

    2015-08-15

    Understanding heat flux deposition processes is essential for the design of the plasma facing component allowing reliable high power steady state plasma operations. Misalignments up to δ = 0.2 mm between two adjacent CFC tiles have been reported on the Toroidal Pump Limiter of Tore Supra. Heat flux impinging the top and leading edge of the protruding tile are characterized with both IR thermographic system and numerical modelling using 2D particle-in-cell simulations that accounts for the Larmor radius smoothing effect of incident ions. Numerical heat loads are coupled with a 2D thermal model of the tile and with a specific sensor correction to simulate spatial-resolution related effects (necessary here since the tile misalignment is smaller than the spatial resolution of the IR system). In the experiment depicted here, with a misalignment smaller than an ion gyro-radius, the Larmor radius smoothing effect is maximum and overheating of the leading edge is reduced by a factor of two.

  10. Microstructure and properties of SiC gradiently coated Cf/C composites prepared by a RCLD method

    Institute of Scientific and Technical Information of China (English)

    Jun-hua Chen; Cuang-li Chen; Hao-ran Geng; Yan Wang

    2009-01-01

    The SiC gradiently coated carbon fiber/carbon (Cf/C) composites were prepared by a two-step rapid chemical liquid depo-sition (RCLD) method. The microstructure and properties of the composites were investigated using X-ray diffraction, scanning elec-tron microscopy together with energy dispersive X-ray analysis, bending tests, and oxidation tests. The experimental results show that the surface layer of the composites is composed of SiC, pyrocarbon, and carbon fibers. Their inner area consists of pyrocarbon and carbon fibers. The SiC content gradiently decreases with increasing distance from the outer surface to the center of the compos-ites. Furthermore, the thickness of the SiC layer increases with increasing tetraethylorthosilicate content and deposition time. SiC coatings have no significant influence on the bending strength of the composites. However, the oxidation resistance of the compos-ites increases with increasing thickness of the SiC layer.

  11. 5 CFR 950.701 - DoD overseas campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false DoD overseas campaign. 950.701 Section... VOLUNTARY ORGANIZATIONS DoD Overseas Campaign § 950.701 DoD overseas campaign. (a) A Combined Federal Campaign is authorized for all Department of Defense (DoD) activities in the overseas areas during a...

  12. 29 CFR 452.79 - Opportunity to campaign.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Opportunity to campaign. 452.79 Section 452.79 Labor... DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.79 Opportunity to campaign. There must be a reasonable... prior to the election so that he was denied an equal opportunity to campaign. Similarly, in a...

  13. 26 CFR 701.9006-1 - Presidential Election Campaign Fund.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 20 2010-04-01 2010-04-01 false Presidential Election Campaign Fund. 701.9006-1...) INTERNAL REVENUE PRACTICE PRESIDENTIAL ELECTION CAMPAIGN FUND § 701.9006-1 Presidential Election Campaign Fund. (a) Transfer of amounts to the Presidential Election Campaign Fund. The Secretary shall...

  14. 29 CFR 452.67 - Distribution of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Distribution of campaign literature. 452.67 Section 452.67... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.67 Distribution of campaign literature. The Act... distribute his campaign literature to the membership at his expense. When the organization or its...

  15. What makes or breaks a health fundraising campaign on twitter?

    NARCIS (Netherlands)

    Prasetyo, N.D.; Hauff, C.; Nguyen, D.; Broek, T.A. van den; Hiemstra, D.

    2015-01-01

    Health campaigns that aim to raise awareness and subsequently raise funds for research and treatment are commonplace. While many local campaigns exist, very few attract the attention of a global audience. One of those global campaigns is Movember, an annual campaign during the month of November, tha

  16. Temperature, salinity, dissolved oxygen, fluorometer, and other data collected with CTD casts during six ECOHAB cruises in the Northeast Pacific and Puget Sound, 6/2/2003 - 10/4/2006 (NODC Accession 0049079)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is the final processed data for the following cruises in the northeastern Pacific Ocean, Strait of Juan De Fuca, and Puget Sound from 20030602 to 20061004: 1....

  17. Nutrients, chlorophyll, and other data from Northeast Water Column Monitoring cruises in the Mid-Atlantic Bight for the Northeast Monitoring Program (NEMP), 21 April 1980 to 24 April 1984 (NODC Accession 8800171)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Multiple cruise reports for the Northeast Monitoring Program (NEMP) describe the data collection activities, analyses and tabular data from multiple NEMP cruises in...

  18. Amateur astronomers in support of observing campaigns

    Science.gov (United States)

    Yanamandra-Fisher, P.

    2014-07-01

    The Pro-Am Collaborative Astronomy (PACA) project evolved from the observational campaign of C/2012 S1 or C/ISON. The success of the paradigm shift in scientific research is now implemented in other comet observing campaigns. While PACA identifies a consistent collaborative approach to pro-am collaborations, given the volume of data generated for each campaign, new ways of rapid data analysis, mining access, and storage are needed. Several interesting results emerged from the synergistic inclusion of both social media and amateur astronomers: - the establishment of a network of astronomers and related professionals that can be galvanized into action on short notice to support observing campaigns; - assist in various science investigations pertinent to the campaign; - provide an alert-sounding mechanism should the need arise; - immediate outreach and dissemination of results via our media/blogger members; - provide a forum for discussions between the imagers and modelers to help strategize the observing campaign for maximum benefit. In 2014, two new comet observing campaigns involving pro-am collaborations have been identified: (1) C/2013 A1 (C/Siding Spring) and (2) 67P/Churyumov-Gerasimenko (CG). The evolving need for individual customized observing campaigns has been incorporated into the evolution of PACA (Pro-Am Collaborative Astronomy) portal that currently is focused on comets: from supporting observing campaigns for current comets, legacy data, historical comets; interconnected with social media and a set of shareable documents addressing observational strategies; consistent standards for data; data access, use, and storage, to align with the needs of professional observers. The integration of science, observations by professional and amateur astronomers, and various social media provides a dynamic and evolving collaborative partnership between professional and amateur astronomers. The recent observation of comet 67P, at a magnitude of 21.2, from Siding

  19. Remembering the 100,000 lives campaign

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2016-06-01

    Full Text Available No abstract available. Article truncated after 150 words. Earlier this week the Institute for Healthcare Improvement (IHI emailed its weekly bulletin celebrating that it has been ten years since the end of the 100,000 Lives Campaign (Appendix 1. This was the campaign, according to the bulletin, that put IHI on the map. The Campaign started at the IHI National Forum in December 2004, when IHI's president, Don Berwick, announced that IHI would work together with nearly three-quarters of the US hospitals to reduce needless deaths by 100,000 over 18 months. A phrase borrowed from political campaigns became IHI's cri de coeur: “Some is not a number. Soon is not a time.” The Campaign relied on six key interventions: Rapid Response Teams; Improved Care for Acute Myocardial Infarction; Medication Reconciliation; Preventing Central Line Infections; Preventing Surgical Site Infections; Preventing Ventilator-Associated Pnemonia [sic]. According to the bulletin, the Campaign’s impact rippled across the organization and the world. IHI listed some ...

  20. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Multimedia

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the Infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  1. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Multimedia

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  2. Local Election Campaign in Social Media

    DEFF Research Database (Denmark)

    Bock Segaard, Signe; Agger Nielsen, Jeppe

    In this paper we focus on the usage of social media in political election campaigns. These new arenas have become increasingly important for democratic purposes, such as opinion sharing and discussions between candidates and voters. But there is a lack of research on how social media is used...... in local election campaigns. Therefore, the aim of this study is to investigate the use of social media as it was intended to be central arenas for local election campaigns in Norwegian municipalities. For that purpose we first develop a model of political communication in social media that conceptualise...... candidates, content registration of local blogs, and log file data of local blogs through Google Analytics). In contrast to the democratic vision for social media the analysis demonstrates that the election blogs primarily are used by those who are most politically active in advance. The analysis also shows...

  3. Road safety campaign is a great success

    CERN Document Server

    2008-01-01

    Rolf Heuer, the next Director-General of CERN, and Sigurd Lettow, the Director of Finance and Human Resources (photo below), completed all the tests of the CERN road safety campaign under the supervision of TCS instructors. The road safety campaign, which took place in the Main Building during the week of 10 November, attracted large numbers of participants. More than 300 CERN personnel and users took part in, and in some cases were literally bowled over by, the activities set up by instructors from the TCS (Touring Club Suisse). The campaign’s aim was to raise driver awareness of several aspects of road safety, including speed, use of mobile phones at the wheel, pedestrian priority, unlawful parking and driving with a valid licence. The campaign was an unqualified success! Even CERN’s directors joined in, testing their own reactions as drivers on the various pieces of apparatus in place.

  4. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Hesperides Cruise in the Atlantic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Millero, F.J.

    2000-06-09

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), and pH at hydrographic stations during the R/V Hesperides oceanographic cruise in the Atlantic Ocean (Section A5). Conducted as part of the Work Ocean Circulation Experiment (WOCE), the cruise began in Cadiz, Spain, on July 14, 1992, and ended in Miami, Florida, on August 15, 1992. Measurements made along WOCE Section A5 included CTD pressure, temperature, salinity, and oxygen; and bottle salinity, oxygen, phosphate, nitrate, nitrite, silicate, TCO{sub 2}, TALK, and pH. The TALK, TCO{sub 2}, and pH were determined from titrations of seawater collected at 33 stations. The titration systems for measuring TALK and TCO{sub 2} were calibrated in the laboratory with certified reference materials (CRMs) before the cruise to ensure traceable results. Standard reference seawater provided by Andrew Dickson of Scripps Institution of Oceanography (SIO) was used at sea to monitor the performance of the titration systems. The results agree with the laboratory results to {+-} 2 {micro}mol/kg for TALK and {+-} 1 {micro}mol/kg for TCO{sub 2}. The titration systems used to measure pH were calibrated with TRIS seawater buffers prepared in the laboratory and measured with an H{sub 2}, Pt/AgCl, Ag electrode. The initial electromotive force (emf) of the titrations was used to determine the pH. The values of pH are thought to be reliable to {+-} 0.01 and are internally consistent with the measured values of TALK and TCO{sub 2} to {+-} 7 {micro}mol/kg. The measured carbon dioxide system parameters have been used to calculate the in situ values of the fugacity of CO{sub 2} (fCO{sub 2}) for the surface water. The surface results are briefly discussed.

  5. The (n,γ campaigns at EXILL

    Directory of Open Access Journals (Sweden)

    Jolie J.

    2015-01-01

    Full Text Available At the PF1B cold neutron beam line at the Institut Laue Langevin, the EXILL array consisting of EXOGAM, GASP and ILL-Clover detectors was used to perform (n,γ measurements at very high coincidence rates. About ten different reactions were measured in autumn 2012 using a highly collimated cold neutron beam. In spring 2013, the EXOGAM array was combined with 16 LaBr3(Ce scintillators in the EXILL&FATIMA campaign for the measurement of lifetimes using the generalised centroid difference method. We report on the properties of the set-ups and present first results from both campaigns.

  6. Post-coring entrapment of modern air in some shallow ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-06-01

    Full Text Available In this study, we report measurements of CFC-12 (CCl2F2 in firn air and in air extracted from shallow ice cores from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, some of the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for the presence of modern air entrapped in the shallow ice core samples that likely contained open pores at the time of collection. We propose that this is due to closure of the open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our results reveal that open porosity can exist below the maximum depth at which firn air samples can be collected, particularly at sites with lower accumulation rates. CFC-12 measurements demonstrate that post-drilling closure of open pores can lead to a change in the composition of bubble air in shallow ice cores through purely physical processes. The results have implications for investigations involving trace gas composition of bubbles in shallow ice cores collected near the firn-ice transition.

  7. Post-coring entrapment of modern air in polar ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and shallow ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-01-01

    Full Text Available In this study, we report the first measurements of CFC-12 (CCl2F2 in air extracted from shallow ice cores along with firn air CFC-12 measurements from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for presence of modern air entrapped in shallow ice core samples. We propose that this is due to closure of open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our measurements reveal the presence of open porosity below the depth at which firn air samples can be collected and demonstrate how the composition of bubble air in shallow ice cores can be altered during the post-drilling period through purely physical processes. These results have implications for investigations involving trace gas composition of bubbles in shallow ice cores.

  8. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    P. F. Bernath

    2013-02-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer-tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the VMR from tropical ground-based AGAGE sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 195 + (− 75 (42 yr (CH4, 69 + (− 65 (23 yr (CH3Cl and 123 + (− 53 (28 yr (N2O. The errors on these values are the weighted 1-σ non-systematic errors. The stratospheric lifetime of CH3Cl represents the first calculations of the stratospheric lifetime of CH3Cl using data from a space based instrument.

  9. Vapor pressures of mixtures of CFC-114 with the potential replacement coolants C{sub 4}F{sub 10} and c-C{sub 4}F{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Trowbridge, L.D. [Oak Ridge K-25 Site, TN (United States); Otey, M.G. [Paducah Gaseous Diffusion Plant, KY (United States)

    1994-09-01

    The U.S. Enrichment Corporation`s production of isotopically enriched uranium depends solely on two plants which utilize the gaseous diffusion process. This process uses large quantities of CFC-114 as an evaporative coolant. CFC-114, however, will be phased out of production at the end of 1995 due to its potential to deplete stratospheric ozone. A search has been underway for substitutes for a number of years. The initial search (1988-89) for an ozone-friendly, commercially available, chemically compatible substitute yielded two candidates, FC-c318 (c-C{sub 4}F{sub 8}) and FC-3110 (C{sub 4}F{sub 10}). The intended mode of replacing coolant was to stage the new coolant into independent subsystems of the plants, so that some systems would continue to operate on CFC-114, and an increasing number would operate on the new coolant. During that changeover process, the possibility of coolant mixing arises in variety of scenarios. This work was intended to generate sufficient experimental information to be able to predict the vapor pressure of coolant mixtures over the range of operating conditions likely to be found in the diffusion plants. Specifically, vapor pressures were measured over the temperature range 322 to 355 K (120{degrees}F to 180{degrees}F) and over the full range of mole fractions for binary mixtures of CFC-114 with FC-3110, and of CFC-114 with FC-c318.

  10. Analysis of the ESA windscatterometer campaign data

    NARCIS (Netherlands)

    Loor, G.P. de

    1985-01-01

    All data of the ESA windscatterometer campaign as provided by the Central Data Library were analyzed. The data obtained fit in the available empirical model and the parameters of this model were determined. The data set was not only related to the actually measured windspeed at 19.5 m but also to th

  11. Transmutation Fuels Campaign FY-09 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2009-09-01

    This report summarizes the fiscal year 2009 (FY-08) accomplishments for the Transmutation Fuels Campaign (TFC). The emphasis is on the accomplishments and relevance of the work. Detailed description of the methods used to achieve the highlighted results and the associated support tasks are not included in this report.

  12. Teen PACK: Population Awareness Campaign Kit.

    Science.gov (United States)

    Zero Population Growth, Inc., Washington, DC.

    This packet of instructional materials is designed to teach teenagers about the effects of overpopulation on the world and on the individual. Information is presented in three related booklets. The first of the three parts of the "Teen Population Awareness Campaign Kit," illustrates overpopulation through profiles of teens living in…

  13. Persistence of Change: Fume Hood Campaign Lessons

    Science.gov (United States)

    Feder, Elah; Robinson, Jennifer; Wakefield, Sarah

    2012-01-01

    Purpose: Sustainability initiatives typically operate for a limited time period, but it is often unclear whether they have lasting effects. The purpose of this paper is to examine a laboratory fume hood campaign, in order to identify factors that might contribute or detract from long-term change persistence. Design/methodology/approach: The…

  14. Analyzing the Communication Dynamics of Political Campaigns

    Science.gov (United States)

    Tannenbaum, Sally

    2007-01-01

    It is widely agreed that college students do not fully participate in the political process. The most commonly cited reasons are apathy, indifference, and ignorance. This article presents an activity that aims to help students learn about communication dynamics in the context of political campaigns and develop an appreciation and confidence about…

  15. Collaboration Portals for NASA's Airborne Field Campaigns

    Science.gov (United States)

    Conover, Helen; Kulkami, Ajinkya; Garrett, Michele; Goodman, Michael; Peterson, Walter Arthur; Drewry, Marilyn; Hardin, Danny M.; He, Matt

    2011-01-01

    The University of Alabama in Huntsville (UAH), in collaboration with the Global Hydrology Resource Center, a NASA Earth Science Data Center, has provided information management for a number of NASA Airborne Field campaigns, both hurricane science investigations and satellite instrument validation. Effective field campaign management requires communication and coordination tools, including utilities for personnel to upload and share flight plans, weather forecasts, a variety of mission reports, preliminary science data, and personal photos. Beginning with the Genesis and Rapid Intensification Processes (GRIP) hurricane field campaign in 2010, we have provided these capabilities via a Drupal-based collaboration portal. This portal was reused and modified for the Midlatitude Continental Convective Clouds Experiment (MC3E), part of the Global Precipitation Measurement mission ground validation program. An end goal of these development efforts is the creation of a Drupal profile for field campaign management. This presentation will discuss experiences with Drupal in developing and using these collaboration portals. Topics will include Drupal modules used, advantages and disadvantages of working with Drupal in this context, and how the science teams used the portals in comparison with other communication and collaboration tools.

  16. News and campaign dynamics in EU 27

    NARCIS (Netherlands)

    de Vreese, C.; Schuck, A.; Maier, M.; Stengel, K.; Haubold, V.; Süß, K.; Tenscher, J.

    2009-01-01

    The presentation provides an introduction to the media content analysis of the European election campaign conducted in the 27 EU member states in the 3 weeks leading up to the June 2009 elections. The analysis is an integral part of the PIREDEU project (www.piredeu.eu): Providing an Infrastructure f

  17. The World Campaign for the Biosphere.

    Science.gov (United States)

    Barman, Charles R.

    1984-01-01

    Lists and discusses goals of The World Campaign for the Biosphere and strategies designed to achieve these goals. Also lists eight suggestions for science teachers to help incorporate the goals into school curricula and programs. These include organizing assemblies which present information about environmental problems and presenting environmental…

  18. Japanese campaign to enthuse young scientists

    CERN Multimedia

    1999-01-01

    Japan's Science and Technology Agency has launched a 3-year campaign to promote the public understanding of science and revive the interest in science subjects in schools. Plans include a science-only television channel and a 'virtual science museum' on the Internet (2 paragraphs).

  19. Parents welcome "hard-hitting" campaign.

    Science.gov (United States)

    1994-01-01

    The FPA (Family Planning Association)'s recent pilot campaign to encourage parents to talk to their children about sex has generated an excellent response rate. Funded by the Department of Health as part of "The health of the nation" efforts to reduce unplanned teenage pregnancies, the campaign centered on two radio advertisements. Aired during March in Greater London and North West England, the advertisements featured a free phone number from which people could obtain free copies of the booklet "Answering your child's questions," part of the FPA's "Growing Up" series. Nearly 7500 copies of the booklet were distributed in response to over 5000 requests--2500 rang in the first week alone. Most requests were from parents (69% mothers, 31% fathers) with one to three children aged between 7 and 13. Over 1000 requests were from parents with children under 7. Hundreds of schools, youth clubs, health professionals and voluntary organizations requested multiple booklets for use in their work. Research carried out to gauge public reaction showed overwhelming support for the campaign's message, demonstrating the immense need by parents for information in this area. "Answering your child's questions" was praised for being "open, direct and easy to follow." One parent said, "The booklet arms parents with the right way of putting information across." Parents described the advertisements as "hard-hitting" and "attention-grabbing." One listener commented: "They really stopped me in my tracks." FPA director Doreen Massey said: "The favorable reaction to the campaign is extremely encouraging. We are looking at ways to relay this pilot effort into a full-scale UK-wide campaign next year."

  20. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Quarterly MCLR program technical progress report, January 1, 1995--March 31, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.

    1995-04-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  1. Citizen Preparedness Campaign: Information Campaigns Increasing Citizen Preparedness to Support Creating a `Culture of Preparedness’

    Science.gov (United States)

    2007-03-01

    objectives, and other aspects. For instance, in 1989, the MADD campaign targeted teenagers and youths trying to reduce underage drinking. In 1996...Partners for this portion of the campaign include NPR; country, rock, rap , alternative and Spanish stations; other talk radio shows; Ad Council...advertisements, play music , show a short film called First Look about what is going on in Hollywood and finally show commercials prior to the feature

  2. Social Media Campaign Effects: Moderating Role of Social Capital in an Anti-Smoking Campaign.

    Science.gov (United States)

    Namkoong, Kang; Nah, Seungahn; Van Stee, Stephanie K; Record, Rachael A

    2017-01-06

    This study examined the effects of an anti-smoking campaign that employs a crowdsourcing method with a social networking service. Drawing upon social capital scholarship and the expression effect research paradigm in eHealth systems, the study also investigated the roles of social trust and community life satisfaction in the social media campaign that has a specific geographical boundary. To that end, we conducted an experiment using a two-group pretest-posttest design. We randomly assigned 201 participants to two conditions: "campaign message reception only" as a control group and "message reception and expression" as a treatment group in which participants fully engaged in the campaign process by sharing their own campaign ideas with other participants. Findings revealed that social trust and community life satisfaction interacted with the treatment condition to positively affect persuasive intentions, but in distinct ways. Social trust moderated the effect of the message reception and interaction condition on participants' willingness to encourage community members to stop smoking. In contrast, community life satisfaction moderated the effect of the treatment condition on encouraging others to comply with the community's anti-smoking policy. These results provide theoretical and practical implications related to the roles of social capital in geographically defined social media campaigns.

  3. A general measles vaccination campaign in urban Guinea-Bissau

    DEFF Research Database (Denmark)

    Byberg, S.; Thysen, Sanne Marie; Rodrigues, A;

    2017-01-01

    Background Measles vaccination campaigns targeting children aged 9–59 months are conducted every three years in Guinea-Bissau. Studies have demonstrated beneficial non-specific effects of measles vaccine. We compared mortality one year after the December 2012 measles vaccination campaign in Bissau...... city for children who received campaign measles vaccine with children who did not receive campaign measles vaccine. Methods Field workers from Bandim Health Project registered all children living in the Bandim Health Project's study area who received measles vaccination at the campaign posts. Children...... not seen during the campaign were visited at home and campaign participation status was assessed. We compared mortality rates of participants vs. non-participants in Cox regression models. Results 5633 children aged 9–59 months (85%) received campaign measles vaccination and 1006 (15%) did not. During...

  4. The 1992 Presidential Campaign and Debates: A Cognitive View.

    Science.gov (United States)

    Carter, Richard F.; Stamm, Keith R.

    1994-01-01

    Distinguishes the cognitive, affective, and emotive effects produced by the 1992 presidential campaign, especially its presidential debates. Describes the kinds of cognitive effects engendered by the campaign activities and performances of the three major candidates. (HB)

  5. An Expert Systems Approach for PR Campaigns Research.

    Science.gov (United States)

    Cameron, Glen T.; Curtin, Patricia A.

    1992-01-01

    Describes an expert system (the artificial intelligence program "Publics") that helps users identify key publics for public relations campaigns. Examines advantages and problems encountered in its use in public relations campaigns classrooms. (SR)

  6. Public Health Campaign Cut Consumption of Sugary Drinks

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_162092.html Public Health Campaign Cut Consumption of Sugary Drinks Soda sales ... 2016 THURSDAY, Nov. 17, 2016 (HealthDay News) -- A public health campaign to reduce sugary drink consumption led to ...

  7. A Smoking Cessation Campaign on Twitter: Understanding the Use of Twitter and Identifying Major Players in a Health Campaign.

    Science.gov (United States)

    Chung, Jae Eun

    2016-05-01

    The current study examined the use of online social media for a health campaign. Collecting tweets (N = 1,790) about the recent smoking cessation campaign by the Centers for Disease Control and Prevention, the current study investigated the dissemination of health campaign messages on Twitter and answered questions from the process evaluation of health campaigns: who tweeted about the campaign, who played central roles in disseminating health campaign messages, and how various features of Twitter were used for sharing of campaign messages. Results showed that individuals and nonprofit organizations posted frequently about the campaign: Individuals and nonprofit organizations posted about 40% and 30% of campaign-related tweets, respectively. Although the campaign under investigation was steered by a government agency, nonprofit organizations played a vital role as mediators who disseminated campaign messages. The culture of retweeting demonstrated its particular usefulness for the dissemination of campaign messages. Despite the expectation that the use of social media would expand opportunities for engagement, actual two-way interactions were few or minimal. Drawn from the results, practical suggestions on how to strategize the use of Twitter for future health campaigns are discussed.

  8. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    A. T. Brown

    2013-07-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long-term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer–tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the volume mixing ratio (VMR from tropical ground based AGAGE (Advanced Global Atmospheric Gases Experiment sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 69 + (− 65 (23 yr (CH3Cl, 123 + (− 53 (28 yr (N2O and 195 + (− 75 (42 yr (CH4. The errors on these values are the weighted 1σ non-systematic errors. Systematic errors were estimated by recalculating lifetimes using VMRs which had been modified to reflect differences between ACE-FTS retrieved VMRs and those from other instruments. The results of these calculations, including systematic errors, were as follows: 113 + (− 32 (20 for CFC-12, 123 + (− 83 (35 for N2O, 195 + (− 139 (57 for CH4, 35 + (− 14 (8 for CCl4 and 69 + (− 2119 (34 yr for CH3Cl. For CH3Cl & CH4 this represents the first calculation of the stratospheric lifetime using data from a space based instrument.

  9. An Evaluation of the Seat Belt Education Campaign.

    Science.gov (United States)

    Rochon, James

    A seat belt education campaign conducted in Canada to dispel myths surrounding seat belts and promote a better understanding of their functions was evaluated. Two telephone surveys, each comprised of 4,000 respondents, were conducted. The first was done immediately before the campaign and the second immediately succeeding the campaign. Also, a…

  10. 5 CFR 950.103 - Establishing a local campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Establishing a local campaign. 950.103... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.103 Establishing a local campaign. (a) The Director establishes and maintains the official list of local campaigns and the geographical area...

  11. Monitoring speed before and during a speed publicity campaign.

    NARCIS (Netherlands)

    Schagen, I.N.L.G. van Commandeur, J.J.F. Goldenbeld, C. & Stipdonk, H.

    2016-01-01

    Driving speeds were monitored during a period of 16 weeks encompassing different stages of an anti-speeding campaign in the Netherlands. This campaign targeted speed limit violations in built-up areas. The observation periods differed in terms of intensity and media used for the campaign. Small road

  12. Organ Donation Campaigns: Perspective of Dialysis Patient's Family Members.

    Directory of Open Access Journals (Sweden)

    Makmor Tumin

    2014-07-01

    Full Text Available Solving the dilemma of the organ shortage in Malaysia requires educating Malaysians about organ donation and transplantation. This paper aims at exploring the average Malaysian households ' preferred channels of campaigns and the preferred campaigners in a family setting, targeting at the dialysis family members.We analyzed the responses of 350 respondents regarding organ donation campaigns. The respondents are 2 family members of 175 dialysis patients from 3 different institutions. The information on respondents' willingness to donate and preferred method and channel of organ donation campaign were collected through questionnaire.Malaysian families have a good tendency to welcome campaigns in both the public and private (their homes spheres. We also found that campaigns facilitated by the electronic media (Television and Radio and executed by experienced doctors are expected to optimize the outcomes of organ donation, in general. Chi-square tests show that there are no significant differences in welcoming campaigns among ethnics. However, ethnics preferences over the campaign methods and campaigners are significantly different (P <0.05.Ethnic differences imply that necessary modifications on the campaign channels and campaigners should also be taken under consideration. By identifying the preferred channel and campaigners, this study hopes to shed some light on the ways to overcome the problem of organ shortage in Malaysia.

  13. The Persuasion of Image Building and Presidential Campaigns.

    Science.gov (United States)

    Thomas, David A.

    In a presidential election campaign, any dimension of an image is important if it motivates the voters to favor or disfavor a candidate. Therefore, to study what motivates electoral behavior is one way to study the persuasion of image building in presidential campaigns. In this paper some of the research in presidential election campaigns is…

  14. 29 CFR 452.69 - Expenses of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Expenses of campaign literature. 452.69 Section 452.69... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.69 Expenses of campaign literature. Each... is no requirement that the union distribute the literature of the candidate free of charge. In...

  15. Campaigning for Children's Oral Health: A Case Study

    Science.gov (United States)

    Vaughan, Kate

    2009-01-01

    Arguably, the ultimate application of evidenced-based communications is translating the research recommendations into a full-fledged media campaign. This article explains the development and implementation of Watch Your Mouth, a campaign based on FrameWorks Institute's research on children's oral health. To date, this innovative campaign has been…

  16. Fear and Leadership in Union Organizing Campaigns

    Directory of Open Access Journals (Sweden)

    Caroline Murphy

    2016-01-01

    Full Text Available This article adopts a mobilization framework to examine the crucial actions of workplace activists in overcoming fear of employer reprisal during union organizing campaigns in hostile environments. The article explores fear as part of the organizing process in two ways; first, we examine how fear can act as a stimulus for workplace activists to take action in an attempt to overcome the source of that fear. Second, we examine fear as an inhibiting factor in organizing, whereby the presence of fear hinders individuals from taking action. Using qualitative data from interviews conducted with workplace activists across a variety of campaigns in Ireland, this article examines the process through which workplace activists conquer their own sense of fear and undertake the task of mobilizing colleagues toward collective action in pursuit of union representation amid fear of employer reprisal.

  17. The OJ287 observing campaign hots up

    Science.gov (United States)

    Poyner, G.

    2006-12-01

    In the August 2006 issue of the Journal [116(4), 163-164] I gave details of the BAAVSS observing campaign to monitor the binary black hole OJ287. The campaign is now once again in full swing for the 2006/2007 season, now that solar conjunction is finally over. During the summer break, new analysis was done on the BAAVSS & TA data by Dr Mauri Valtonen (Dept of Physics and Tuorla Observatory, University of Turku, Finland & Dept of Physics, University of the West Indies, Trinidad) and Dr Mark Kidger (Herschel Science Centre, European Space Astronomy centre, Villafranca del Castillo Satellite Tracking Station, Madrid, Spain, & INSA) and Dr Harry Lehto (NORDITA, Copenhagen, Denmark). A detailed examination of these data from the past 15 years, and especially the last 12 months, has led to some interesting conclusions.

  18. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  19. Developing a Theory for Dynamic Campaign Planning,

    Science.gov (United States)

    1988-04-26

    historical campaigns. THE PURSUIT OF WISDOM AND ART Hermann Hesse. in his novel Siddhartha . develops a situation analogous to the search for a... Siddhartha who has become a ferryman on a river. Discovering that Siddhartha has achieved salvation, Govinda asks Siddhartha for the path. Siddhartha ...and that doctrine specifying both the process and product needs to be codified. 3. Hermann Hesse, Siddhartha , New York: Bantam Books Inc., 1974, p. 142

  20. Planning for Action: Campaign Concepts and Tools

    Science.gov (United States)

    2012-08-01

    with a brush full of paint needs certain techniques to start to communicate his vision on the canvas ; there has to be some method to start the...remain fairly consistent throughout a campaign, but it is not locked in concrete . It should be obvious that many factors can affect national strategic...of the desired conditions that describe success. Again, the end state is not set in concrete ; at this stage commanders are identifying broad

  1. The China Campaign Committee:1937-1945

    Institute of Scientific and Technical Information of China (English)

    Jenny; Clegg

    2015-01-01

    The China Campaign Committee rallied the British people in solidarity with China’s struggle Against Japanese aggression throughout the years of 1937-1945.Set up in the autumn of1937,its chair was Victor Gollancz,with Dorothy Woodman as secretary,and the Labour politician,Lord Listowel,as President.My father,a recent graduate of the London School of Economics,who had been following developments

  2. Feasibility study of the AOSTA experimental campaign

    Directory of Open Access Journals (Sweden)

    Carta M.

    2016-01-01

    Full Text Available The reduction of the nuclear waste is one of the most important nuclear issues. The high radiotoxicity of the spent fuel is due to plutonium and some minor actinides (MAs such as neptunium, americium and curium, above all. One way to reduce their hazard is to destroy by fission MAs in appropriate nuclear reactors. To allow the MAs destruction an important effort have been done on the nuclear data due to the poor knowledge in this field. In the framework of one of the NEA Expert Group on Integral Experiments for Minor Actinide Management an analysis of the feasibility of MAs irradiation campaign in the TAPIRO fast research reactor is carried out. This paper provides preliminary results obtained by calculations modelling the irradiation, in different TAPIRO irradiation channels, of some CEA samples coming from the French experimental campaign OSMOSE, loaded with different contents of MAs, in order to access, through particular peak spectrometry, to their capture cross section. On the basis of neutron transport calculation results, obtained by both deterministic and Monte Carlo methods, an estimate of the irradiated samples counting levels from the AOSTA (Activation of OSMOSE Samples in TAPIRO experimental campaign is provided.

  3. 11 CFR 9004.4 - Use of payments; examples of qualified campaign expenses and non-qualified campaign expenses.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Use of payments; examples of qualified campaign expenses and non-qualified campaign expenses. 9004.4 Section 9004.4 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: GENERAL ELECTION FINANCING ENTITLEMENT OF ELIGIBLE...

  4. Do vegetarian marketing campaigns promote a vegan diet?

    OpenAIRE

    James, Waters

    2015-01-01

    This paper examines whether vegetarian marketing campaigns promote a vegan diet. Our trivariate model of omnivorous, vegetarian, and vegan consumption is estimated using twenty years of UK data. For short-lived campaigns, we find no persistent effect, but observe a rise and fall in vegan numbers during adjustment. For long-running campaigns, we find that for every person who adopts a vegetarian diet in such a campaign, around 0.34 people adopt a vegan diet. In a campaign to market veganis...

  5. Coupling 3D groundwater modeling with CFC-based age dating to classify local groundwater circulation in an unconfined crystalline aquifer

    Science.gov (United States)

    Kolbe, Tamara; Marçais, Jean; Thomas, Zahra; Abbott, Benjamin W.; de Dreuzy, Jean-Raynald; Rousseau-Gueutin, Pauline; Aquilina, Luc; Labasque, Thierry; Pinay, Gilles

    2016-12-01

    Nitrogen pollution of freshwater and estuarine environments is one of the most urgent environmental crises. Shallow aquifers with predominantly local flow circulation are particularly vulnerable to agricultural contaminants. Water transit time and flow path are key controls on catchment nitrogen retention and removal capacity, but the relative importance of hydrogeological and topographical factors in determining these parameters is still uncertain. We used groundwater dating and numerical modeling techniques to assess transit time and flow path in an unconfined aquifer in Brittany, France. The 35.5 km2 study catchment has a crystalline basement underneath a ∼60 m thick weathered and fractured layer, and is separated into a distinct upland and lowland area by an 80 m-high butte. We used groundwater discharge and groundwater ages derived from chlorofluorocarbon (CFC) concentration to calibrate a free-surface flow model simulating groundwater flow circulation. We found that groundwater flow was highly local (mean travel distance = 350 m), substantially smaller than the typical distance between neighboring streams (∼1 km), while CFC-based ages were quite old (mean = 40 years). Sensitivity analysis revealed that groundwater travel distances were not sensitive to geological parameters (i.e. arrangement of geological layers and permeability profile) within the constraints of the CFC age data. However, circulation was sensitive to topography in the lowland area where the water table was near the land surface, and to recharge rate in the upland area where water input modulated the free surface of the aquifer. We quantified these differences with a local groundwater ratio (rGW-LOCAL), defined as the mean groundwater travel distance divided by the mean of the reference surface distances (the distance water would have to travel across the surface of the digital elevation model). Lowland, rGW-LOCAL was near 1, indicating primarily topographical controls. Upland, r

  6. Social marketing campaigns and children's media use.

    Science.gov (United States)

    Evans, W Douglas

    2008-01-01

    Media-related commercial marketing aimed at promoting the purchase of products and services by children, and by adults for children, is ubiquitous and has been associated with negative health consequences such as poor nutrition and physical inactivity. But, as Douglas Evans points out, not all marketing in the electronic media is confined to the sale of products. Increasingly savvy social marketers have begun to make extensive use of the same techniques and strategies used by commercial marketers to promote healthful behaviors and to counter some of the negative effects of conventional media marketing to children and adolescents. Evans points out that social marketing campaigns have been effective in helping to prevent and control tobacco use, increase physical activity, improve nutrition, and promote condom use, as well as other positive health behaviors. He reviews the evidence from a number of major recent campaigns and programming in the United States and overseas and describes the evaluation and research methods used to determine their effectiveness. He begins his review of the field of social marketing by describing how it uses many of the strategies practiced so successfully in commercial marketing. He notes the recent development of public health brands and the use of branding as a health promotion strategy. He then goes on to show how social marketing can promote healthful behavior, how it can counter media messages about unhealthful behavior, and how it can encourage discussions between parents and children. Evans concludes by noting some potential future applications to promote healthful media use by children and adolescents and to mitigate the effects of exposure to commercial marketing. These include adapting lessons learned from previous successful campaigns, such as delivering branded messages that promote healthful alternative behaviors. Evans also outlines a message strategy to promote "smart media use" to parents, children, and adolescents and

  7. The Velocity Campaign for Ignition on NIF

    Science.gov (United States)

    Callahan, Debra

    2011-10-01

    Achieving ignition requires a high velocity implosion since the energy required for ignition scales like 1/v8. Beyond ignition, a higher velocity produces more robust performance, which will be useful for applications of ignition. In the velocity campaign, we will explore three methods for increasing implosion velocity: increased laser power and energy, optimized hohlraum and capsule materials, and optimized capsule thickness. The main issue with increasing the laser power and energy is the way in which LPI (laser plasma interactions) and hot electron preheat will change as we increase the laser power. Based on scalings from previous data and theory, we expect to couple 80-85% of 1.5 MJ at 475-500 TW. We can also increase the velocity by optimizing the hohlraum and capsule materials. In this campaign, we will explore depleted uranium hohlraums to reduce wall loss and optimize the capsule dopant by replacing the germanium dopant with silicon. Those two changes are expected to increase velocity by 6-7%. Finally, we will optimize the capsule thickness. The optimal capsule thickness is a trade-off between velocity and mix. A thinner capsule has higher velocity, but is more susceptible to mix of the ablator material into the hotspot due to hydrodynamic instabilities seeded by ablation surface imperfections. Once we have achieved adequate capsule areal density, we will optimize the velocity/mix trade off by varying the capsule thickness. We will also make direct measure of Rayleigh-Taylor instability growth by backlighting the growth of engineered features on the surface of the capsule. This will allow us to benchmark our models of mix. In this paper, we will describe the designs and experimental results of the velocity campaign. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344.

  8. Forecasting for a Lagrangian aircraft campaign

    Directory of Open Access Journals (Sweden)

    A. Stohl

    2004-01-01

    Full Text Available A forecast system has been developed in preparation for an upcoming aircraft measurement campaign, where the same air parcels polluted by emissions over North America shall be sampled repeatedly as they leave the continent, during transport over the Atlantic, and upon their arrival over Europe. This paper describes the model system in advance of the campaign, in order to make the flight planners familiar with the novel model output. The aim of a Lagrangian strategy is to infer changes in the chemical composition and aerosol distribution occurring en route by measured upwind/downwind differences. However, guiding aircraft repeatedly into the same polluted air parcels requires careful forecasting, for which no suitable model system exists to date. This paper describes a procedure using both Eulerian-type (i.e. concentration fields and Lagrangian-type (i.e. trajectories model output from the Lagrangian particle dispersion model FLEXPART to predict the best opportunities for a Lagrangian experiment. The best opportunities are defined as being highly polluted air parcels which receive little or no emission input after the first measurement, which experience relatively little mixing, and which are reachable by as many aircraft as possible. For validation the system was applied to the period of the NARE 97 campaign where approximately the same air masses were sampled on different flights. Measured upwind/downwind differences in carbon monoxide (CO and ozone (O3 decreased significantly as the threshold values used for accepting cases as Lagrangian were tightened. This proves that the model system can successfully identify Lagrangian opportunities.

  9. Marketing campaigns and politics – british experience

    Directory of Open Access Journals (Sweden)

    Halida Sarajlić

    2007-12-01

    Full Text Available By gaining political power, individuals and political par¬ties at the same time gain the power to shape not only political but also public life. An accelerated growth of mass media communication has led to the development of various means and techniques of political marketing. This in turn requires certain adjustments to political campaigns and programs, out of which only those adapted to the new communication environment may succeed. Marketing in terms of politics and especially negative comparative advertising, which is becoming increasingly more present and intense in political campaigning, opens a series of ethical questions. Among others, these include whether such advertising in politics is effective, to what extent and what its consequences are. The goal of this paper is to present the main characteristics of political marketing, the effectiveness of the methods and techniques used in the course of elect¬ion campaigning, their consequences and basic differences between political marketing and products and services marketing. A special emphasis will be placed on the presentation of political marketing of Great Britain, which has a long tradition in utilizing marketing methods and techniques in the political arena. Moreover, political moves made by politicians and political parties in Great Britain certainly make a good starting point for shaping an optimal political strategy in other countries, while at the same time taking into account the particulars of a specific political and social environment. Content analysis methodology was used in the preparation of this paper and all the data were gathered from secondary sources.

  10. Forecasting for a Lagrangian aircraft campaign

    Directory of Open Access Journals (Sweden)

    A. Stohl

    2004-05-01

    Full Text Available A forecast system has been developed in preparation for an upcoming aircraft measurement campaign, where the same air parcels polluted by emissions over North America shall be sampled repeatedly as they leave the continent, during transport over the Atlantic, and upon their arrival over Europe. This paper describes the model system in advance of the campaign, in order to make the flight planners familiar with the novel model output. The aim of a Lagrangian strategy is to infer changes in the chemical composition and aerosol distribution occurring en route by measured upwind/downwind differences. However, guiding aircraft repeatedly into the same polluted air parcels requires careful forecasting, for which no suitable model system exists to date. This paper describes a procedure using both Eulerian-type (i.e. concentration fields and Lagrangian-type (i.e. trajectories model output from the Lagrangian particle dispersion model FLEXPART to predict the best opportunities for a Lagrangian experiment. The best opportunities are defined as being highly polluted air parcels which receive little or no emission input after the first measurement, which experience relatively little mixing, and which are reachable by as many aircraft as possible. For validation the system was applied to the period of the NARE 97 campaign where approximately the same air masses were sampled on different flights. Measured upwind/downwind differences in carbon monoxide (CO and ozone (O3 decreased significantly as the threshold values used for accepting cases as Lagrangian were tightened. This proves that the model system can successfully identify Lagrangian opportunities.

  11. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  12. Talking "truth": predictors and consequences of conversations about a youth antismoking campaign for smokers and nonsmokers.

    Science.gov (United States)

    Dunlop, Sally M

    2011-08-01

    Using data from the Legacy Media Tracking Survey II, this study investigated relations among youth's evaluations of the "truth" antismoking campaign, campaign-related interpersonal discussion, and campaign-relevant outcomes (n = 8,000). Regression analyses showed that smokers were less likely to have discussed the campaign than nonsmokers, and this effect was mediated by negative campaign evaluation. However, smokers with a negative evaluation of the campaign were more likely to talk about it than were nonsmokers reporting negative evaluation. Nonsmokers who talked about the campaign had beliefs, attitudes, and intentions in greater agreement with campaign messages than those who did not talk about the campaign. For smokers, talking about the campaign was associated with beliefs, attitudes, and intentions in greater agreement with campaign messages, but only if associated with positive campaign evaluation. For smokers with a negative campaign evaluation, talking about the campaign was associated with beliefs and attitudes counter to the campaign messages.

  13. Advanced Fuels Campaign Cladding & Coatings Meeting Summary

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2013-03-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) organized a Cladding and Coatings operational meeting February 12-13, 2013, at Oak Ridge National Laboratory (ORNL). Representatives from the U.S. Department of Energy (DOE), national laboratories, industry, and universities attended the two-day meeting. The purpose of the meeting was to discuss advanced cladding and cladding coating research and development (R&D); review experimental testing capabilities for assessing accident tolerant fuels; and review industry/university plans and experience in light water reactor (LWR) cladding and coating R&D.

  14. Advanced Fuels Campaign FY 2015 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Braase, Lori Ann [Idaho National Lab. (INL), Idaho Falls, ID (United States); Carmack, William Jonathan [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-10-29

    The mission of the Advanced Fuels Campaign (AFC) is to perform research, development, and demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This report is a compilation of technical accomplishment summaries for FY-15. Emphasis is on advanced accident-tolerant LWR fuel systems, advanced transmutation fuels technologies, and capability development.

  15. Running a successful campaign against unionization.

    Science.gov (United States)

    Block, Velinda J; Jamerson, Patricia A

    2005-01-01

    Unions, once rare in healthcare, are now targeting hospital employees as potential members. In an industry that has seen an increase in regulations, mergers and acquisitions, rising financial pressures, and changing working conditions, it is easy to understand why discontented employees are being targeted by unions now more than ever. Hospital leaders must look to lessons learned in other organizations to develop strategies that will ensure a successful campaign. In 2003, St. Louis Children's Hospital defeated the Missouri Nurses Association/United American Nurse with a 77% no vote. The authors describe an overview of unionization in healthcare and the strategies they used to successfully win this union election.

  16. Results of a workplace health campaign

    DEFF Research Database (Denmark)

    Leyk, Dieter; Rohde, Ulrich; Hartmann, Nadine D;

    2014-01-01

    is that the target groups are too rarely reached and sustainable benefits too rarely achieved. In 2011, we carried out a broad-based health and fitness campaign to assess how many personnel could be motivated to participate in a model study under nearly ideal conditions. METHOD: 1010 personnel were given...... and strength). The duration of the study was one year. RESULTS: 490 of the 1010 personnel (48.5%, among whom 27.2% were nonactive, 44.1% not very active, and 28.7% very active) participated in the initial questionnaire and testing. By the end of the study, this figure had dropped to 17.8%; diminished...

  17. Second-rate election campaigning? An analysis of campaign styles in European parliamentary elections

    NARCIS (Netherlands)

    C.H. de Vreese

    2009-01-01

    The literature on professionalization of political campaigns is strongly biased toward first-order (national) elections and the U.S. and U.K. contexts. This study expands that scope. Based on a survey of candidates for the 2004 European elections in eight European Union countries, we tested whether

  18. Materials Compatibility and Lubricants Research of CFC-refrigerant substitutes. Quarterly technical progress report, 1 April 1993--30 June 1993

    Energy Technology Data Exchange (ETDEWEB)

    Godwin, D.S.; Hourahan, G.C.; Szymurski, S.R.

    1993-07-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The DCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. Under the current MCLR program the Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) is contracting and managing multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each researcher.

  19. A combined morphostructural/fluid migration model of Pisciarelli area (Campi Flegrei caldera - CFc) through structural and integrated Terrestrial Laser Scanner (TLS) and Electrical Resistivity Tomography (ERT) analysis.

    Science.gov (United States)

    Caputo, Teresa; Di Giuseppe, Maria Guilia; Troiano, Antonio; Somma, Renato; Isaia, Roberto; Vitale, Stefano; Troise, Claudia; De Natale, Giuseppe

    2014-05-01

    The Solfatara-Pisciarelli (S-P) area was characterized by an intense eruptive activity during the last 5 ka and is presently the highly distributed degassing zones inside the CFC, worldwide well-known for its bradyseismic phenomenon. The last two main crises occurred during the 1970-72 and 1982-84, associated with an overall 3.5 m of ground uplift and an elevate rate of low magnitude seismicity. A strong direct relationship has always been observed between the increase of hydrothermal activity in the S-P area and ground uplift of the CFc. More recently starting from the 2005 a new gradual increase of the hydrothermal activity and ground uplift has been observed, with a steep growth of these effects from 2012, accompanied by seismic events with highest magnitude of 1.8. The Pisciarelli area has been the site of a significant morphological changes of its hydrothermal field including new fumarolic vents and a wide enlargement of a mud pool. Monitoring either landscape deformation than fluids migration of the S-P activity can be considered a good indicator of the volcanic dynamics taking place in the whole CFc caldera. This study shows a first attempt to integrate multidisciplinary approach including volcanological and structural field surveys and studies such us TLS and ERT signals applied to this highly dynamic areas. A detailed geo-structural survey allow us to characterize the complex pattern of fractures and faults recorded in the volcanic rocks in different times of the polyphasic CFc volcanic history. In order to statistically record data about fault and fracture (i) attitudes and (ii) spacing, the scan line method was applied. The whole planar structure is the locus of the well-known fumaroles and mud pools of Pisciarelli. A first time detailed Digital Terrestrial Model DTM of the area with an accuracy of 5cm obtained through TLS has been integrated combining the ERT of the lower part of the area, characterized by a widespread fumarolic activity and soil

  20. K2 Microlensing and Campaign 9

    Science.gov (United States)

    Penny, Matthew

    2016-06-01

    Campaign 9 of K2 will observe a contiguous 3.7 deg^2 region of the Galactic bulge in order to search for microlensing events and measure microlens parallaxes. It will also perform targeted follow-up of approximately 50 microlensing events spread throughout the Kepler focal plane. Parallax measurements are a critical ingredient for measurements of both the lens mass and distance, which contribute to our understanding of the formation of cold exoplanets, and the formation of planets as a function of Galactic environment. Additionally, as the first un-targeted, space-based microlensing survey, K2C9 offers us the first chance to measure the masses and kinematics of a large population of free-floating planet candidates, whose large abundance has been a puzzle since their discovery.I will review the scientific goals of the K2C9 survey, which will be well underway, and report on the ongoing activity of the K2 Campaign 9 Microlensing Science Team and the wider microlensing community, with a focus on the progress that has been made towards analyzing K2 data in crowded fields.

  1. The Gemini NICI Planet-Finding Campaign

    CERN Document Server

    Liu, Michael C; Biller, Beth A; Nielsen, Eric L; Chun, Mark; Close, Laird M; Ftaclas, Christ; Hartung, Markus; Hayward, Thomas L; Clarke, Fraser; Reid, I Neill; Shkolnik, Evgenya L; Tecza, Matthias; Thatte, Niranjan; Alencar, Silvia; Artymowicz, Pawel; Boss, Alan; Burrows, Adam; Pino, Elisabethe de Gouveia Dal; Gregorio-Hetem, Jane; Ida, Shigeru; Kuchner, Marc J; Lin, Douglas; Toomey, Douglas

    2010-01-01

    Our team is carrying out a multi-year observing program to directly image and characterize young extrasolar planets using the Near-Infrared Coronagraphic Imager (NICI) on the Gemini-South 8.1-meter telescope. NICI is the first instrument on a large telescope designed from the outset for high-contrast imaging, comprising a high-performance curvature adaptive optics system with a simultaneous dual-channel coronagraphic imager. Combined with state-of-the-art observing methods and data processing, NICI typically achieves ~2 magnitudes better contrast compared to previous ground-based or space-based programs, at separations inside of ~2 arcsec. In preparation for the Campaign, we carried out efforts to identify previously unrecognized young stars, to rigorously construct our observing strategy, and to optimize the combination of angular and spectral differential imaging. The Planet-Finding Campaign is in its second year, with first-epoch imaging of 174 stars already obtained out of a total sample of 300 stars. We ...

  2. Public health campaigns and obesity - a critique

    Directory of Open Access Journals (Sweden)

    Proietto Joseph

    2011-02-01

    Full Text Available Abstract Background Controlling obesity has become one of the highest priorities for public health practitioners in developed countries. In the absence of safe, effective and widely accessible high-risk approaches (e.g. drugs and surgery attention has focussed on community-based approaches and social marketing campaigns as the most appropriate form of intervention. However there is limited evidence in support of substantial effectiveness of such interventions. Discussion To date there is little evidence that community-based interventions and social marketing campaigns specifically targeting obesity provide substantial or lasting benefit. Concerns have been raised about potential negative effects created by a focus of these interventions on body shape and size, and of the associated media targeting of obesity. Summary A more appropriate strategy would be to enact high-level policy and legislative changes to alter the obesogenic environments in which we live by providing incentives for healthy eating and increased levels of physical activity. Research is also needed to improve treatments available for individuals already obese.

  3. Precipitation properties observed during CHUVA Field Campaign

    Science.gov (United States)

    Morales, C.; Machado, L. A.; Angelis, C. F.; Silva Dias, M. A. F.; Fisch, G.; Carvalho, I. C.; Biscaro, T.; Sakuragi, J.; Neves, J. R.; Anselmo, E. M.; Lacerda, M.

    2012-04-01

    CHUVA is a Brazilian research program that seeks to depict the main precipitating systems observed in Brazil as a support for the Global Precipitation Measurement (GPM) mission. CHUVA is conducting a series of field campaigns in the time frame of 2010-2013 to sample raining systems that vary from maritime to continental regime and in polluted and clean environments. For this study, we will present initially the drop size distribution (DSD) variability observed in the field experiments of Alcantara (March/2010), Fortaleza (April/2011), Belém (June/2011) and Vale do Paraiba (November-December/2011). Secondly, with the help of the mobile X-Band and MRR-2, we will show the DSD differences observed on warm and cold phase clouds, and convective and stratiform precipitation. Finally, by employing the vertical electrical field and lightning measurements together with the weather radar, we will present the main vertical precipitation features observed in thunderstorms and non- thunderstorms, in addition to the different raining systems observed during the four field campaigns.

  4. Transmutation Fuel Campaign Description and Status

    Energy Technology Data Exchange (ETDEWEB)

    Jon Carmack; Kemal O. Pasamehmetoglu

    2008-01-01

    This report contains a technical summary package in response to a Level 2 milestone in the transmutation fuel campaign (TFC) management work-package calling for input to the Secretarial decision. At present, the form of the Secretarial decision package is not fully defined, and it is not clear exactly what will be required from the TFC as a final input. However, it is anticipated that a series oftechnical and programmatic documents will need to be provided in support of a wider encompassing document on GNEP technology development activities. The TFC technical leadership team provides this report as initial input to the secretarial decision package which is being developed by the Technical Integration Office (TIO) in support of Secretarial decision. This report contains a summary of the TFC execution plan with a work breakdown structure, highlevel schedule, major milestones, and summary description of critical activities in support of campaign objectives. Supporting documents referenced in this report but provided under separate cover include: • An updated review of the state-of-the art for transmutation fuel development activities considering national as well as international fuel research and development testing activities. • A definition of the Technology Readiness Level (TRL) used to systematically define and execute the transmutation fuel development activities.

  5. Post-campaign information from the Infirmary

    CERN Multimedia

    2015-01-01

    The Medical Service’s “TAKE YOUR BLOOD PRESSURE TO HEART” campaign, which ran from 24 to 27 March 2015 (see here), was a resounding success.   In total, 274 people visited the nurses at their pop-up clinics (in Building 40, Restaurants 2 and 3 and the Main Building) or at the Infirmary (Building 57). Each of them had their blood pressure measured and received information and advice about high blood pressure, its contributory factors and ways to control it. They were also offered various leaflets about this public health issue. We would like to draw attention to the fact that 21% of the participants were found to have abnormally high blood-pressure and, crucially, 72% of these had been unaware of the problem. Another point to note is that a significant proportion (16%) of the younger people tested (aged 18 to 30) had abnormal results. The results of this campaign demonstrate the importance of early screening, but also the high level of interest among the pers...

  6. The impact of thermal fatigue and carbidization on the W coatings deposited on CFC tiles for the ITER-like Wall project at JET

    Energy Technology Data Exchange (ETDEWEB)

    Ruset, C., E-mail: ruset@infim.ro [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); Grigore, E.; Falie, D.; Gherendi, M. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); Maier, H. [Max-Plank Institut für Plasma Physik, Euratom Association, 85748 Garching (Germany); Rasinski, M. [Faculty of Materials Science and Engineering, Warsaw University of Technology, Warsaw (Poland); Matthews, G.F. [Culham Centre for Fusion Energy, Euratom Association, Abingdon (United Kingdom); Zoita, V. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); EFDA Close Support Unit, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom)

    2013-10-15

    Highlights: ► Degradation curves of the W coatings depend on temperature and number of pulses. ► Thermo-mechanical properties of the W coatings are associated with degradation curves. ► Thermal fatigue and carbidization affect the interface between CFC and W. ► A pore structure was detected at the interface by SEM examination. -- Abstract: Since August 2011 JET operates with the ITER-like wall comprising bulk Be tiles, bulk W tiles and W coated CFC tiles with a thickness of 10–15 μm and 20–25 μm. In order to evaluate behavior of the W coatings to a cyclic thermal loading relevant to JET operation, high heat flux (HHF) tests have been carried out up to 5100 pulses with an electron beam facility at peak temperatures of 1000 °C, 1250 °C and 1450 °C. The pulse duration was 24 s. Optical inspections of the W layer performed periodically by interrupting the test revealed small delaminations with the size of 50–500 μm. The dependence of the delamination percentage on the number of pulses can be seen as a degradation curve for each particular W coating. In this way the thermo-mechanical properties of the W coatings can be characterized quantitatively. Thermal fatigue and carbidization of the tungsten due to the diffusion of the carbon from the substrate have been recognized as mechanisms for degradation of the coatings. Tungsten carbides have been identified by using TEM (transmission electron microscopy) diffraction analysis on FIB (focused ion beam) prepared cross-section samples subjected to HHF tests. Nano-pores developed at the CFC–Mo and Mo–W interfaces during the tests might be also responsible for the degradation of the coating.

  7. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Maurice Ewing Cruise in the Atlantic Ocean (WOCE Section A17, 4 January - 21 March 1994)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2005-06-30

    This documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and pH at hydrographic stations during the R/V Maurice Ewing cruise in the South Atlantic Ocean on the A17 WOCE section. Conducted as part of the World Ocean Circulation Experiment (WOCE), this cruise was also a part of the French WOCE program consisting of three expeditions (CITHER 1, 2, and 3) focused on the South Atlantic Ocean. The A17 section was occupied during the CITHER 2 expedition, which began in Montevideo, Uruguay, on January 4, 1994 and finished in Cayenne, French Guyana, on March 21, 1994. During this period the ship stopped in Salvador de Bahia and Recife, Brazil, to take on supplies and exchange personnel. Upon completion of the cruise the ship transited to Fort de France, Martinique. Instructions for accessing the data are provided.

  8. Lessons learned from the TMT site testing campaign

    CERN Document Server

    Travouillon, T; Riddle, R L; Schöck, M; Skidmore, A W

    2011-01-01

    After a site testing campaign spanning 5 sites over a period of 5 years, the site selection for the Thirty Meter Telescope (TMT) culminated with the choice of Mauna Kea 13N in Hawaii. During the campaign, a lot practical lessons were learned by our team and these lessons can be shared with current and future site testing campaign done for other observatories. These lessons apply to the preselection of the site, the ground work and operations of the campaign as well as the analysis of the data. We present of selection of such lessons in this paper preceded by a short summary of the TMT site testing activities.

  9. [Research on China railway health campaign in 1930s].

    Science.gov (United States)

    Huang, Huaping

    2015-01-01

    The motivation factors of China's railway health campaign in 1930s included avocation by the government, mass media mobilization, railway authorities' hygiene awareness and the systematization of the construction of organization. During the health campaign, the railway authorities adopted various approaches for its formation, including the rally speeches, distribution of materials, cleaning and vaccination etc. Unfortunately, the actual effect of railway health campaign was not satisfactory, yet, it enhanced theoretically railway employees' health knowledge and contributed to the promotion of modernization of hygienic knowledge. Meanwhile, there still existed many problems in the railway health campaign, for example, lack of funds, formalism and uneven development among the railway bureaus.

  10. Cost Effective Campaigning in Social Networks

    CERN Document Server

    Kotnis, Bhushan

    2016-01-01

    Campaigners are increasingly using online social networking platforms for promoting products, ideas and information. A popular method of promoting a product or even an idea is incentivizing individuals to evangelize the idea vigorously by providing them with referral rewards in the form of discounts, cash backs, or social recognition. Due to budget constraints on scarce resources such as money and manpower, it may not be possible to provide incentives for the entire population, and hence incentives need to be allocated judiciously to appropriate individuals for ensuring the highest possible outreach size. We aim to do the same by formulating and solving an optimization problem using percolation theory. In particular, we compute the set of individuals that are provided incentives for minimizing the expected cost while ensuring a given outreach size. We also solve the problem of computing the set of individuals to be incentivized for maximizing the outreach size for given cost budget. The optimization problem t...

  11. Fit for purpose: Australia's National Fitness Campaign.

    Science.gov (United States)

    Collins, Julie A; Lekkas, Peter

    2011-12-19

    During a time of war, the federal government passed the National Fitness Act 1941 to improve the fitness of the youth of Australia and better prepare them for roles in the armed services and industry. Implementation of the National Fitness Act made federal funds available at a local level through state-based national fitness councils, which coordinated promotional campaigns, programs, education and infrastructure for physical fitness, with volunteers undertaking most of the work. Specifically focused on children and youth, national fitness councils supported the provision of children's playgrounds, youth clubs and school camping programs, as well as the development of physical education in schools and its teaching and research in universities. By the time the Act was repealed in 1994, fitness had become associated with leisure and recreation rather than being seen as equipping people for everyday life and work. The emergence of the Australian National Preventive Health Agency Act 2010 offers the opportunity to reflect on synergies with its historic precedent.

  12. Strategies for reward-based crowdfunding campaigns

    DEFF Research Database (Denmark)

    Kraus, Sascha; Richter, Christian; Brem, Alexander

    2016-01-01

    Crowdfunding represents an alternative way of funding entrepreneurial ventures – and is attracting a high amount of interest in research as well as practice. Against this back- ground, this paper analyzes reward-based crowdfunding campaign strategies and their communication tools. To do this, 446...... crowdfunding projects were gathered and empirically analyzed. Three different paths of successful crowdfunding projects could be identified and are described in detail. Practical implications of crowdfunding strategies are derived, and are dependent on the required sales effort and the project added value....... The terms communicator, networker and self-runner are created for this crowdfunding strategy and filled with practi- cal examples. This paper contributes to the literature in different ways: first, it sheds more light on the developing concept of crowdfunding, with an overview of current academic dis...

  13. Environmental Awareness Campaign: The Change It Brings

    Directory of Open Access Journals (Sweden)

    Merlita C. Medallon

    2014-02-01

    Full Text Available The study was conducted to determine the awareness and sensitivity of the younger generation in environmental issues such global warming, climate change and waste management. Data were gathered from selected students who attended the environmental awareness seminar held at Lyceum of the Philippines – Laguna in 2011. There were 54 students who participated in the survey. The respondents had participated in several activities related to environmental issues which include attendance to seminars, and participation in school and community projects. Most of the information about environmental issues was obtained by the students from their teachers. Global warming was the most common issue. There was a significant increase in the level of knowledge after the environmental awareness campaign was made. As a result, the highest level of action proposed by the students is on the proper disposal of wastes and the proper segregation of wastes.

  14. Advanced Fuels Campaign FY 2011 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2011-11-01

    One of the major research and development (R&D) areas under the Fuel Cycle Research and Development (FCRD) program is advanced fuels development. The Advanced Fuels Campaign (AFC) has the responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. Accomplishments made during fiscal year (FY 20) 2011 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section. The order of the accomplishments in this report is consistent with the AFC work breakdown structure (WBS).

  15. Manufactured Doubt: The Campaign Against Nuclear Energy

    Science.gov (United States)

    Rogers, N. L.

    2012-12-01

    Nuclear electricity is a CO2 free technology with a proven track record of large scale commercial deployment. For example, France generates 78% of its electrical power with nuclear plants. France has the lowest pre-tax cost of electricity in Europe at 4.75 eurocents per KWH and France is the world's largest exporter of electricity. There are large world reserves of uranium sufficient for hundreds of years, even without breeder technology. Additionally, thorium, another radioactive mineral is in even more plentiful supply. Although present-day nuclear technology has proven to be safe and reliable, waiting in the wings is new generation technology that promises great improvements in both safety and cost. Yet, there has been a calculated and sophisticated campaign in the later part of the 20th century to create doubt and fear concerning nuclear power. In the United States this campaign has essentially destroyed the nuclear industry. No new plants have been commissioned for decades. Leadership in the nuclear power field has been ceded to other countries. The great paradox is that the very organizations that express great alarm concerning CO2 emissions are the same organizations that led the campaign against nuclear power decades ago. Representatives of these organizations will say privately that they are taking a new look at nuclear power, but no major organization has reversed course and become a supporter of nuclear power. To do so would involve a loss of face and create doubts concerning the credibility of the organization. As recently as 2001 environmentalist lobbyists made great efforts to ensure that no credit could be given for nuclear power under the Kyoto accords and the associated clean development mechanism. They succeeded and nuclear power receives unfavorable treatment under the Kyoto accords even though it is a proven solution for reducing CO2 emissions. The technique used to destroy nuclear energy as a viable alternative in the United States had two

  16. Campaigning for Organ Donation at Mosques.

    Science.gov (United States)

    Rady, Mohamed Y; Verheijde, Joseph L

    2016-09-01

    There is a trend of recruiting faith leaders at mosques to overcome religious barriers to organ donation, and to increase donor registration among Muslims. Commentators have suggested that Muslims are not given enough information about organ donation in religious sermons or lectures delivered at mosques. Corrective actions have been recommended, such as funding campaigns to promote organ donation, and increasing the availability of organ donation information at mosques. These actions are recommended despite published literature expressing safety concerns (i.e., do no harm) in living and end-of-life organ donation. Living donors require life-long medical follow-up and treatment for complications that can appear years later. Scientific and medical controversies persist regarding the international guidelines for death determination in end-of-life donation. The medical criteria of death lack validation and can harm donors if surgical procurement is performed without general anesthesia and before biological death. In the moral code of Islam, the prevention of harm holds precedence over beneficence. Moral precepts described in the Quran encourage Muslims to be beneficent, but also to seek knowledge prior to making practical decisions. However, the Quran also contains passages that demand honesty and truthfulness when providing information to those who are seeking knowledge. Currently, information is limited to that which encourages donor registration. Campaigning for organ donation to congregations in mosques should adhere to the moral code of complete, rather than selective, disclosure of information. We recommend as a minimal standard the disclosure of risks, uncertainties, and controversies associated with the organ donation process.

  17. An Empirical Assessment of the "Above the Influence" Advertising Campaign

    Science.gov (United States)

    Scheier, Lawrence M.; Grenard, Jerry L.; Holtz, Kristen D.

    2011-01-01

    This study evaluated the efficacy of "Above the Influence" (ATI), a national media-based health persuasion campaign to deter youth drug use. The campaign uses public service anti-drug prevention messages and targets youth between the ages of 14 and 16, a period of heightened susceptibility to peer influences. The evaluation utilized mall…

  18. Formulation and Use of a Politik Campaign Game

    Science.gov (United States)

    Bozeman, Barry

    1974-01-01

    This article is a report of a campaign game that was formulated in order to introduce the student to the realities of political campaigning. Post-game tests indicated that the game generally increased political interest and had little effect on measured political attitudes such as efficacy, saliency and alienation. (Author)

  19. Communicating Sustainability: Student Perceptions of a Behavior Change Campaign

    Science.gov (United States)

    Godfrey, D. Matthew; Feng, Patrick

    2017-01-01

    Purpose: This paper aims to investigate the impacts of a science-based environmental communication campaign at a university dining hall. The impacts are assessed in terms of student attitudes toward sustainability, food consumption choices and perceptions and understanding of the campaign and the information it communicated.…

  20. Mediacampaign - A multimodal semantic analysis system for advertisement campaign detection

    NARCIS (Netherlands)

    Rehatschek, H.; Sorschag, R.; Rettenbacher, B.; Zeiner, H.; Nioche, J.; Jong, F. de; Ordelmann, R.; Leeuwen, D. van

    2008-01-01

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project's main goal is to automate to a large degree the detection and tracking of advertisement

  1. Mass-media publicity campaign on driving while intoxicated.

    NARCIS (Netherlands)

    Wesemann, P.

    1986-01-01

    Mass media publicity campaigns against driving while intoxicated have been conducted in the netherlands for a number of years. A new, more aggressive approach was introduced in 1984 with the slogan "alcohol ..... all too easily a crime". Goals of this campaign were (1) internationalization of the le

  2. Observations during the first K West fuel shipping campaign

    Energy Technology Data Exchange (ETDEWEB)

    Makenas, B.J.

    1995-11-01

    Three fuel elements were shipped to the 300 Area hotcells during the first characterization shipping campaign from K West Basin. This document summarizes observations made during this campaign including the gas, liquid, and sludge content of the observed canisters. Included in an appendix is a detailed evaluation of fuel element condition for each canister opened

  3. Queer & Ally Youth Involvement in the Fair Wisconsin Campaign

    Science.gov (United States)

    Stiegler, Sam

    2008-01-01

    This article discusses the role and experience of queer youth and allies in the Fair Wisconsin campaign that fought against the marriage amendment to that state's constitution. It illustrates how LGBT and ally youth involvement can be incorporated into other organizations. Following an explanation of the campaign, are narratives of two…

  4. Which Updates During an Equity Crowdfunding Campaign Increase Crowd Participation?

    NARCIS (Netherlands)

    J.H. Block (Jörn); L. Hornuf (Lars); A. Moritz (Alexandra)

    2016-01-01

    textabstractStart-ups often post updates during equity crowdfunding campaigns. Yet, little is known about the effects of such updates on funding success. We investigate this question using hand-collected data from 71 funding campaigns on two German equity crowdfunding portals. Using a combination of

  5. National campaign effects on secondary pupils’ bullying and violence

    NARCIS (Netherlands)

    Mooij, Ton

    2016-01-01

    Background. Research on pupils' bullying (1991) and violence (1993) motivated the Dutch Ministry of Education, Culture and Science to initiate a national campaign on school safety. The government campaign was undertaken from 1995 to 2000. Aim. To test for differences in secondary pupils' bullying a

  6. 11 CFR 9004.9 - Net outstanding qualified campaign expenses.

    Science.gov (United States)

    2010-01-01

    ... such as computer systems and telecommunications systems, if the equipment is used together and if the... 11 Federal Elections 1 2010-01-01 2010-01-01 false Net outstanding qualified campaign expenses. 9004.9 Section 9004.9 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN...

  7. Mediacampaign: A Multimodal Semantic Analysis System for Advertisement Campaign Detection

    NARCIS (Netherlands)

    Rehatschek, Herwig; Sorschag, Robert; Rettenbacher, Bernhard; Zeiner, Herwig; Nioche, Julien; Jong, de Franciska; Ordelman, Roeland; Leeuwen, van David A.

    2008-01-01

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project’s main goal is to automate to a large degree the detection and tracking of advertisement

  8. Teaching PR Campaigns: The Current State of the Art.

    Science.gov (United States)

    Benigni, Vincent L.; Cameron, Glen T.

    1999-01-01

    Reports results from a national survey regarding courses on public-relations campaigns. Examines predominant pedagogical strategies and course-management text techniques used; intentions for the course; theory/research elements; the role of management skill and/or interpersonal dynamics in the student campaign both internally and externally, and…

  9. Getting the message across: perceived effectiveness of political campaign communication

    NARCIS (Netherlands)

    van Spanje, J.; Boomgaarden, H.G.; Elenbaas, M.; Vliegenthart, R.; Azrout, R.; Schuck, A.R.T.; de Vreese, C.H.

    2013-01-01

    Do political actors communicate effectively during electoral campaigns? We introduce a novel concept in electoral research, the "perceived effectiveness of political parties' election campaigns." This evaluation concentrates on the extent to which a party is seen as getting its message across to the

  10. Evaluating Direct Marketing Campaigns: recent findings and future research topics

    NARCIS (Netherlands)

    J-J. Jonker (Jedid-Jah); Ph.H.B.F. Franses (Philip Hans); N. Piersma (Nanda)

    2002-01-01

    textabstractThis paper contains a survey of the recent literature on the evaluation of direct marketing campaigns. We give an outline of the various stages included in such a campaign. Next, we review the statistical methods most frequently used and we review the general findings from using these me

  11. Evaluating Direct Marketing Campaigns: recent findings and future research topics

    OpenAIRE

    Jonker, Jedid-Jah; Franses, Philip Hans; Piersma, Nanda

    2002-01-01

    textabstractThis paper contains a survey of the recent literature on the evaluation of direct marketing campaigns. We give an outline of the various stages included in such a campaign. Next, we review the statistical methods most frequently used and we review the general findings from using these methods.

  12. Stimulating dialogue: measuring success of the "Smoke Free Horry" campaign.

    Science.gov (United States)

    Anderson, Christina; Holody, Kyle J

    2013-01-01

    Smoke Free Horry was an anti-secondhand smoke media campaign that ran in Horry County, South Carolina in 2011 and 2012. The present study assessed the campaign's ability to stimulate interpersonal dialogue about the campaign-specifically its four television public service announcements (PSAs)-as well as about other smoking-related topics, among a sample of 285 Horry County young adults. Survey data suggested talking about anti-smoking PSAs was related to subsequent discussion about smoking-related topics and positive perceptions of the campaign's effectiveness. PSAs using emotional appeals and that discussed the negative health effects of smoking/secondhand smoke were related to the most interpersonal discussions about smoking, secondhand smoking, and smoking bans. Implications for future anti-smoking campaign design are discussed.

  13. Status Report on the Development of Research Campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Baer, Donald R.; Baker, Scott E.; Washton, Nancy M.; Linggi, Bryan E.

    2013-06-30

    Research campaigns were conceived as a means to focus EMSL research on specific scientific questions. Campaign will help fulfill the Environmental Molecular Sciences Laboratory (EMSL) strategic vision to develop and integrate, for use by the scientific community, world leading capabilities that transform understanding in the environmental molecular sciences and accelerate discoveries relevant to the Department of Energy’s (DOE’s) missions. Campaigns are multi-institutional multi-disciplinary projects with scope beyond those of normal EMSL user projects. The goal of research campaigns is to have EMSL scientists and users team on the projects in the effort to accelerate progress and increase impact in specific scientific areas by focusing user research, EMSL resources, and expertise in those areas. This report will give a history and update on the progress of those campaigns.

  14. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (tracers, otherwise would have supported the suitability of

  15. Critical Metadata for Spectroscopy Field Campaigns

    Directory of Open Access Journals (Sweden)

    Barbara A. Rasaiah

    2014-04-01

    Full Text Available A field spectroscopy metadata standard is defined as those data elements that explicitly document the spectroscopy dataset and field protocols, sampling strategies, instrument properties and environmental and logistical variables. Standards for field spectroscopy metadata affect the quality, completeness, reliability, and usability of datasets created in situ. Currently there is no standardized methodology for documentation of in situ spectroscopy data or metadata. This paper presents results of an international experiment comprising a web-based survey and expert panel evaluation that investigated critical metadata in field spectroscopy. The survey participants were a diverse group of scientists experienced in gathering spectroscopy data across a wide range of disciplines. Overall, respondents were in agreement about a core metadataset for generic campaign metadata, allowing for a prioritization of critical metadata elements to be proposed including those relating to viewing geometry, location, general target and sampling properties, illumination, instrument properties, reference standards, calibration, hyperspectral signal properties, atmospheric conditions, and general project details. Consensus was greatest among individual expert groups in specific application domains. The results allow the identification of a core set of metadata fields that enforce long term data storage and serve as a foundation for a metadata standard. This paper is part one in a series about the core elements of a robust and flexible field spectroscopy metadata standard.

  16. Cost effective campaigning in social networks

    Science.gov (United States)

    Kotnis, Bhushan; Kuri, Joy

    2016-05-01

    Campaigners are increasingly using online social networking platforms for promoting products, ideas and information. A popular method of promoting a product or even an idea is incentivizing individuals to evangelize the idea vigorously by providing them with referral rewards in the form of discounts, cash backs, or social recognition. Due to budget constraints on scarce resources such as money and manpower, it may not be possible to provide incentives for the entire population, and hence incentives need to be allocated judiciously to appropriate individuals for ensuring the highest possible outreach size. We aim to do the same by formulating and solving an optimization problem using percolation theory. In particular, we compute the set of individuals that are provided incentives for minimizing the expected cost while ensuring a given outreach size. We also solve the problem of computing the set of individuals to be incentivized for maximizing the outreach size for given cost budget. The optimization problem turns out to be non trivial; it involves quantities that need to be computed by numerically solving a fixed point equation. Our primary contribution is, that for a fairly general cost structure, we show that the optimization problems can be solved by solving a simple linear program. We believe that our approach of using percolation theory to formulate an optimization problem is the first of its kind.

  17. [The medical literature of the Egyptian campaign].

    Science.gov (United States)

    Hutin, Jean-François

    2012-01-01

    Bonaparte's Egyptian Campaign (1798 - 1801), like all other episodes from the Napoleonic era, gave rise to an extensive literature on the subject, but most of all a significant medical literature. This fact is due to many reasons:--an important health service for this expeditionary corps of more than 36.000 men, with two main figures at its hea, Desgenettes and Larrey--but also with valuable subordinates like Assalini, Savaresi, Balme, Pugnet or Barbès.--A Commission for Science and Art, of which a few doctors and surgeons were members, but most of all pharmacists like Boudet or Rouyer--The presence in the field of Ludwig Frank, the nephew of the famous Johann Peter Frank.--The creation in Cairo of an Egyptian Institute and the publication of the masterly Description of Egypt and the establishment of printing houses.--The emergence of the myth of the Orient and its mysteries.--An extensive array of indigenous pathologies, which is characteristic of those countries. For instance: plague, dysentery, yellow fever, Egyptian ophthalmia, as well as more common diseases like tetanus, scurvy or venereal diseases. The main medical works that cover this period and its pathologies are skimmed.

  18. A campaign strategy for your career.

    Science.gov (United States)

    Clark, Dorie

    2012-11-01

    Organizations are inherently political, and pretending they're not is just plain impractical. But strategizing like a politician to advance your career doesn't have to mean compromising your integrity. You can craft a campaign plan that actually gets results without making you feel soiled. So argues Clark, who has worked with top-tier politicians and business executives as they strive to achieve their goals. She recommends that in business, as in politics, aspiring leaders choose their career milestones from the get-go and plan precisely what reaching each one will demand. That means taking inventory of the skills you'll need to acquire and figuring out exactly where and how you'll develop them. The best career planners work backward on the calendar: They start with the end points and carefully mark, in reverse, all the steps along the way. Then they set out on the course, identifying influential people whose favor they need to win and getting specific about how to garner it. They use power maps to home in on the most influential individuals and groups, and they aren't shy about courting votes. "Being political" still sounds negative to many people in business, but learning how to play the game doesn't have to be a Machiavellian endeavor. Indeed, harming people in the process won't help you at all, but if you eschew the political process altogether, you'll only harm yourself.

  19. Advanced Fuels Campaign FY 2010 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2010-12-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) Accomplishment Report documents the high-level research and development results achieved in fiscal year 2010. The AFC program has been given responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. The science-based approach combines theory, experiments, and multi-scale modeling and simulation aimed at a fundamental understanding of the fuel fabrication processes and fuel and clad performance under irradiation. The scope of the AFC includes evaluation and development of multiple fuel forms to support the three fuel cycle options described in the Sustainable Fuel Cycle Implementation Plan4: Once-Through Cycle, Modified-Open Cycle, and Continuous Recycle. The word “fuel” is used generically to include fuels, targets, and their associated cladding materials. This document includes a brief overview of the management and integration activities; but is primarily focused on the technical accomplishments for FY-10. Each technical section provides a high level overview of the activity, results, technical points of contact, and applicable references.

  20. 2013 Bike safety campaign: outcome and feedback

    CERN Multimedia

    HSE Unit

    2013-01-01

    From 3 to 17 June, the HSE Unit, in collaboration with the Reception and Access Control Service, led a campaign targeting CERN cyclists.   Photo: Laëtitia Wohlgemuth. In exchange for vouchers distributed by the security guards, 195 persons received a helmet and a reflective vest as well as documents on safety issues (ex: how to adjust one’s safety helmet properly; how to avoid blind spots; what is the required equipment for bikes and bike users, etc.). These persons also took part in a survey that contained questions on their cycling habits and level of knowledge on bike safety issues. It appeared that, for instance, 43% of the participants were aware that wearing a reflective vest is mandatory whenever visibility is poor (in France). 95% gave particular attention to the need to protect their heads (by assuming that wearing a helmet is either “mandatory” or “highly recommended”). The HSE Unit provided the participants with further i...

  1. Recall campaign for gas bottles and banks

    CERN Multimedia

    2015-01-01

    The previous contract with gas supplier Carbagas ended on 31 March 2015. Gas bottles and banks are not a property of CERN. According to the contract terms, they can remain on CERN sites without any extra costs until 30 September 2015.    If you are using Carbagas containers (bottles and/or banks) for gas purchased between 1 April 2010 and 31 March 2015, multiple options exist: Return them to the closest gas point. Purchase them on the following basis:     Rent them on the following basis: 12 CHF/month for bottles, 144 CHF/month for banks. The recall campaign has been going on for several months already: we would like to thank everyone who has already replied to it. If you haven’t answered yet, there is still time. If you know of unused or abandoned Carbagas containers, please don’t hesitate to contact us. Thank you i...

  2. Arduous campaign for Ryan White CARE Act.

    Science.gov (United States)

    1995-01-01

    The House version of the Ryan White CARE Act reauthorization passed the Health and Environment Subcommittee of the House Commerce Committee on June 14, 1995. The legislation now moves to the full Commerce Committee for consideration. However, a review of the measure was postponed indefinitely, some feel as a result of discussion about an expected amendment to the legislation offered by Rep. Tom Coburn (R-OK). Coburn is a major proponent for mandatory AIDS testing of newborns and wishes to amend the reauthorization to include legislation of that nature. AIDS Action has communicated concerns about the legislation to key committee members and is preparing for the possibility that restrictive amendments, infused with homophobia and with prejudice against people with HIV/AIDS, may be attached to the legislation. In the Senate, efforts continue to overcome tactics by Sen. Jesse Helms (R-NC) to hold up or block legislation S.641. Sixty-one legislators have cosponsored the bill. AIDS Action continues to mount a national campaign for letters to Senate Majority Leader Robert Dole (R-KA) to ask him to expedite the legislation.

  3. Progress of the 2012 KSTAR experimental campaign

    Science.gov (United States)

    Oh, Yeong-Kook; Kim, W. C.; Lee, S. G.; Kim, J. Y.; Yang, H. L.; Park, K. R.; Chu, Y.; Park, M. K.; Bae, Y. S.; H; K; Kim; Kwak, J. G.; Park, H.; Choe, W. H.; Chung, K. S.; Na, Y. S.; Hwang, Y. S.; in, S. Y.; Walker, M.; Mueller, D.; Park, J.; Ahn, J. W.; Sabbagh, S. A.; Zoletnik, S.

    2012-10-01

    KSTAR device has been operated with a mission to explore the advanced physics and technologies at high performance steady-state plasma that are essential for ITER and fusion reactor development. The 2012 KSTAR campaign is conducted with experimental goals to extend H-mode over 10 sec at the plasma current in the level of 0.6 ˜ 1 MA by adopting the real-time shaping control, to investigate physics issues including L- to H-mode transition and ELM mitigation, and to support various experiments proposed by domestic and international collaborators. The available heating power in 2012 is about 5.5 MW in total including 3.5 MW NBI, 1 MW ICRF, 1 MW ECH/CD, and 0.3 MW LHCD. The upgraded diagnostic systems are Thomson scattering system, BES, two ECEI, VUV spectrometer, imaging bolometer, and FIR interferometer. In this presentation, the progress of the KSTAR experiments will be described including the hardware upgrade and physics research results.

  4. What matters most in advertising campaigns? The relative effect of media expenditure and message content strategy

    NARCIS (Netherlands)

    van den Putte, B.

    2009-01-01

    Three main factors determine the effect of advertising campaigns: message content strategy, advertising expenditure and previous consumer behaviour. This study investigates the relative strength of each of these influences. Four possible campaign targets are taken into account: campaign recall, camp

  5. Ionospheric measurements during the CRISTA/MAHRSI campaign: their implications and comparison with previous campaigns

    Directory of Open Access Journals (Sweden)

    J. Laštovicka

    Full Text Available The CRISTA/MAHRSI experiment on board a space shuttle was accompanied by a broad campaign of rocket, balloon and ground-based measurements. Supporting lower ionospheric ground-based measurements were run in Europe and Eastern Asia between 1 October-30 November, 1994. Results of comparisons with long ionospheric data series together with short-term comparisons inside the interval October-November, 1994, showed that the upper middle atmosphere 
    (h = 80-100 km at middle latitudes of the Northern Hemisphere in the interval of the CRISTA/MAHRSI experiment (4-12 November, 1994 was very close to its expected climatological state. In other words, the average results of the experiment can be used as climatological data, at least for the given area/altitudes. The role of solar/geomagnetic and "meteorological" control of the lower ionosphere is investigated and compared with the results of MAP/WINE, MAC/SINE and DYANA campaigns. The effects of both solar/geomagnetic and global meteorological factors on the lower ionosphere are found to be weak during autumn 1994 compared to those in MAP/WINE and DYANA winters, and they are even slightly weaker than those in MAP/SINE summer. The comparison of the four campaigns suggests the following overall pattern: in winter the lower ionosphere at northern middle latitudes appears to be fairly well "meteorologically" controlled with a very weak solar influence. In summer, solar influence is somewhat stronger and dominates the weak "meteorological" influence, but the overall solar/meteorological control is weaker than in winter. In autumn we find the weakest overall solar/meteorological control, local effects evidently dominate.

    Key words. Ionosphere (ionosphere · atmosphere interactions; mid-latitude ionosphere

  6. The VERB campaign: applying a branding strategy in public health.

    Science.gov (United States)

    Asbury, Lori D; Wong, Faye L; Price, Simani M; Nolin, Mary Jo

    2008-06-01

    A branding strategy was an integral component of the VERB Youth Media Campaign. Branding has a long history in commercial marketing, and recently it has also been applied to public health campaigns. This article describes the process that the CDC undertook to develop a physical activity brand that would resonate with children aged 9-13 years (tweens), to launch an unknown brand nationally, to build the brand's equity, and to protect and maintain the brand's integrity. Considerations for branding other public health campaigns are also discussed.

  7. Structure versus level: A unified approach to campaign evaluation

    DEFF Research Database (Denmark)

    Scholderer, Joachim; Grunert, Klaus G.

    2001-01-01

    Based on a modified version of the theory of planned behavior (Ajzen, 1985), a general model for the evaluation of social interventions is developed. Whilst common practice defines campaign success in terms of absolute levels of the target variables, the present approach stresses changes...... in their structure. A structural equation model is outlined that allows to simultaneously test both aspects. As an example application, the 1996-1999 generic advertising campaign for fresh fish in Denmark is evaluated. Results indicate that the campaign has (a) changed the level of the target variables...

  8. Subpolitics and the Campaign against Barclays' Involvement in South Africa

    DEFF Research Database (Denmark)

    Skovgaard, Jakob

    2016-01-01

    In this article I examine the context for the British bank Barclays’ decision to disinvest from South Africa in 1986, with special attention to the impact of the Anti-Apartheid Movement’s campaign against the bank. The 18-year long campaign against Barclays – the largest bank in South Africa...... by multinational corporations may have unintended political consequences and, furthermore, that the awareness of this phenomenon has contributed to the development of corporate social responsibility. Finally, I suggest that the campaign against Barclays generated public attentiveness towards the social...

  9. The polio eradication campaign: time to shift the goal.

    Science.gov (United States)

    Baron, Emmanuel; Magone, Claire

    2014-03-01

    The social rejection of the polio eradication campaign in endemic countries challenges an assumption underlying the goal itself: the full compliance of an entire population to a public health programme. The polio campaign, which has been an extraordinary public health enterprise, is at risk of becoming irremediably unpopular if the eradication goal is pursued at all costs. The Global Polio Eradication Initiative (GPEI) should not be driven by the fear of failure, because the greatest benefit of the polio campaign is that it has demonstrated how simple, community-wide actions can contribute to a dramatic decrease in the incidence of a disease.

  10. Some Accounting Aspects regarding the Elections Campaigns in Romania

    Directory of Open Access Journals (Sweden)

    Riana Iren Radu

    2016-07-01

    Full Text Available The objective of this paper is to present the legal framework for financing the election campaigns in Romania and in the world. There are different systems of campaign finance across the world. Some of these systems rely mainly on private funds, some are based mainly on public funds, but most systems are a combination of both. In all cases a certain degree of limitations on contributions and expenditures are a standard characteristic of the campaign finance system. Limitations on contributions can be means to reduce the corruption and limitations on expenditures may be imposed to guarantee egalitarianism among the various political forces.

  11. Campaigning and contestation: Comments on politicians’ Facebook pages during the 2011 Danish general election campaign

    Directory of Open Access Journals (Sweden)

    Sander Andreas Schwartz

    2015-12-01

    Full Text Available This article is a critical study of the Facebook pages of politicians as public spheres using Dahlberg’s notion of contestation. A method is implemented inspired by qualitative content analysis and including focus groups in order to study citizen comments on eight main political candidates’ Facebook pages during the 2011 Danish election campaign. An analytical framework is presented that conceptualizes the particular platform as a dinner party, with a dinner table, a host, and the invited guests. The dinner party exhibits the interplay between these elements and how they limit the option of contesting the dominating discourse in favor of a supportive marketing logic.

  12. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems.

  13. International Tax Havens, CFC Rules and the Chinese Economy%国际避税地、CFC法规与中国经济

    Institute of Scientific and Technical Information of China (English)

    张巍; 黄莹

    2012-01-01

    The relationship between international tax havens and China's economic development is getting closer. China has begun to establish anti- tax framework for the economic model of international tax havens. This paper estimates the scale of FDI connected with the international tax havens in China, summarizing the tax legislation for international tax havens, and discusses the CFC rules in the balance of the two rival policies.%国际避税地与中国经济发展关系越来越紧密。针对国际避税地经济模式的税收法制框架在我国已经初具模型。本文估测了国际避税地对中国FDI的影响规模,总结了针对国际避税地的中国税收立法情况,探讨了中国受控外国公司(Controlted Foreign Corporation。以下简称CFC)法规在两大竞争性政策中的平衡问题。

  14. Conceptual Design - Polar Drive Ignition Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, R

    2012-04-05

    Review (CDR) remain to be defined. In all cases, the facility modifications represent functional changes to existing systems or capabilities. The bulk of the scope yet to be identified is associated with the DPR's and MultiFM beam smoothing. Detailed development plans for these two subsystems are provided in Appendices H and I; additional discussion of subsystem requirements based on the physics of PD ignition is given in Section 3. Accordingly, LLE will work closely with LLNL to develop detailed conceptual designs for the PD-specific facility modifications, including assessments of the operational impact of implementation (e.g., changing optics for direct rather than indirect-drive illumination and swapping from a hohlraum-based ITIC to one that supports PD). Furthermore, the experimental implementation plan represents the current best understanding of the experimental campaigns required to achieve PD ignition. This plan will evolve based on the lessons learned from the National Ignition Campaign (NIC) and ongoing indirect-drive ignition experiments. The plan does not take the operational realities of the PD configuration into account; configuration planning for the proposed PD experiments is beyond the scope of this document.

  15. The National Ignition Campaign: status and progress

    Science.gov (United States)

    Moses, E. I.; Collaborators, the NIC

    2013-10-01

    The National Ignition Facility (NIF) at Lawrence Livermore National Laboratory (LLNL) has been operational since March 2009 and a variety of experiments have been completed and many more are planned in support of NIF's mission areas: national security, fundamental science, and fusion energy. NIF capabilities and infrastructure are in place to support all of its missions with nearly 60 x-ray, optical and nuclear diagnostic systems and the ability to shoot cryogenic targets and DT layered capsules. The NIF has also been qualified for the use of tritium and other special materials as well as to perform high-yield experiments and classified experiments. Implosions with record indirect-drive neutron yield of 7.5 × 1014 neutrons have been achieved. NIF, a Nd : Glass laser facility, is routinely operating at 1.6 MJ of ultraviolet (3ω) light on target with very high reliability. It recently reached its design goal of 1.8 MJ and 500 TW of 3ω light on target, and has performed target experiments with 1.9 MJ at peak powers of 410 TW. The National Ignition Campaign (NIC), an international effort with the goal of demonstrating thermonuclear burn in the laboratory, is making steady progress towards achieving ignition. Other experiments have been completed in support of high-energy science, materials equation of state, and materials strength. In all cases, records of extreme temperatures and pressures, highest neutron yield and highest energy densities have been achieved. This paper describes the unprecedented experimental capabilities of the NIF and the results achieved so far on the path towards ignition.

  16. An overview of the HIBISCUS campaign

    Directory of Open Access Journals (Sweden)

    J.-P. Pommereau

    2007-02-01

    Full Text Available HIBISCUS was a field campaign for investigating the impact of deep convection on the Tropical Tropopause Layer (TTL and the Lower Stratosphere, which took place during the Southern Hemisphere summer in February–March 2004 in the State of São Paulo, Brazil. Its objective was to provide a set of new observational data on meteorology, tracers of horizontal and vertical transport, water vapour, clouds, and chemistry in the tropical UT/LS from balloon observations at local scale over a land convective area, as well as at global scale using circumnavigating long-duration balloons. Overall, the composition of the TTL, the region between 14 and 19 km of intermediate lapse rate between the almost adiabatic upper troposphere and the stable stratosphere, appears highly variable. Tracers and ozone measurements performed at both the local and the global scale indicate a strong quasi-horizontal isentropic exchange with the lowermost mid-latitude stratosphere suggesting that the barrier associated to the tropical jet is highly permeable at these levels in summer. But the project also provides clear indications of strong episodic updraught of cold air, short-lived tracers, low ozone, humidity and ice particles across the lapse rate tropopause at about 15 km, up to 18 or 19 km at 420–440 K potential levels in the lower stratosphere, suggesting that, in contrast to oceanic convection penetrating little the stratosphere, fast daytime developing land convective systems could be a major mechanism in the troposphere-stratosphere exchange at the global scale.

    The present overview is meant to provide the background of the project, as well as overall information on the instrumental tools available, on the way they have been used within the highly convective context of the South Atlantic Convergence Zone, and a brief summary of the results, which will be detailed in several other papers of this special issue.

  17. Manus Water Isotope Investigation Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Conroy, Jessica L [University of Illinois, Urbana-Champaign; Cobb, Kim M [Georgia Institute of Technology; Noone, David [University of Colorado, Boulder

    2016-03-01

    The objective of this field campaign was to investigate climatic controls on the stable isotopic composition of water vapor, precipitation, and seawater in the western tropical Pacific. Simultaneous measurements of the stable isotopic composition of vapor and precipitation from April 28 to May 8, 2013, at the Manus Tropical Western Pacific Atmospheric Radiation Measurement site, provided several key insights into the nature of the climate signal archived in precipitation and vapor isotope ratios. We observed a large shift from lower to higher isotopic values in vapor and precipitation because of the passage of a mesoscale convective system west of the site and a transition from a regional stormy period into a more quiescent period. During the quiescent period, the stable isotopic composition of vapor and precipitation indicated the predominance of oceanic evaporation in determining the isotopic composition of boundary-layer vapor and local precipitation. There was not a consistent relationship between intra-event precipitation amount at the site and the stable isotopic composition of precipitation, thus challenging simplified assumptions about the isotopic “amount effect” in the tropics on the time scale of individual storms. However, some storms did show an amount effect, and deuterium excess values in precipitation had a significant relationship with several meteorological variables, including precipitation, temperature, relative humidity, and cloud base height across all measured storms. The direction of these relationships points to condensation controls on precipitation deuterium excess values on intra-event time scales. The relationship between simultaneous measurements of vapor and precipitation isotope ratios during precipitation events indicates the ratio of precipitation-to-vapor isotope ratios can diagnose precipitation originating from a vapor source unique from boundary-layer vapor and rain re-evaporation.

  18. Zambia Communications Support for Health Safe Love Campaign Outcome Evaluation

    Data.gov (United States)

    US Agency for International Development — The Safe Love campaign was a three-year comprehensive HIV prevention behavior change and communication (BCC) initiative implemented between June 2011 and June 2014....

  19. Special Campaign for Greater Protection of Intellectual Property Rights

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ In order to achieve more substantial progress in China's IPR protection cause within a relatively short period of time, the State Council decided to launch a special IPR protection campaign across the country from September 2004 to August 2005.

  20. Theory and practice in health communication campaigns: a critical interrogation.

    Science.gov (United States)

    Dutta-Bergman, Mohan J

    2005-01-01

    In recent reviews of the body of work on health campaigns, communication scholars discussed the importance of reflective thinking about the capacity of campaigns to effect change; this reflective thinking is especially important in the realm of the increasing gaps in society between the health rich and the health poor and the increasing marginalization of the poorer sections of society. This article critically reviews 3 central theories of health communication campaigns that represent the dominant cognitive approach: theory of reasoned action, health belief model, and the extended parallel process model. After articulating the limitations of these theoretical approaches, the article summarizes new directions in theory, methodology, and application of health communication campaigns targeting marginalized populations.

  1. [Vaccination campaigns against poliomyelitis in Spain in 1963].

    Science.gov (United States)

    Rodríquez Sánchez, Juan Antonio; Seco Calvo, Jesús

    2009-01-01

    Two anti-poliomyelitic vaccination campaigns coexisted in 1963: the Salk vaccine used by the Compulsory Health Insurance and the pilot experience with the oral Sabin vaccine promoted by the Health General Office. This simultaneity of campaigns was due to the interest that both bodies had to control the Preventive Medicine in Spain. The Compulsory Sickness Insurance used the anti-polio vaccine to promote itself socially in a time when the Basic Law on Social Security was being developed. Under these circumstances, the Health General Office allegedly brought forward its vaccine campaign by using a test of an innovative oral trivalent vaccine in the province of León, something which was hidden to the public. The Health General Office's claim of competence in prevention and the need of a massive response to a voluntary vaccine led to a singular advertising campaign with old messages in innovative means of communication.

  2. "Let's Move" campaign: applying the extended parallel process model.

    Science.gov (United States)

    Batchelder, Alicia; Matusitz, Jonathan

    2014-01-01

    This article examines Michelle Obama's health campaign, "Let's Move," through the lens of the extended parallel process model (EPPM). "Let's Move" aims to reduce the childhood obesity epidemic in the United States. Developed by Kim Witte, EPPM rests on the premise that people's attitudes can be changed when fear is exploited as a factor of persuasion. Fear appeals work best (a) when a person feels a concern about the issue or situation, and (b) when he or she believes to have the capability of dealing with that issue or situation. Overall, the analysis found that "Let's Move" is based on past health campaigns that have been successful. An important element of the campaign is the use of fear appeals (as it is postulated by EPPM). For example, part of the campaign's strategies is to explain the severity of the diseases associated with obesity. By looking at the steps of EPPM, readers can also understand the strengths and weaknesses of "Let's Move."

  3. Variability monitoring of OB stars during the Mons campaign

    CERN Document Server

    Morel, T; Eversberg, T; Alves, F; Arnold, W; Bergmann, T; Viegas, N G Correia; Fahed, R; Fernando, A; Carreira, L F Gouveia; Hunger, T; Knapen, J H; Leadbeater, R; Dias, F Marques; Moffat, A F J; Reinecke, N; Ribeiro, J; Romeo, N; Gallego, J Sanchez; Santos, E M dos; Schanne, L; Stahl, O; Stober, Ba; Stober, Be; Vollmann, K; Corcoran, M F; Dougherty, S M; Hamaguchi, K; Pittard, J M; Pollock, A M T; Williams, P M

    2010-01-01

    We present preliminary results of a 3-month campaign carried out in the framework of the Mons project, where time-resolved Halpha observations are used to study the wind and circumstellar properties of a number of OB stars.

  4. The Volunteers for Stevenson in the 1952 Campaign.

    Science.gov (United States)

    Slaybaugh, Douglas

    1985-01-01

    The limits of amateurism in the Stevenson campaign for the U.S. presidency in 1952 are examined. Both Stevenson and his volunteers lacked political and organizational skills and thus failed to win over wealthy contributors and powerful politicians. (RM)

  5. The CAWSES Global Observing Campaign on Tides: Current Status

    Science.gov (United States)

    Ward, W. E.; Gerding, M.; Goncharenko, L.; Keckhut, P.; Marsh, D.; Oberheide, J.; Rao, D. N.; Scheer, .; Singer, W.

    2007-05-01

    The CAWSES Global Tidal Campaign was initiated to encourage collaboration between satellite and ground based observations and to identify features in various observation types consistent with specific components. This project is one of several sponsored under Theme 3, Atmospheric Coupling Processes, of the international Climate and Weather of the Sun Earth System program (CAWSES, a SCOSTEP sponsored program). The overall goal of the campaign is to provide global data sets for several concentrated time periods over the next few years which includes coordinated ground-based and satellite measurements and modeling efforts. To unambiguously resolve the tidal components present in the Earth's atmosphere requires spatial and temporal sampling sufficient to resolve wavenumbers up to at least 5 and periods down to 4.8 hours every two to three days. Neither satellite or ground based observations on their own are capable of achieving these goals. Interpretation of tidal signatures in different observables (for example wind and temperature) is complicated by the fact the the associated latitudinal structures are typically different. A global network is required to allow these structures to be examined. Three campaign periods have been sceduled to date. The first tidal campaign took place from September 1 to October 31, 2005 and this year two campaigns, March 1 to April 31, and June 1 to August 15 are planned. The first of these latter campaigns will concentrate on the global tidal structures during equinox and their evolution and variability during this time period. The second of these campaigns will address the tidal structures during solstice conditions. Strong hemispheric asymmetries are know to develop in the structure of the migrating diurnal tide and it is of interest to determine the form of other components. These campaigns will allow the characterization of the heating sources, tidal components (migrating and nonmigrating), and tidal effects from the surface of the

  6. A Reassessment of the SIDS Back to Sleep Campaign

    Directory of Open Access Journals (Sweden)

    Ralph Pelligra

    2005-01-01

    Full Text Available The Back to Sleep Campaign was initiated in 1994 to implement the American Academy of Pediatrics' (AAP recommendation that infants be placed in the nonprone sleeping position to reduce the risk of the Sudden Infant Death Syndrome (SIDS. This paper offers a challenge to the Back to Sleep Campaign (BTSC from two perspectives: (1 the questionable validity of SIDS mortality and risk statistics, and (2 the BTSC as human experimentation rather than as confirmed preventive therapy.

  7. [Comics for traffic education: evaluation of a traffic safety campaign].

    Science.gov (United States)

    Bonfadelli, H

    1989-01-01

    Traffic safety campaigns often are ineffective to change driving behavior because they don't reach the target group or are recognized only by people who are already interested or concerned. The evaluation of a traffic safety campaign called "Leo Lässig", addressed to young new drivers, shows that recognition and acceptance by the target group were stimulated by the age-conform means of comic-strips.

  8. Crowdfunding Campaigns Help Researchers Launch Projects and Generate Outreach

    Directory of Open Access Journals (Sweden)

    Katherine Dahlhausen

    2015-11-01

    Full Text Available Organizers of participatory research (citizen science projects can generate funds and outreach through crowdfunding. Here we provide insights from three successful science crowdfunding campaigns recently completed on Indiegogo, Experiment, and Kickstarter. Choosing a crowdfunding platform that fits the project is just the beginning; a successful campaign reflects its content, management, and marketing, and some researchers may need to acquire new skills. In addition, the growing trend of crowdfunding for science reinforces the importance of academic engagement with social media.

  9. Crowdfunding Campaigns Help Researchers Launch Projects and Generate Outreach.

    Science.gov (United States)

    Dahlhausen, Katherine; Krebs, Bethany L; Watters, Jason V; Ganz, Holly H

    2016-03-01

    Organizers of participatory research (citizen science) projects can generate funds and outreach through crowdfunding. Here we provide insights from three successful science crowdfunding campaigns recently completed on Indiegogo, Experiment, and Kickstarter. Choosing a crowdfunding platform that fits the project is just the beginning; a successful campaign reflects its content, management, and marketing, and some researchers may need to acquire new skills. In addition, the growing trend of crowdfunding for science reinforces the importance of academic engagement with social media.

  10. The role of authenticity in electoral social media campaigns

    OpenAIRE

    Grow, Gabrielle; Ward, Janelle

    2013-01-01

    textabstractAuthenticity is a popular buzzword in electoral politics: Electoral candidates and politicians are expected to be authentic in their public interactions. Since 2008, campaigning via social media has become an integral part of elections in the United States, and continues to gain importance. In such an environment, this paper presents research into the role of authenticity in electoral social media campaigns. Using Gilpin, et al.'s (2010) definition of authenticity as the theoretic...

  11. An empirical assessment of the Above the Influence advertising campaign.

    Science.gov (United States)

    Scheier, Lawrence M; Grenard, Jerry L; Holtz, Kristen D

    2011-01-01

    This study evaluated the efficacy of Above the Influence (ATI), a national media-based health persuasion campaign to deter youth drug use. The campaign uses public service anti-drug prevention messages and targets youth between the ages of 14 and 16, a period of heightened susceptibility to peer influences. The evaluation utilized mall intercepts from geographically dispersed regions of the country. Theoretical impetus for the campaign combines elements of the theory of reasoned action (TRA), persuasion theory, and the health belief model. A series of structural equation models were tested with four randomly drawn cross-validation samples (N = 3,000). Findings suggest that awareness of ATI is associated with greater anti-drug beliefs, fewer drug use intentions, and less marijuana use. Congruent with the TRA, changes in beliefs and intentions are intermediate steps linking campaign awareness with behavior. This study provides further evidence of positive campaign effects and may strengthen reliance on mass media health persuasion campaigns as a useful adjunct to other programs targeting youth.

  12. Example of evaluation of media campaign in traffic

    Directory of Open Access Journals (Sweden)

    Marko Divjak

    2007-06-01

    Full Text Available The paper presents an example of evaluation of the intervention EUCHIRES (EUropean public awareness campaign on the use of seat belts and CHIld REstraint Systems which was designed to promote the use of seat belts and child safety seats (CSS. It combined media campaign and project work in a few chosen Slovene kindergartens with preventive and repressive actions of the Police. The evaluation model consisted of three different approaches: (a the media campaign evaluation using a telephone poll, (b the investigation of changes in knowledge, attitudes and self-reported use of CSS in case of both kindergarten teachers and parents, and (c the observational study of the actual seat belt and CSS wearing rates on the roads. Media campaign proved effective in terms of reach, attractiveness, and recall of its message. Besides, the comparison of the effects of the combined approach (media campaign and project work with the effects of media campaign alone showed that the first approach had been more effective only in terms of educating both kindergarten teachers and parents. With changing attitudes and self-reported use of CSS, however, no major differences between approaches were detected. In addition, the results of the observation revealed the 8% increase in the number of properly restrained children being younger than 12 years during the intervention, whereas the wearing rates of other groups of passengers did not change. Critical examination of the evaluation model together with some guidelines for planning and evaluating future interventions is provided in the end.

  13. Advanced Fuels Campaign FY 2014 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Braase, Lori [Idaho National Lab. (INL), Idaho Falls, ID (United States). INL Systems Analyses; May, W. Edgar [Idaho National Lab. (INL), Idaho Falls, ID (United States). INL Systems Analyses

    2014-10-01

    The mission of the Advanced Fuels Campaign (AFC) is to perform Research, Development, and Demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This includes development of a state-of-the art Research and Development (R&D) infrastructure to support the use of a “goal-oriented science-based approach.” In support of the Fuel Cycle Research and Development (FCRD) program, AFC is responsible for developing advanced fuels technologies to support the various fuel cycle options defined in the Department of Energy (DOE) Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. AFC uses a “goal-oriented, science-based approach” aimed at a fundamental understanding of fuel and cladding fabrication methods and performance under irradiation, enabling the pursuit of multiple fuel forms for future fuel cycle options. This approach includes fundamental experiments, theory, and advanced modeling and simulation. The modeling and simulation activities for fuel performance are carried out under the Nuclear Energy Advanced Modeling and Simulation (NEAMS) program, which is closely coordinated with AFC. In this report, the word “fuel” is used generically to include fuels, targets, and their associated cladding materials. R&D of light water reactor (LWR) fuels with enhanced accident tolerance is also conducted by AFC. These fuel systems are designed to achieve significantly higher fuel and plant performance to allow operation to significantly higher burnup, and to provide enhanced safety during design basis and beyond design basis accident conditions. The overarching goal is to develop advanced nuclear fuels and materials that are robust, have high performance capability, and are more tolerant to

  14. On the impact of Twitter-based health campaigns: a cross-country analysis of movember

    NARCIS (Netherlands)

    Dwi Prasetyo, N.; Hauff, C.; Nguyen, Dong-Phuong; van den Broek, T.; Hiemstra, D.

    2015-01-01

    Health campaigns that aim to raise awareness and subsequently raise funds for research and treatment are commonplace. While many local campaigns exist, very few attract the attention of a global audience. One of those global campaigns is Movember, an annual campaign during the month of November, tha

  15. The Christian Schools Campaign: What Were Its Long-Term Consequences?

    Science.gov (United States)

    Baker, Sylvia

    2009-01-01

    This article looks at the long-term consequences of a political campaign that was influential in Britain between 1988 and 1992, the Christian Schools Campaign. The campaign was a response to the need for funding of a group of small independent Christian schools. The article brings up to date the direct outcomes of the campaign in two areas. The…

  16. CoMStOC vs. International Solar Month - Experience gained and lessons learned from SMM campaigns

    Science.gov (United States)

    Schmelz, J. T.

    1991-01-01

    The factors that should be addressed by the organizers of a solar observing campaign are outlined and described. Two recent solar observing campaigns are compared and discussed. Lessons learned from these and other campaigns involving the SMM satellite are analyzed and advice for future campaigns is offered.

  17. Targets for the National Ignition Campaign

    Science.gov (United States)

    Atherton, L. J.

    2008-05-01

    The National Ignition Facility (NIF) is a 192 beam Nd-glass laser facility presently under construction at Lawrence Livermore National Laboratory (LLNL) for performing inertial confinement fusion (ICF) and experiments studying high energy density (HED) science. When completed in 2009, NIF will be able to produce 1.8 MJ, 500 TW of ultraviolet light for target experiments that will create conditions of extreme temperatures (>108 K), pressures (10 GBar) and matter densities (>100 g/cm3). A detailed program called the National Ignition Campaign (NIC) has been developed to enable ignition experiments in 2010, with the goal of producing fusion ignition and burn of a deuterium-tritium (DT) fuel mixture in millimeter-scale target capsules. The first of the target experiments leading up to these ignition shots will begin in 2008. The targets for the NIC are both complex and precise, and are extraordinarily demanding in materials fabrication, machining, assembly, cryogenics and characterization. The DT fuel is contained in a 2-millimeter-diameter graded copper/beryllium or CH shell. The 75-μm-thick cryogenic ice DT fuel layer is formed to sub-micron uniformity at a temperature of approximately 18 Kelvin. The capsule and its fuel layer sit at the center of a gold/depleted uranium 'cocktail' hohlraum. Researchers at LLNL have teamed with colleagues at General Atomics to lead the development of the technologies, engineering design and manufacturing infrastructure necessary to produce these demanding targets. We are also collaborating with colleagues at the Laboratory for Laser Energetics (LLE) at the University of Rochester in DT layering, and at Fraunhofer in Germany in nano-crystalline diamond as an alternate ablator to Beryllium and CH. The Beryllium capsules and cocktail hohlraums are made by physical vapor deposition onto sacrificial mandrels. These coatings must have high density (low porosity), uniform microstructure, low oxygen content and low permeability. The ablator

  18. Oral cancer preventive campaigns: are we reaching the real target?

    Directory of Open Access Journals (Sweden)

    Renato Paladino Nemoto

    2015-02-01

    Full Text Available Introduction: Oral cavity malignant neoplasms have a high mortality rate. For this reason, preventive campaigns have been developed, both to educate the population and to diagnose lesions at an early stage. However, there are studies that contest the validity of these endeavors, principally because the target audience of the campaigns may not conform to the group at highest risk for oral malignancy. Objective: To describe the profile of patients who avail themselves of the preventive campaign, identify the presence of oral lesions in that population, and compare that data with the epidemiological profile of patients with oral cancer. Methods: Cross-sectional historical cohort study performed by analysis of epidemiological data of the campaign "Abra a Boca para a Saúde" collected in the years from 2008 to 2013. Results: In the years analyzed, 11,965 people were treated and 859 lesions were diagnosed, all benign. There was a female predominance (52.7%, with mean age of 44 years (±15.4 years; 26% were smokers and 29% reported alcohol consumption. It is known that the group at highest risk to develop oral cancer is 60to 70-year-old men, who are alcoholic smokers. Conclusion: The population that seeks preventive campaigns is not the main risk group for the disease. This fact explains the low number of lesions and the lack of cancer detection.

  19. Donation to disaster relief campaigns: underlying social cognitive factors exposed.

    Science.gov (United States)

    Oosterhof, Liesbeth; Heuvelman, Ard; Peters, Oscar

    2009-05-01

    A number of very serious natural disasters have put an enormous pressure on relief organizations in the last few years. The present study exposes underlying social cognitive factors for donation to relief campaigns. A causal model was constructed, based on social cognitive theory, research on attitudes, and the impact of media exposure. The aim was to expand and improve an already existing model by Cheung and Chan [Cheung, C. K., & Chan, C. M. (2000). Social-cognitive factors of donating money to charity, with special attention to an international relief organisation. Evaluation and Program Planning, 23, 241-253]. The expanded model showed a better fit. Furthermore, the expanded model explained two-thirds of the variance of the intention to donate to a disaster relief campaign. The greatest predictor of the intention to donate proved to be "Past donation to disaster relief campaigns." The factor "News exposure" was indicated to be a valuable additional factor, as it had a significant direct effect on "Awareness of a disaster relief campaign" and was the only factor that had a total effect on all other factors, including "Intention to donate to a disaster relief campaign."

  20. INFORMATION CAMPAIGNS – MEANS OF COMMUNICATION WITH CUSTOMERS

    Directory of Open Access Journals (Sweden)

    Claudia-Nicoleta Dobrescu

    2014-01-01

    Full Text Available Within a company’s activities, an important role is granted to the performance and implementation of information campaigns for the final consumers. The paper has the general objective to identify specific issues that constitute the premises for the preparation and conduct of such activities, and especially the expected results. The analysis is performed and based on a direct research among several companies, which operate in various fields, for the identification of a method of performance and implementation of information campaigns that are necessary for ensuring visibility on the reference market. The aim of the study was to identify the importance that the firms from Resita give to information campaigns addressed to a target audience. The study was carried from April to May 2013 on a sample of small, medium and large firms, which operate in trade, manufacturing and services. The questions and the discussions addressed to the public were meant to outline the specific aspects of the exact way in which the information campaigns were done for their clients, but also to underline the results obtained with the help of these campaigns.

  1. Experimental pretesting of public health campaigns: a case study.

    Science.gov (United States)

    Whittingham, Jill; Ruiter, Robert A C; Zimbile, Filippo; Kok, Gerjo

    2008-01-01

    The aim of the present study is to demonstrate the merits of evaluating new public health campaign materials in the developmental phase using an experimental design. This is referred to as experimental pretesting. In practice, most new materials are tested only after they have been distributed using nonexperimental or quasiexperimental designs. In cases where materials are pretested prior to distribution, pretesting is usually done using qualitative research methods such as focus groups. Although these methods are useful, they cannot reliably predict the effectiveness of new campaign materials in a developmental phase. Therefore, we suggest when pretesting new materials, not only qualitative research methods but also experimental research methods must be used. The present study discusses an experimental pretest study of new campaign materials intended for distribution in a national sexually transmitted infection (STI) AIDS prevention campaign in the Netherlands. The campaign material tested was the storyline of a planned television commercial on safe sex. A storyboard that consisted of drawings and text was presented to members of the target population, namely, students between the ages of 14 and 16 enrolled in vocational schools. Results showed positive effects on targeted determinants of safe sexual behavior. The advantages, practical implications, and limitations of experimental pretesting are discussed.

  2. Estimating causal effects from family planning health communication campaigns using panel data: the "your health, your wealth" campaign in Egypt.

    Directory of Open Access Journals (Sweden)

    Paul L Hutchinson

    Full Text Available BACKGROUND: Health communication campaigns - involving mass media and interpersonal communication - have long been utilized by national family planning programs to create awareness about contraceptive methods, to shift social norms related to fertility control, and to promote specific behaviors, such as the use of condoms, injectable methods or permanent sterilization. However, demonstrating the effectiveness of these campaigns is often complicated because the infeasibility of experimental designs generally yields statistically non-equivalent samples of campaign-exposed and unexposed individuals. METHODS: Using data from a panel survey of reproductive age women in Egypt, we estimate the effects of the multimedia health communication campaign "Your Health, Your Wealth" ("Sahatek Sarwetek" on precursors to contraceptive use (e.g., spousal communication, birth spacing attitudes and on modern contraceptive use. Difference-in-differences and fixed effects estimators that exploit the panel nature of the data are employed to control for both observed and unobserved heterogeneity in the sample of women who self-report recall of the messages, thereby potentially improving upon methods that make no such controls or that rely solely on cross-sectional data. FINDINGS: All of the estimators find positive effects of the "Your Health, Your Wealth" campaign on reproductive health outcomes, though the magnitudes of those effects diverge, often considerably. Difference-in-differences estimators find that exposure to the campaign increases the likelihood of spousal discussions by 14.4 percentage points (pp. (SE= .039, p<0.001 but has no effect on contraceptive use. In contrast, the fixed effects, instrumental variables estimator, controlling for unobserved heterogeneity, finds a large, statistically significant effect on modern contraceptive use (27.4 pp., SE=0.135, p=0.043. CONCLUSIONS: The difficulties of evaluating family planning communication programs may

  3. Going all-in: gender and campaign commitment

    Directory of Open Access Journals (Sweden)

    Michael G Miller

    2015-09-01

    Full Text Available Recent evidence suggests that women overcome the potential negative impact of gender stereotypes by emerging when they are stronger candidates than men. I leverage an original survey of state legislative candidates to determine whether women devote more time to their campaigns. I find that women on the whole, and those who had previously been elected to a political office in particular, invested more of their personal time into the campaign than men. This difference is driven by the fact that women are more likely to forgo employment during the election. These findings suggest that women are more likely than men to arrange their personal obligations in such a fashion that they can run stronger campaigns.

  4. Campaign contributions, lobbying and post-Katrina contracts.

    Science.gov (United States)

    Hogan, Michael J; Long, Michael A; Stretesky, Paul B

    2010-07-01

    This research explores the relationship between political campaign contributions, lobbying and post-Hurricane Katrina cleanup and reconstruction contracts. Specifically, a case-control study design is used to determine whether campaign contributions to national candidates in the 2000-04 election cycles and/or the employment of lobbyists and lobbying firms increased a company's probability of receiving a post-hurricane contract. Results indicate that both a campaign contribution dichotomous variable and the dollar amount of contributions are significantly related to whether a company received a contract, but that lobbying activity was not. These findings are discussed in the context of previous research on the politics of natural disasters, government contracting and governmental and corporate deviance.

  5. The Strategy and Implementation of the Rosetta Communication Campaign

    Science.gov (United States)

    Bauer, M.; McCaughrean, M.; Landeau-Constantin, J.

    2016-03-01

    The communication campaign for Rosetta has been the biggest success in the history of European Space Agency outreach, resulting in global awareness for the agency. The mission itself is an extraordinary operational and scientific success, but communicating only the operational and scientific firsts would likely not have brought the Rosetta orbiter and Philae lander to the attention of so many people, and would not have made the mission part of people's lives across the globe. The additional impact brought to the mission through the communication campaign was based on a strategic approach focusing on: real-time release of information with maximum transparency; direct real-time access for media and social media; adding a human dimension to the story; and communicating the risks openly in order to manage expectations. In this article we describe our overall strategy, illustrate its implementation, and provide the framework for subsequent articles in this journal highlighting specific aspects of the campaign in more detail.

  6. Buildings and Health. Educational campaign for healthy buildings. Educational material

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    In recent years health and comfort problems associated with the indoor climate have come to constitute a problem in Sweden. To come to grips with this a nationwide educational campaign on Buildings and Health is being run. It is directed to those involved in planning, project design, construction and management of buildings. The objective is to convey a body of knowledge to the many occupational and professional groups in the construction sector on how to avoid indoor climate problems in homes, schools, offices and other workplaces. The campaign is being run by the Swedish National Board of Housing and Planning and the Swedish Council for Building Research, in co-operation with various organizations and companies in the construction industry, and with municipalities and authorities. The knowledge which is being disseminated through the campaign is summarized in this compendium. figs., tabs.

  7. Update of the Used Fuel Dispositon Campaign Implementation Plan

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, Kevin A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bragg-Sitton, Shannon [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mackinnon, Robert James [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Saltzstein, Sylvia J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorenson, Ken B. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Swift, Peter N. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Birkholzer, Jens T. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2014-10-01

    This Update to the Used Fuel Disposition Campaign Implementation Plan provides summary level detail describing how the Used Fuel Disposition Campaign (UFDC) supports achievement of the overarching mission and objectives of the Department of Energy Office of Nuclear Energy Fuel Cycle Technologies Program, building on work completed in this area since 2009. This implementation plan begins with the assumption of target dates that are set out in the January 2013 DOE Strategy for the Management and Disposal of Used Nuclear Fuel and High-Level Radioactive Waste (http://energy.gov/downloads/strategy-management-and-disposal-used-nuclearfuel- and-high-level-radioactive-waste). These target dates and goals are summarized in section III. This implementation plan will be maintained as a living document and will be updated as needed in response to available funding and progress in the Used Fuel Disposition Campaign and the Fuel Cycle Technologies Program.

  8. Update of the used fuel disposition Campaign Implementation Plan

    Energy Technology Data Exchange (ETDEWEB)

    Birkholzer, Jens [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); MacKinnon, Robert [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); McMahon, Kevin [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Saltzstein, Sylvia [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorenson, Ken [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Swift, Peter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-09-01

    This Campaign Implementation Plan provides summary level detail describing how the Used Fuel Disposition Campaign (UFDC) supports achievement of the overarching mission and objectives of the Department of Energy Office of Nuclear Energy Fuel Cycle Technologies Program The implementation plan begins with the assumption of target dates that are set out in the January 2013 DOE Strategy for the Management and Disposal of Used Nuclear Fuel and High-Level Radioactive Waste (http://energy.gov/downloads/strategy-management-and-disposal-used-nuclear-fuel-and-high-level-radioactive-waste). These target dates and goals are summarized in section III. This implementation plan will be maintained as a living document and will be updated as needed in response to progress in the Used Fuel Disposition Campaign and the Fuel Cycle Technologies Program.

  9. Shortwave Hyperspectral Observations During MAGIC Final Campaign Summary

    Energy Technology Data Exchange (ETDEWEB)

    McBride, P. J. [Atmospheric Radiation Measurement, Washington, DC (United States); Marshak, A. [Atmospheric Radiation Measurement, Washington, DC (United States); Yang, W. [Atmospheric Radiation Measurement, Washington, DC (United States)

    2016-03-01

    The Marine ARM GPCI1 Investigation of Clouds (MAGIC) field campaign was initiated to improve our understanding of low-level marine clouds that have a significant influence on the Earth’s climate. The campaign was conducted using an ARM mobile facility deployed on a commercial ship traveling between Honolulu, Hawaii, and Los Angeles, California, from October 2012 to September 2013. The solar spectral flux radiometer (SSFR) was deployed on July 6, 2013, through the end of the campaign. The SSFR was calibrated and installed by Warren Gore of NASA Ames Research Center, and the data is and will be analyzed by Drs. Alexander Marshak and Weidong Yang of NASA Goddard Space Flight Center, Dr. Samuel LeBlanc of NASA Ames Research Center, Dr. Sebastian Schmidt of the University of Colorado-Boulder, and Dr. Patrick McBride of Atmospheric & Space Technology Research Associates in Boulder, Colorado.

  10. Clean Air for London (CLEARFLO) Final Campaign Summary

    Energy Technology Data Exchange (ETDEWEB)

    Worsnop, D. R. [Aerodyne Research, Inc., Billerica, MA (United States); Williams, L. R. [Aerodyne Research, Inc., Billerica, MA (United States); Herndon, S. C. [Aerodyne Research, Inc., Billerica, MA (United States); Dubey, M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Ng, N. L. [Georgia Inst. of Technology, Atlanta, GA (United States); Thornton, J. [Univ. of Washington, Seattle, WA (United States); Knighton, B. [Montana State Univ., Bozeman, MT (United States); Coulter, R. [Argonne National Lab. (ANL), Argonne, IL (United States); Prévôt, Ash [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2016-03-01

    This field campaign funded the participation of scientists from seven different research groups and operated over thirty instruments during the Winter Intensive Operating Period (January-February 2012) of the Clean Air for London (ClearfLo) campaign. The campaign took place at a rural site in Detling, UK, 45 kilometers southeast of central London. The primary science questions for the ClearfLo winter IOP (intensive operational periods) were: 1) “what is the urban increment of particulate matter (PM) and other pollutants in the greater London area?” and 2) “what is the contribution of solid fuel use for home heating to wintertime PM?” An additional motivation for the Detling measurements was the question of whether coatings on black carbon particles enhance absorption.

  11. Exploring Affordances of Social Media Use in Election Campaigns

    DEFF Research Database (Denmark)

    Dyrby, Signe; Jensen, Tina Blegind

    In recent years, social media have become omnipresent and highly important for social networking and content sharing. Lately we have witnessed how also political parties adopt social media as part of their political campaign strategy. The purpose of this work-in-progress paper is to investigate...... this tendency by posing two research questions: 1) what do political parties perceive as affordances of social media use in their campaign strategy? And 2) how are these affordances reflected in the political parties’ actual actions during the campaign? To address the two questions, we conducted a qualitative...... interaction and involvement is limited by their actions as most of them do not engage with the users’ posts and comments. The tensions between perceived affordances and actual use prompt further investigation of what political parties should consider when engaging in social media activities as part...

  12. Online Political Campaigning during the 2014 Regional Elections in Poland

    Directory of Open Access Journals (Sweden)

    Paweł Baranowski

    2015-12-01

    Full Text Available This article is dedicated to the analysis and evaluation of political communication on a regional level. Without any doubt, the Internet revolution affected electoral campaigning on every level. Online campaigning before local elections is often marginalized by political scientists and other scholars researching political marketing. However, the question emerges: are the candidates aware of the possibilities that new media has brought to political communication? Content analysis of all the major online communication tools has allowed the author to analyze the patterns of using websites, official Facebook profiles and Twitter accounts of candidates during the 2014 Lower Silesian Regional assembly elections. The Lower Silesian Voivodeship is among the fastest developing regions in Poland with high Internet penetration rate. Is the Internet campaign treated as a second-class way to communicate with potential voters, or is it perceived as an opportunity to reach electorate online?

  13. Erosion at the inner wall of JET during the discharge campaign 2011–2012 in comparison with previous campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Krat, S. [National Research Nuclear University “MEPhI”, Moscow Kashirskoe shosse 31, 115409 (Russian Federation); Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Gasparyan, Yu; Pisarev, A. [National Research Nuclear University “MEPhI”, Moscow Kashirskoe shosse 31, 115409 (Russian Federation); Bykov, I. [Fusion Plasma Physics, Royal Institute of Technology (KTH), Teknikringen 31, Stockholm 10044 (Sweden); Mayer, M., E-mail: matej.mayer@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Saint Aubin, G. de; Balden, M. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Lungu, C.P. [NILPRP, Association EURATOM-MEdC, Bucharest (Romania); Widdowson, A. [Culham Science Centre, EURATOM/UKAEA – Fusion Association, Abingdon, Oxfordshire OX14 3DB (United Kingdom)

    2015-01-15

    The erosion of Be and W marker layers was investigated using long-term samples during the first ITER-like wall discharge campaign 2011–2012. The markers were mounted in Be coated Inconel tiles between the inner wall guard limiters (IWGL). They were analyzed using Rutherford backscattering (RBS) before and after exposure. All samples showed strong erosion. The results were compared to the data for Be and W erosion rates for the 2005–2009 and the 2001–2004 campaigns, respectively, when JET was operated with a carbon wall. In 2005–2009 Be and C samples were used, and W samples were used in 2001–2004. The mean W erosion rates and the toroidal and poloidal distributions of the W erosion were the same for the 2001–2004 and the 2011–2012 campaigns. The mean erosion rate of Be during the 2011–2012 campaign was smaller by a factor of about two compared to the 2005–2009 campaign and showed a different poloidal distribution. The mean erosion rate of the inner JET ITER-like wall was about 4–5 times smaller than the mean erosion rate of the carbon wall.

  14. Revisiting the Effect of Anthropomorphizing a Social Cause Campaign.

    Directory of Open Access Journals (Sweden)

    Lisa A Williams

    Full Text Available Recent research suggests that anthropomorphism can be harnessed as a tool to boost intentions to comply with social cause campaigns. Drawing on the human tendency to extend moral concern to entities portrayed as humanlike, it has been argued that adding personified features to a social campaign elevates anticipated guilt at failing to comply, and this subsequently boosts intentions to comply with that campaign. The present research aimed to extend extant research by disentangling the effects of emotional and non-emotional anthropomorphism, and differentiating amongst other emotional mechanisms of the anthropomorphism-compliance effect (namely, anticipated pride and anticipated regret. Experiment 1 (N = 294 compared the effectiveness of positive, negative, and emotionally-neutral anthropomorphized campaign posters for boosting campaign compliance intentions against non-anthropomorphized posters. We also measured potential mechanisms including anticipated guilt, regret, and pride. Results failed to support the anthropomorphism-compliance effect, and no changes in anticipated emotion according to anthropomorphism emerged. Experiments 2 (N = 150 and 3 (N = 196 represented further tests of the anthropomorphism-compliance effect. Despite high statistical power and efforts to closely replicate the conditions under which the anthropomorphism-compliance effect had been previously observed, no differences in compliance intention or anticipated emotion according to anthropomorphism emerged. A meta-analysis of the effects of anthropomorphism on compliance and anticipated emotion across the three experiments revealed effect size estimates that did not differ significantly from zero. The results of these three experiments suggest that the anthropomorphism-compliance effect is fragile and perhaps subject to contextual and idiographic influences. Thus, this research provides important insight and impetus for future research on the applied and theoretical

  15. Revisiting the Effect of Anthropomorphizing a Social Cause Campaign.

    Science.gov (United States)

    Williams, Lisa A; Masser, Barbara; Sun, Jessie

    2015-01-01

    Recent research suggests that anthropomorphism can be harnessed as a tool to boost intentions to comply with social cause campaigns. Drawing on the human tendency to extend moral concern to entities portrayed as humanlike, it has been argued that adding personified features to a social campaign elevates anticipated guilt at failing to comply, and this subsequently boosts intentions to comply with that campaign. The present research aimed to extend extant research by disentangling the effects of emotional and non-emotional anthropomorphism, and differentiating amongst other emotional mechanisms of the anthropomorphism-compliance effect (namely, anticipated pride and anticipated regret). Experiment 1 (N = 294) compared the effectiveness of positive, negative, and emotionally-neutral anthropomorphized campaign posters for boosting campaign compliance intentions against non-anthropomorphized posters. We also measured potential mechanisms including anticipated guilt, regret, and pride. Results failed to support the anthropomorphism-compliance effect, and no changes in anticipated emotion according to anthropomorphism emerged. Experiments 2 (N = 150) and 3 (N = 196) represented further tests of the anthropomorphism-compliance effect. Despite high statistical power and efforts to closely replicate the conditions under which the anthropomorphism-compliance effect had been previously observed, no differences in compliance intention or anticipated emotion according to anthropomorphism emerged. A meta-analysis of the effects of anthropomorphism on compliance and anticipated emotion across the three experiments revealed effect size estimates that did not differ significantly from zero. The results of these three experiments suggest that the anthropomorphism-compliance effect is fragile and perhaps subject to contextual and idiographic influences. Thus, this research provides important insight and impetus for future research on the applied and theoretical utility of

  16. Purex process operation and performance, 1970 Thoria Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, R.R.; Walser, R.L. (eds.)

    1977-03-01

    The Hanford Purex Plant fulfilled a 1970 commitment to the Atomic Energy Commission to produce 360 kilograms of high purity /sup 233/U as uranyl nitrate solution. Overall plant performance during both 1970 and 1966 confirmed the suitability of Purex for processing thorium on a campaign basis. The 1970 processing campaign, including flushing operations, is discussed with particular emphasis on problem areas. Background information on the process and equipment used is also presented. The organizations and their designations described are those existing in 1970.

  17. The Surviving Sepsis Campaign: past, present and future.

    Science.gov (United States)

    Schorr, Christa A; Dellinger, R Phillip

    2014-04-01

    The Surviving Sepsis Campaign (SSC) was created in 2002 and consists of severe sepsis management guidelines and a sepsis performance improvement program. The second revision of the guidelines, published in 2013, are sponsored by 30 international scientific organizations and contain changes in recommendations for fluids and vasopressor administration. The new 3- and 6-hour sepsis 'bundles' (sets of care elements) include a software program that can be downloaded free from the Surviving Sepsis Campaign website (www.survivingsepsis.org). The traditional intensive care unit and emergency department champion-driven sepsis performance improvement program continues internationally with the kick off of a new grant-funded hospital floor sepsis performance improvement initiative.

  18. Long Campaign of BF with Overheating-Free Cooling Stave

    Institute of Scientific and Technical Information of China (English)

    CHENG Su-sen; YANG Tian-jun; CANG Da-qiang

    2003-01-01

    A basic idea of permanent lining in designing long campaign of BF was put forward. BF designer should follow a chain of thinking procedure: Cooling water-Cooling system-Refractory lining. The temperature field of BF wall and cooling stave was calculated using heat transfer model and the results were proved by a 1 000-1 200 ℃ test rig. The overheating-free cooling stave with different parameters was designed, and such a long campaign of BF (15 years) was going to put into construction.

  19. Improving the effectiveness of road safety campaigns: Current and new practices

    Directory of Open Access Journals (Sweden)

    Tamara Hoekstra

    2011-03-01

    Full Text Available The evaluation of campaigns aimed at improving road safety is still the exception rather than the rule. Because of this, ineffective campaigns and campaign techniques are allowed to continue to be utilised without question, while new methods of behaviour modification are often ignored. Therefore, the necessity and advantages of formally evaluating road safety campaign efforts are discussed. This article also describes the pros and cons of some of the more common campaign strategies and introduces a number of new methods that show a great deal of promise for the purpose of road safety campaigns. In order to infuse the field of road safety campaigning with such new insights into road user behaviour and behavioural modification, one should look beyond the confines of road safety campaign standards and learn from the knowledge gained in other disciplines such as economics and social psychology. These new insights are discussed in terms of their implications for the future of road safety campaigns.

  20. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2007-05-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusive below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs

  1. Recruiting New Teachers: Campaign Response 1988-1992. Executive Summary.

    Science.gov (United States)

    Harris, Louis

    This study evaluated the impact of a public service advertising campaign conducted for Recruiting New Teachers, Inc (RNT). The study surveyed a national sample of 2,750 individuals who called the RNT toll-free number mentioned in public service advertising and returned information about their educational background and teaching interests. The…

  2. Consumers' Perspectives on Water Issues: Directions for Educational Campaigns.

    Science.gov (United States)

    DeLorme, Denise E.; Hagen, Scott C.; Stout, I. Jack

    2003-01-01

    Explores the relationship between population growth, development, and water resources to glean insight for environmental education campaigns. Reports high awareness and moderate concern about rapid growth and development, dissatisfaction with water resource quantity and quality, and varied water management strategies among consumers. (Contains 37…

  3. Young People's Involvement in a Substance Misuse Communications Campaign

    Science.gov (United States)

    Jones, Mathew; Salmon, Debra; Orme, Judy

    2004-01-01

    There is growing emphasis in public policy on involving young people in the development of health promotion campaigns and information resources on substance misuse. To date there has been little literature that explores the level and nature young people's involvement in such initiatives. This paper reports on an evaluation of a substance misuse…

  4. Message Testing to Create Effective Health Communication Campaigns

    Science.gov (United States)

    Domigan, Juliane; Glassman, Tavis J.; Miller, Jeff; Hug, Heather; Diehr, Aaron J.

    2015-01-01

    Purpose: The purpose of this paper was to assess a health communication campaign designed to reduce distracted driving among college students within the USA. Design/methodology/approach: Utilizing central interviewing techniques, participants were asked qualitative and quantitative items soliciting feedback concerning the efficacy of the messages.…

  5. 1991 National campaign to increase safety belt usage.

    NARCIS (Netherlands)

    National Highway Traffic Safety Administration NHTSA

    1992-01-01

    The central theme of this paper is the national campaign of the USA to be conducted in 1991 and 1992, in order to reach the goal of 70 percent safety belt usage by 1992. Among other things, it is shown that visible enforcement of existing laws offers the greatest potential for achieving this goal. F

  6. Progress and Focus of the National Childhood Immunization Campaign.

    Science.gov (United States)

    Paskert, Catherine J.

    1983-01-01

    A nationwide campaign to improve and maintain immunization levels for selected preventable childhood diseases was instituted in 1977, and another program, whose goal was to eliminate indigenous measles by 1982, was instituted in 1978. Immunization levels have improved so much that attention is now focused on ways to maintain these high levels.…

  7. Cross-Language System Evaluation: The CLEF Campaigns.

    Science.gov (United States)

    Peters, Carol; Braschler, Martin

    2001-01-01

    Describes the goals of the CLEF (Cross-Language Evaluation Forum) series of evaluation campaigns for information retrieval systems operating on European languages. Examines the difficulties of organizing an activity which aims at an objective evaluation of systems running on and over a number of different languages. (Author/LRW)

  8. Managing Dog Waste: Campaign Insights from the Health Belief Model

    Science.gov (United States)

    Typhina, Eli; Yan, Changmin

    2014-01-01

    Aiming to help municipalities develop effective education and outreach campaigns to reduce stormwater pollutants, such as pet waste, this study applied the Health Belief Model (HBM) to identify perceptions of dog waste and corresponding collection behaviors from dog owners living in a small U.S. city. Results of 455 online survey responses…

  9. The role of authenticity in electoral social media campaigns

    NARCIS (Netherlands)

    G. Grow (Gabrielle); J.R. Ward (Janelle)

    2013-01-01

    textabstractAuthenticity is a popular buzzword in electoral politics: Electoral candidates and politicians are expected to be authentic in their public interactions. Since 2008, campaigning via social media has become an integral part of elections in the United States, and continues to gain importan

  10. Approach For Investigating Crowdfunding Campaigns With Platform Data

    DEFF Research Database (Denmark)

    Huhtamäki, Jukka; Lasrado, Lester; Menon, Karan

    2015-01-01

    Crowdfunding via the internet is a relatively new phenomenon in research and gaining momentum currently. While taking a data-driven approach into investigating the properties and dynamics of crowdfunding campaigns would allow the use of computational social science in investigations on crowdfundi...

  11. Functional brain imaging predicts public health campaign success.

    Science.gov (United States)

    Falk, Emily B; O'Donnell, Matthew Brook; Tompson, Steven; Gonzalez, Richard; Dal Cin, Sonya; Strecher, Victor; Cummings, Kenneth Michael; An, Lawrence

    2016-02-01

    Mass media can powerfully affect health decision-making. Pre-testing through focus groups or surveys is a standard, though inconsistent, predictor of effectiveness. Converging evidence demonstrates that activity within brain systems associated with self-related processing can predict individual behavior in response to health messages. Preliminary evidence also suggests that neural activity in small groups can forecast population-level campaign outcomes. Less is known about the psychological processes that link neural activity and population-level outcomes, or how these predictions are affected by message content. We exposed 50 smokers to antismoking messages and used their aggregated neural activity within a 'self-localizer' defined region of medial prefrontal cortex to predict the success of the same campaign messages at the population level (n = 400,000 emails). Results demonstrate that: (i) independently localized neural activity during health message exposure complements existing self-report data in predicting population-level campaign responses (model combined R(2) up to 0.65) and (ii) this relationship depends on message content-self-related neural processing predicts outcomes in response to strong negative arguments against smoking and not in response to compositionally similar neutral images. These data advance understanding of the psychological link between brain and large-scale behavior and may aid the construction of more effective media health campaigns.

  12. When the stakes are high: party competition and negative campaigning

    NARCIS (Netherlands)

    A.S. Walter; W. van der Brug; P. van Praag

    2013-01-01

    This article examines the conditions under which different kinds of parties resort to negative campaigning in three Western European countries: the Netherlands, Britain, and Germany in the period between 1980 and 2006. Data were collected for 27 parties, participating in 23 elections, yielding a tot

  13. Republican Campaign Rhetoric: Reflections of a Meaner, Tougher America.

    Science.gov (United States)

    Kelley, Colleen E.; Troester, Rod

    This essay examines some Republican communication behaviors which account in part for accusations that the use of negative strategies was unprecedented during the 1988 presidential campaign. It also explores some of the effects of those strategies on political communication behavior during the first year of the Bush Administration. It is suggested…

  14. The 2014 ALMA Long Baseline Campaign : An Overview

    NARCIS (Netherlands)

    ALMA Partnership, [Unknown; Fomalont, E. B.; Vlahakis, C.; Corder, S.; Remijan, A.; Barkats, D.; Lucas, R.; Hunter, T. R.; Brogan, C. L.; Asaki, Y.; Matsushita, S.; Dent, W. R. F.; Hills, R. E.; Phillips, N.; Richards, A. M. S.; Cox, P.; Amestica, R.; Broguiere, D.; Cotton, W.; Hales, A. S.; Hiriart, R.; Hirota, A.; Hodge, J. A.; Impellizzeri, C. M. V.; Kern, J.; Kneissl, R.; Liuzzo, E.; Marcelino, N.; Marson, R.; Mignano, A.; Nakanishi, K.; Nikolic, B.; Perez, J. E.; Pérez, L. M.; Toledo, I.; Aladro, R.; Butler, B.; Cortes, J.; Cortes, P.; Dhawan, V.; Di Francesco, J.; Espada, D.; Galarza, F.; Garcia-Appadoo, D.; Guzman-Ramirez, L.; Humphreys, E. M.; Jung, T.; Kameno, S.; Laing, R. A.; Leon, S.; Mangum, J.; Marconi, G.; Nagai, H.; Nyman, L.-A.; Radiszcz, M.; Rodón, J. A.; Sawada, T.; Takahashi, S.; Tilanus, R. P. J.; van Kempen, T.; Vila Vilaro, B.; Watson, L. C.; Wiklind, T.; Gueth, F.; Tatematsu, K.; Wootten, A.; Castro-Carrizo, A.; Chapillon, E.; Dumas, G.; de Gregorio-Monsalvo, I.; Francke, H.; Gallardo, J.; Garcia, J.; Gonzalez, S.; Hibbard, J. E.; Hill, T.; Kaminski, T.; Karim, A.; Krips, M.; Kurono, Y.; Lopez, C.; Martin, S.; Maud, L.; Morales, F.; Pietu, V.; Plarre, K.; Schieven, G.; Testi, L.; Videla, L.; Villard, E.; Whyborn, N.; Alves, F.; Andreani, P.; Avison, A.; Barta, M.; Bedosti, F.; Bendo, G. J.; Bertoldi, F.; Bethermin, M.; Biggs, A.; Boissier, J.; Brand, J.; Burkutean, S.; Casasola, V.; Conway, J.; Cortese, L.; Dabrowski, B.; Davis, T. A.; Diaz Trigo, M.; Fontani, F.; Franco-Hernandez, R.; Fuller, G.; Galvan Madrid, R.; Giannetti, A.; Ginsburg, A.; Graves, S. F.; Hatziminaoglou, E.; Hogerheijde, M.; Jachym, P.; Jimenez Serra, I.; Karlicky, M.; Klaasen, P.; Kraus, M.; Kunneriath, D.; Lagos, C.; Longmore, S.; Leurini, S.; Maercker, M.; Magnelli, B.; Marti Vidal, I.; Massardi, M.; Maury, A.; Muehle, S.; Muller, S.; Muxlow, T.; O’Gorman, E.; Paladino, R.; Petry, D.; Pineda, J.; Randall, S.; Richer, J. S.; Rossetti, A.; Rushton, A.; Rygl, K.; Sanchez Monge, A.; Schaaf, R.; Schilke, P.; Stanke, T.; Schmalzl, M.; Stoehr, F.; Urban, S.; van Kampen, E.; Vlemmings, W.; Wang, K.; Wild, W.; Yang, Y.; Iguchi, S.; Hasegawa, T.; Saito, M.; Inatani, J.; Mizuno, N.; Asayama, S.; Kosugi, G.; Morita, K.-I.; Chiba, K.; Kawashima, S.; Okumura, S. K.; Ohashi, N.; Ogasawara, R.; Sakamoto, S.; Noguchi, T.; Huang, Y.-D.; Liu, S.-Y.; Kemper, F.; Koch, P. M.; Chen, M.-T.; Chikada, Y.; Hiramatsu, M.; Iono, D.; Shimojo, M.; Komugi, S.; Kim, J.; Lyo, A.-R.; Muller, E.; Herrera, C.; Miura, R. E.; Ueda, J.; Chibueze, J.; Su, Y.-N.; Trejo-Cruz, A.; Wang, K.-S.; Kiuchi, H.; Ukita, N.; Sugimoto, M.; Kawabe, R.; Hayashi, M.; Miyama, S.; Ho, P. T. P.; Kaifu, N.; Ishiguro, M.; Beasley, A. J.; Bhatnagar, S.; Braatz, J. A., III; Brisbin, D. G.; Brunetti, N.; Carilli, C.; Crossley, J. H.; D’Addario, L.; Donovan Meyer, J. L.; Emerson, D. T.; Evans, A. S.; Fisher, P.; Golap, K.; Griffith, D. M.; Hale, A. E.; Halstead, D.; Hardy, E. J.; Hatz, M. C.; Holdaway, M.; Indebetouw, R.; Jewell, P. R.; Kepley, A. A.; Kim, D.-C.; Lacy, M. D.; Leroy, A. K.; Liszt, H. S.; Lonsdale, C. J.; Matthews, B.; McKinnon, M.; Mason, B. S.; Moellenbrock, G.; Moullet, A.; Myers, S. T.; Ott, J.; Peck, A. B.; Pisano, J.; Radford, S. J. E.; Randolph, W. T.; Rao Venkata, U.; Rawlings, M. G.; Rosen, R.; Schnee, S. L.; Scott, K. S.; Sharp, N. K.; Sheth, K.; Simon, R. S.; Tsutsumi, T.; Wood, S. J.

    2015-01-01

    A major goal of the Atacama Large Millimeter/submillimeter Array (ALMA) is to make accurate images with resolutions of tens of milliarcseconds, which at submillimeter (submm) wavelengths requires baselines up to ∼15 km. To develop and test this capability, a Long Baseline Campaign (LBC) was carried

  15. Thai Electoral Campaigning: Vote-Canvassing Networks and Hybrid Voting

    Directory of Open Access Journals (Sweden)

    Anyarat Chattharakul

    2010-01-01

    Full Text Available Based on evidence gathered through participant observation, this article illuminates the nature of vote-canvassing, previously a black box in Thai electoral studies. Offering a close-up study of the internal mechanisms of an individual Thai election campaign, this article reveals that vote-canvasser networks are underpinned by long-term dyadic relationships, both hierarchical and horizontal, between the candidate, vote-canvassers and voters. These networks continue to be the most important factor in winning elections. This article documents how candidates draw up an election campaign map and identify voters along residential lines to maximise their vote-canvassing strategy. The findings of this article challenge Anek’s 1996 concept of “two democracies”, which argues that rural voters are influenced by money, local leaders, political factions and corrupt politicians while more well-educated, urban, middle-class voters are more oriented toward the alternative policies offered by competing parties. The case study of Kom’s election campaign showed that the role of the much-vaunted middle-class voters is not decisive, even in suburban areas of Bangkok. While political marketing has grown in importance in Thai elections, it has not displaced traditional electoral practices. Thai society is, in fact, deeply fragmented and diverse – too complex to be divided in such a simplistic manner. This article suggests that rather than undergoing a linear transformation, political hybridisation is a key trend in Thai election campaigns.

  16. Wind turbine and actuator disc wake: Two experimental campaigns

    NARCIS (Netherlands)

    Lignarolo, L.; Ragni, D.; Simao Ferreira, C.J.; van Bussel, G.J.W.

    2015-01-01

    The present paper is the summary of 3 years of research on the wake aerodynamics of horizontal axis wind turbine at Delft University of Technology, the Netherlands. In particular, the main results and the conclusions of two experimental campaigns are collected. The underlying research question is: h

  17. Political Campaign Debating: A Selected, Annotated Bibliography. Second Edition.

    Science.gov (United States)

    Ritter, Kurt; Hellweg, Susan A.

    This 44-item bibliography, limited to the television era of American politics, is intended to assist teachers of debate, argumentation, and political communication; researchers of campaign debates; and debate sponsors and participants. Scholarly books and monographs; public affairs books, monographs and papers; academic articles and chapters from…

  18. Political Candidate Campaign Advertising: A Selected Review of the Literature.

    Science.gov (United States)

    Hellweg, Susan A.

    This paper provides a selected review of political candidate campaign advertising studies from the political science, mass communication, advertising, and political communication literature. The paper examines the literature in terms of research pertaining to (1) candidate advertising content (commercials for male versus female candidates and for…

  19. The Bolund experiment - design of measurement campaign using CFD

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Johansen, Jeppe; Sørensen, Niels N.

    the upcoming measurement campaign. The simulation results are used for estimating rational positions of measuring masts and instrumentation. A total of ten measuring masts are proposed consisting of two 16 m masts, six 9 m masts and two 5 m masts. The masts are instrumented with 12 cup anemometers for mean...

  20. Women’s Cloth-Making Campaign in Shanxi(2)

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    THE cloth-making campaign carried out by the Eighth Route Army and the local people in Shanxi helped pulp them through a tough situation and win the victory of the War of Resistance Against Japan (1937-1945). In the remote hills where both industrial and agricultural development was slow-

  1. The STAR Grants Contribution to the SOAS Campaign

    Science.gov (United States)

    The Southern Oxidant and Aerosol Study (SOAS) is a community-led field campaign that was part of the Southeast Atmosphere Study (SAS). As one of the largest field studies in decades to characterize air quality in the Southeastern United States, SAS is a collaborative project invo...

  2. Monitoring speed before and during a speed publicity campaign.

    Science.gov (United States)

    van Schagen, Ingrid; Commandeur, Jacques J F; Goldenbeld, Charles; Stipdonk, Henk

    2016-12-01

    Driving speeds were monitored during a period of 16 weeks encompassing different stages of an anti-speeding campaign in the Netherlands. This campaign targeted speed limit violations in built-up areas. The observation periods differed in terms of intensity and media used for the campaign. Small road-side radars, mounted in light poles, were used and registered the speeds on 20 locations in built-up areas. Speeds of over 10 million vehicles were measured. Ten locations had a posted speed limit of 50km/h; the other ten had a posted speed limit of 30km/h. Posters were placed at half of each group of locations to remind drivers of the speed limit. The average speed on the 50km/h roads was 46.2km/h, and 36.1km/h on the 30km/h roads. The average proportions of vehicles exceeding the speed limit were 33.3% and 70.1% respectively. For the 30km/h roads, the data shows differences in speed and speeding behaviour between the six distinguished observation periods, but overall these differences cannot be logically linked to the contents of the phases and, hence, cannot be explained as an effect of the campaign. The only exception was an effect of local speed limit reminders on the 30km/h roads. This effect, however, was temporary and had disappeared within a week.

  3. Two Birds with One Myth-Debunking Campaign

    Science.gov (United States)

    LaCaille, Rick A.

    2015-01-01

    Misconceptions of psychological phenomena are widespread and often not easily eliminated--even among students completing college-level psychology courses. As part of a research methods psychology course, students developed public-service-announcement-style posters as part of a psychology myth-debunking campaign and presented these to students…

  4. POLITICAL COMMUNICATION DURING THE 2014 PRESIDENTIAL CAMPAIGN: ONLINE MEDIA COVERAGE

    Directory of Open Access Journals (Sweden)

    Cristina Cîrtiţă-Buzoianu

    2016-02-01

    Full Text Available The election campaign has lately become a real challenge where all the political actors display their skills, the communication ones, but also those related to the electoral marketing and public relations which play a vital role in creating the image of a particular candidate. The interest that the public manifest towards the presidential debates, as well as towards all the means of political communication used by the actors involved represents a reference point in the construction of an election campaign. Our paper aims to achieve a quantitative analysis of the communicational messages sent during the 2014 presidential campaign in the online media. In this respect, we are going to conduct a media monitoring on two central newspapers, namely “Evenimentul Zilei” (“Daily Event” and “Jurnalul Național” (“National Journal”, to track the online media visibility of the political communication starting from several indicators predefined in order to measure the efficiency of the political communication. Thus, our approach considers the influence of political communication in the election campaign as it appears in the online press in Romania.

  5. Donation to disaster relief campaigns: underlying social cognitive factors exposed

    NARCIS (Netherlands)

    Oosterhof, Liesbeth; Heuvelman, Ard; Peters, Oscar

    2009-01-01

    number of very serious natural disasters have put an enormous pressure on relief organizations in the last few years. The present study exposes underlying social cognitive factors for donation to relief campaigns. A causal model was constructed, based on social cognitive theory, research on attitude

  6. No Middle Ground: A Personal View of the Tenure Campaign.

    Science.gov (United States)

    Osumi, M. Dick

    1990-01-01

    Describes the campaign for tenure for an Asian Pacific American university professor, D. Nakanishi, within a historical context. Includes discussions of Asian Americans' and Pacific Americans' experience of discrimination since the 1900s, civil rights struggles in the 1970s and 1980s, and the history and development of the "Amerasia…

  7. The Role of Gatekeepers in the Asbestos Awareness Campaign.

    Science.gov (United States)

    Freimuth, Vicki S.; Van Nevel, J. Paul

    The role of news media as gatekeepers controlling the flow of information that the public receives was explored during the 1978 Asbestos Awareness campaign conducted by the Department of Health, Education, and Welfare (HEW). In an effort to inform high risk workers and the general public about the health hazards associated with asbestos exposure,…

  8. Airborne campaigns for CryoSat prelaunch calibration and validation

    DEFF Research Database (Denmark)

    Skourup, Henriette; Hanson, Susanne; Hvidegaard, Sine Munk

    2011-01-01

    After the successful launch of CryoSat-2 in April 2010, the first direct validation campaign of the satellite is planned for spring 2011. DTU Space has been involved in ESA’s CryoSat Validation Experiment (CryoVEx) with airborne activities since 2003. To validate the prelaunch performance of the ...

  9. "War on Waste": A Public-Education Campaign.

    Science.gov (United States)

    Larson, Mark A.; Massetti-Miller, Karen L.

    As part of a statewide campaign to increase both awareness of the problem of littering and illegal dumping, and participation in recycling activities, Humboldt County, California, began a recycling and antilittering education project in 1981. Pre- and postcampaign survey data suggest that the 9-month program, relying largely on television and…

  10. Preparing for SMOS: Sea Salinity Campaigns and Results

    DEFF Research Database (Denmark)

    Søbjærg, Sten Schmidl; Balling, Jan E.; Kristensen, Steen Savstrup

    2006-01-01

    Mapping of sea surface salinity, based on L-band radiometric measurements, is presently investigated as a preparation for space missions. Special concern is on correction for effects caused by the sea surface roughness, and this paper will address two campaigns, LOSAC and CoSMOS, with the aim...

  11. [Tobacco prevention. The "smoke-free" youth campaign].

    Science.gov (United States)

    Lang, P; Strunk, M

    2010-02-01

    The sharp increase of adolescent tobacco consumption between 1990 and 2001 and the national health target "reducing tobacco consumption" were two main reasons for the increased prevention measures of the Federal Center for Health Education in promoting non-smoking among young people. This article focuses on the offers and measures of the "smoke-free" youth campaign from the Federal Center for Health Education. To promote non-smoking in adolescence, the Federal Center for Health Education started the "smoke-free" youth campaign in 2002 and has continuously expanded it through the present. The campaign is based on a goal-oriented planning process and is predominantly directed towards adolescents younger than 18 years. To achieve national effects in the target group, concerted measures ranging from mass media (television/cinema spots, advertisement), internet, and face-to-face communication--with a focus on school--were implemented. Simultaneous with the start of the "smoke-free" youth campaign in 2001, there is evidence for continuous reduction of the smoking prevalence of adolescents. The rate of smoking adolescents between 12 and 17 years decreased from 28% in 2001 to 15% in 2008, thus, reaching an all-time low.

  12. EARLINET instrument intercomparison campaigns: overview on strategy and results

    Science.gov (United States)

    Wandinger, Ulla; Freudenthaler, Volker; Baars, Holger; Amodeo, Aldo; Engelmann, Ronny; Mattis, Ina; Groß, Silke; Pappalardo, Gelsomina; Giunta, Aldo; D'Amico, Giuseppe; Chaikovsky, Anatoli; Osipenko, Fiodor; Slesar, Alexander; Nicolae, Doina; Belegante, Livio; Talianu, Camelia; Serikov, Ilya; Linné, Holger; Jansen, Friedhelm; Apituley, Arnoud; Wilson, Keith M.; de Graaf, Martin; Trickl, Thomas; Giehl, Helmut; Adam, Mariana; Comerón, Adolfo; Muñoz-Porcar, Constantino; Rocadenbosch, Francesc; Sicard, Michaël; Tomás, Sergio; Lange, Diego; Kumar, Dhiraj; Pujadas, Manuel; Molero, Francisco; Fernández, Alfonso J.; Alados-Arboledas, Lucas; Bravo-Aranda, Juan Antonio; Navas-Guzmán, Francisco; Guerrero-Rascado, Juan Luis; José Granados-Muñoz, María; Preißler, Jana; Wagner, Frank; Gausa, Michael; Grigorov, Ivan; Stoyanov, Dimitar; Iarlori, Marco; Rizi, Vincenco; Spinelli, Nicola; Boselli, Antonella; Wang, Xuan; Lo Feudo, Teresa; Perrone, Maria Rita; De Tomasi, Ferdinando; Burlizzi, Pasquale

    2016-03-01

    This paper introduces the recent European Aerosol Research Lidar Network (EARLINET) quality-assurance efforts at instrument level. Within two dedicated campaigns and five single-site intercomparison activities, 21 EARLINET systems from 18 EARLINET stations were intercompared between 2009 and 2013. A comprehensive strategy for campaign setup and data evaluation has been established. Eleven systems from nine EARLINET stations participated in the EARLINET Lidar Intercomparison 2009 (EARLI09). In this campaign, three reference systems were qualified which served as traveling standards thereafter. EARLINET systems from nine other stations have been compared against these reference systems since 2009. We present and discuss comparisons at signal and at product level from all campaigns for more than 100 individual measurement channels at the wavelengths of 355, 387, 532, and 607 nm. It is shown that in most cases, a very good agreement of the compared systems with the respective reference is obtained. Mean signal deviations in predefined height ranges are typically below ±2 %. Particle backscatter and extinction coefficients agree within ±2 × 10-4 km-1 sr-1 and ± 0.01 km-1, respectively, in most cases. For systems or channels that showed larger discrepancies, an in-depth analysis of deficiencies was performed and technical solutions and upgrades were proposed and realized. The intercomparisons have reinforced confidence in the EARLINET data quality and allowed us to draw conclusions on necessary system improvements for some instruments and to identify major challenges that need to be tackled in the future.

  13. Connecticut Children's Medical Center multi-year branding campaign.

    Science.gov (United States)

    Botvin, J

    2000-01-01

    As the only children's hospital in the state, Connecticut Children's Medical Center was challenged by the inherent complacency of parents. It met the challenge through a multi-level marketing effort which included television and radio, community outreach and strong media relations. By emphasizing the unique nature of children, the campaign affirms the need for a specialized children's health center.

  14. Teaching the Public Relations Case Studies/Campaigns Class.

    Science.gov (United States)

    Cottone, Laura Perkins

    The public relations case studies/campaigns class entails teaching students how to die and then come back to life. As students must learn to take a critical look at complex public and social issues, teachers should create an environment in which the students feel comfortable with the process of psychological reconstruction. Students must be taught…

  15. Email and political campaigning: the experience of MPs in Westminster

    Directory of Open Access Journals (Sweden)

    Nigel Jackson

    2004-04-01

    Full Text Available Traditionally individual politicians communicated directly with their constituents, but the arrival of the mass media, especially television, eroded the role of direct communication. The development of new Information Communication Technologies (ICTs is now re-opening the use of direct communication as part of post-modern campaigning (Norris 2000, with the Internet providing an alternative to media relations. The World Wide Web has attracted great interest from political commentators, but so far email has been largely ignored. Yet the Web is a pull technique, whereas the push nature of email opens up new campaigning possibilities. Downes and Mui (2000 suggest that email represents potentially a 'killer app' which might revolutionize the way MPs approach re-election. A survey of Members of Parliament (MPs Assembly Members (AMs of the Welsh Assembly and Members of the Scottish Parliament (MSPs examines whether they have grasped the opportunities email represents. The research suggests that the outbound use of email for campaigning purposes is limited to a small number of pioneers. Resources, parliamentary culture and party affiliation all shape the use of email campaigning.

  16. Programmatic research to increase the effectiveness of health communication campaigns.

    Science.gov (United States)

    Harrington, Nancy Grant; Palmgreen, Philip C; Donohew, Lewis

    2014-12-01

    This article reviews a long program of research designed to investigate ways to increase the effectiveness of televised antidrug public service announcements. The review highlights the importance of audience targeting (adolescent and young adult high sensation seekers) and message design (message sensation value) in campaign research. It also emphasizes the role of theory and evaluation in programmatic research.

  17. NIF Rugby High Foot Campaign from the design side

    Science.gov (United States)

    Leidinger, J.-P.; Callahan, D. A.; Berzak-Hopkins, L. F.; Ralph, J. E.; Amendt, P.; Hinkel, D. E.; Michel, P.; Moody, J. D.; Ross, J. S.; Rygg, J. R.; Celliers, P.; Clouët, J.-F.; Dewald, E. L.; Kaiser, P.; Khan, S.; Kritcher, A. L.; Liberatore, S.; Marion, D.; Masson-Laborde, P.-E.; Milovich, J. L.; Morice, O.; Pak, A. E.; Poujade, O.; Strozzi, D.; Hurricane, O. A.

    2016-05-01

    The NIF Rugby High Foot campaign results, with 8 shots to date, are compared with the 2D FCI2 design simulations. A special emphasis is placed on the predictive features and on those areas where some work is still required to achieve the best possible modelling of these MJ-class experiments.

  18. Search Engine Advertising Effectiveness in a Multimedia Campaign

    NARCIS (Netherlands)

    Zenetti, German; Bijmolt, Tammo H. A.; Leeflang, Peter S. H.; Klapper, Daniel

    2014-01-01

    Search engine advertising has become a multibillion-dollar business and one of the dominant forms of advertising on the Internet. This study examines the effectiveness of search engine advertising within a multimedia campaign, with explicit consideration of the interaction effects between search eng

  19. 78 FR 34109 - ``Script Your Future'' Medication Adherence Campaign

    Science.gov (United States)

    2013-06-06

    ... HUMAN SERVICES Food and Drug Administration ``Script Your Future'' Medication Adherence Campaign AGENCY... importance of medication adherence to enhance the health of Americans. Medication adherence is taking... each patient. Nearly three out of four Americans report that they do not take their medication...

  20. How campaigns enhance European issues voting during European Parliament elections

    DEFF Research Database (Denmark)

    Beach, Derek; Møller Hansen, Kasper; Larsen, Martin Vinæs

    2016-01-01

    allegiances less important and attitudes about the European project more important by informing voters of and getting them interested in European politics. In effect, we argue that the political campaign leading up to the election makes European Parliament elections less second-order. While previous studies...

  1. Eifel field operation campaign supporting Moon Mars and NEO exploration

    Science.gov (United States)

    Kamps, Oscar; Foing, Bernard H.; Offringa, Marloes

    2016-07-01

    As follow-up on the 2009 Eifel field campaign new field tests with our ExoGeoLab lander were conducted in November 2015 and February 2016. The two phase campaign was used to test the usability of a mock-up lander as test bench for experiments and its remote control in a Moon, Mars analogue environment. In a real mission such a lander could be used in a robotic or manned mission as scientific tool for scientists on Earth to do preliminary study on in-situ collected rocks. This could be useful for example for a sample return mission where scientists on Earth can determine if sample is interesting enough for a more detailed study. The prototype lander is one of the components of the ExoGeoLab project from ESA and ILEWG. Several student projects have prepared the lander for a geological field campaign in lunar and Martian analogue terrain. The lander can be divided in three sections which are used to store several components of the lander. The lower compartment can be used to store a rover or used as laboratory. The middle compartment is used for the lander computer(s), spectrometers and the associated cables. The top plate is used for a telescope which in our case is used to observe the environment around the lander and to guide astronauts during their EVA. As closest volcanic are there is chosen to do the Eifel area, Germany. Several stages of volcanism from Devon till Quaternary resulted in a variation of rocks which is analogue to volcanic rocks from Moon, Mars and other near Earth objects. Several topics we would like to test were pre-defined. Functional tests and demo were performed at European astronaut centre prior to the campaign. The latest updates with respect to the remote control were tested. The pressurised transport vehicle was equipped as remote base for (scientific) support during the campaign. The new instrument set-up were tested and some spectra were measured on collected rocks. The telescope was used to study the environment around the lander

  2. Coordinated Airborne Studies in the Tropics (CAST) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Vaughan, Geraint [Univ. of Manchester (United Kingdom)

    2016-05-01

    The last field campaign held at the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility site on Manus Island, Papua New Guinea (PNG), was conducted in February 2014 as part of the Co-ordinated Airborne Studies in the Tropics (CAST) campaign. This campaign was a collaboration between the National Aeronautics and Space Administration (NASA), National Center for Atmospheric Research (NCAR), and the United Kingdom’s (UK) Natural Environment Research Council (NERC) to study the composition of the Tropical Tropopause Layer (TTL) and the impact of deep convection on this composition. There are three main areas of interest: i) transport of trace gases in the tropical atmosphere (especially short-lived halogenated compounds that can be lifted rapidly into the TTL, where they augment the stratospheric loading of these species); ii) formation of cirrus and its impact on the TTL; and iii) the upper-atmosphere water vapor budget. Overall, the aim was to improve understanding of the dynamical, radiative, and chemical role of the TTL. The Manus operation was a joint experiment between the Universities of Manchester and Cambridge and the UK National Centre for Atmospheric Science (NCAS). It consisted of two elements: an ozonesonde campaign to measure ozone vertical profiles through the TTL, and ground-based monitoring of ozone, halogenated hydrocarbons, and greenhouse gases to determine the composition of lower-boundary-layer air in the Warm Pool region. Thanks to the support from the ARM Climate Research Facility and the exemplary collaboration of ARM staff in the region, the campaign was very successful.

  3. Breastfeeding social marketing: lessons learned from USDA's "Loving Support" campaign.

    Science.gov (United States)

    Pérez-Escamilla, Rafael

    2012-10-01

    Social marketing involves the application of commercial marketing principles to advance the public good. Social marketing calls for much more than health communications campaigns. It involves four interrelated tasks: audience benefit, target behavior, essence (brand, relevance, positioning), and developing the "4Ps" (product, price, place, promotion) marketing mix. The ongoing U.S. Department of Agriculture "Loving Support Makes Breastfeeding Work" campaign was launched in 1997 based on social marketing principles to increase breastfeeding initiation rates and breastfeeding duration among Special Supplemental Nutrition Program for Women, Infants and Children (WIC) participants. Since then there have been improvements in breastfeeding duration in the country, and the majority of WIC women now initiate breastfeeding. Breastfeeding in public places is still not well accepted by society at large, and any and exclusive breastfeeding durations remain exceedingly low. Lessons learned from "Loving Support" and other campaigns indicate that it is important to design social marketing campaigns to target the influential societal forces (e.g., family and friends, healthcare providers, employers, formula industry, legislators) that affect women's decision and ability to breastfeed for the recommended amount of time. This will require formative research that applies the social-ecological model to different population segments, taking and identifying the right incentives to nudge more women to breastfeed for longer. Any new breastfeeding campaign needs to understand and take into account the information acquisition preferences of the target audiences. The vast majority of WIC women have mobile devices and are accessing social media. The Brazilian experience indicates that making breastfeeding the social norm can be done with a solid social marketing strategy. This is consistent with the recently released "Six Steps to Achieve Breastfeeding Goals for WIC Clinics," which identifies

  4. Social Media as a Tool for Online Advocacy Campaigns: Greenpeace Mediterranean’s Anti Genetically Engineered Food Campaign in Turkey

    Directory of Open Access Journals (Sweden)

    B. Pınar Özdemir

    2012-12-01

    Full Text Available Advocacy has been one of the main fields of study in public relations and is established amongst the main functions of public relations. The strong need of non-governmental organizations for public support in order to reach their goals locates public relations and advocacy at a central position for these organizations. Social media, which have been introduced by the further development of Internet technology, especially Web 2.0, has had a significant impact upon public relations and advocacy activities of non-governmental organizations in particular. This development also led non-governmental organizations towards online advocacy campaigns that promote active participation of supporters with more cost effective methods that can easily become widespread. The aim of this study is to place the advocacy campaigns of non-governmental organizations into the context of public relations and to discuss how social media can be utilized in online advocacy through the case study of the Yemezler! (We do not buy it! campaign by Greenpeace Mediterranean that has been significantly successful in a short period in Turkey. The Dragonfly Effect model developed by Aaker and Smith (2010 is employed as a framework in the analysis of the Yemezler! campaign.

  5. Air Quality Campaign Results from the Langley Mobile Ozone Lidar

    Science.gov (United States)

    De Young, R.; Carrion, W.; Pliutau, D.; Gano, R.

    2014-12-01

    A compact differential absorption ozone lidar (DIAL) system has been developed called the Langley Mobile Ozone Lidar (L-MOL) which can provide ozone, aerosol and cloud atmospheric profiles from a mobile trailer for ground-based atmospheric air quality campaigns. This lidar is integrated into the Tropospheric Ozone Lidar Network (TOLNet) currently made up of four other ozone lidars, three of which are mobile, across the country. The laser transmitter consist of a Coherent Evolution 30 TEM00 1-kHz diode pumped Q-switched Nd:YLF inter-cavity doubled laser pumping a Ce:LiCAF tunable UV laser. The transmitter transmits ~60 mW at two wavelengths between 280 and 293-nm for ozone and 2.5-W at 527-nm for aerosol profiling. The lidar operates at 1-kHz with 500-Hz at each 0f two UV wavelength. A fiber coupled 40-cm diameter parabolic telescope collets the backscattered return and records analog and photon counting signals. A separate 30-cm diameter telescope collects very near field returns for ozone profiles close to the surface. The lidar is capable of recording ozone profiles from 100-500-m with the very near field telescope and from 800-m to approximately 6000-m with the far field channel depending on sky background conditions. The system has been configured to enable mobile operation from a trailer which is environmentally controlled, and is towed with a truck with the objective to make the system mobile such that it can be setup at remote sites to support air quality field campaigns such as the July-August 2014 Denver, CO DISCOVER_AQ campaign. Before the lidar was deployed in the DISCOVER-AQ campaign the lidar operated for 15 hours at NASA Langley in Hampton, VA to test the ability of the system to accurately record ozone profiles. The figure below shows the results of that test. Six ozonesondes were launched during this period and show reasonable agreement with the ozone (ppbv) curtain plot. Ozone of stratospheric origin at 4-14 UTC was noted as well as local ozone

  6. Bringing climate change down to earth : science and participation in Canadian and Australian climate change campaigns

    OpenAIRE

    Padolsky, Miriam Elana

    2006-01-01

    This dissertation examines Canadian and Australian climate change campaigns as cases of science in the public sphere. I pose three interconnected research questions. What is the role of science in climate change campaigns? How is the use of science affected by the type of campaign institution: government or non-government? How does the national policy environment, particularly Canada's ratification and Australia's rejection of the Kyoto Protocol, affect the campaigns? In both Canada and Austr...

  7. How Do Online Citizens Persuade Fellow Voters? Using Twitter During the 2012 Dutch Parliamentary Election Campaign

    NARCIS (Netherlands)

    Hosch-Dayican, Bengü; Amrit, Chintan; Aarts, Kees; Dassen, Adrie

    2014-01-01

    This article explores how Twitter was used by voters to participate in electoral campaigning during the Dutch election campaign of 2012. New social media networks like Twitter are believed to be efficient tools of communication between electoral candidates and voters during electoral campaign period

  8. Leading the Campaign: Advancing Colleges and Universities. The ACE Series on Higher Education

    Science.gov (United States)

    Worth, Michael J.

    2010-01-01

    The ability to lead a campaign is essential to success for today's college or university president. And campaign experience at some level is generally now a prerequisite credential for presidential candidates, as well as deans and other academic leaders, on both public and private campuses. This book discusses fundamental campaign principles, but…

  9. The Effect of Media on Charitable Giving and Volunteering: Evidence from the "Give Five" Campaign

    Science.gov (United States)

    Yoruk, Baris K.

    2012-01-01

    Fundraising campaigns advertised via mass media are common. To what extent such campaigns affect charitable behavior is mostly unknown, however. Using giving and volunteering surveys conducted biennially from 1988 to 1996, I investigate the effect of a national fundraising campaign, "Give Five," on charitable giving and volunteering patterns. The…

  10. Impact of a measles immunisation campaign on measles admissions to a Natal hospital.

    Science.gov (United States)

    Abdool Karim, S S; Abdool Karim, Q; Chamane, M

    1991-12-07

    During May and June 1990, a national mass measles immunisation campaign was undertaken in South Africa. This study is an assessment of the impact of the campaign on measles admissions to a provincial referral hospital that has specifically designated wards for children with communicable diseases. Data from the measles ward admissions book for the 18 months before the campaign (1 January 1989-30 June 1990) and 6 months after the campaign (1 July 1990-31 December 1990) were compared. Since the campaign, the average number of measles admissions has declined by 64.4% from 87 to 31 per month (P less than 0.01). Before the campaign, 21.3% of measles patients admitted were aged 7-9 months compared with 27.6% after the campaign, highlighting the urgent need to improve the measles vaccination coverage in this age group. An analysis of the geographical source of patients showed that measles continued to occur after the campaign in most of the areas where it existed before the campaign. It is concluded that important gains have been achieved by the campaign. These will be rapidly eroded and epidemics of measles may occur if measles vaccination efforts wane and slump back to pre-campaign levels. It is important to capitalise on the momentum generated through the campaign by continuing to support efforts of existing health care services to improve and maintain high levels of measles immunisation coverage.

  11. Crime prevention and the attitude toward the criminal justice system: The effects of a multimedia campaign

    NARCIS (Netherlands)

    Kuttschreuter, Margot; Wiegman, Oene

    1998-01-01

    This study concerns the effects of a multimedia campaign regarding residential burglary and violence on the streets in The Netherlands that can be characterised as a tell-the-truth campaign. The mass media component of the campaign consists of editorials in the regional dailies, local weeklies, and

  12. Negative versus Positive Television Advertising in U.S. Presidential Campaigns, 1960-1988.

    Science.gov (United States)

    Kaid, Lynda Lee; Johnston, Anne

    1991-01-01

    Analyzes 830 television spots from 8 presidential campaigns. Shows that the "negativism" charged to the 1988 campaign is actually at the same level as the two previous campaigns. Finds that what tends to differentiate negative from positive ads is not party or incumbency but a more frequent appeal to voters' fears. (PRA)

  13. 78 FR 22516 - Notice of Request for Stakeholder Comments on Doing Business in Africa Campaign

    Science.gov (United States)

    2013-04-16

    ... International Trade Administration Notice of Request for Stakeholder Comments on Doing Business in Africa... to and commercial ties with Africa, the Doing Business in Africa campaign (DBIA campaign), to be led... through the development of a Doing Business in Africa campaign, which will also help advance the...

  14. Integrating Public Relations with Advertising: An Exercise for Students in the College Public Relations Campaigns Course

    Science.gov (United States)

    Moody, Reginald Ford

    2012-01-01

    Today's public relations (PR) campaigns courses give students the opportunity to research, analyze, plan, and, in many cases, execute a campaign for a real client. Even so, today's campaigns courses may leave students with a weak understanding of how PR can best partner with other tools in the communication mix, namely advertising. Educators may…

  15. Campaigning on the Internet: 2008 Presidential General Election Candidate Webpage

    Directory of Open Access Journals (Sweden)

    William L. Benoit

    2016-12-01

    Full Text Available The Internet is becoming an increasingly important component of political campaigns. This study employed content analysis to apply Functional Theory and Issue Ownership Theory to Obama’s and McCain’s presidential candidate webpages in the 2008 campaign. Acclaims (92% were more common than attacks (98%; defenses did not occur in this sample. Policy (82% was addressed more than character (18%. When discussing policy, these candidates addressed future plans most frequently, followed by general goals and then past deeds; on character, candidates discussed ideals, then personal qualities, and then leadership ability. This study shows that as candidates use the Internet to reach voters, their webpages conform to theoretical expectations.

  16. Electoral Campaigning in Indonesia: The Professionalization and Commercialization after 1998

    Directory of Open Access Journals (Sweden)

    Andreas Ufen

    2010-01-01

    Full Text Available According to “Western” models, there are three different stages of electioneering. In Indonesia, elements of these different stages are now combined. The result is not a comprehensive “Americanization”, but a professionalization, along with a hybridization of indigenous and foreign methods. At the beginning, the elections of 1955 were marked by a localized campaign and the absence of TV, pollsters and consultants. The long suppression of electoral politics (from 1957 until 1998 has decelerated the transition toward new forms of electioneering. Technological change, institutional reforms (especially the introduction of direct presidential and direct local elections, the general dealignment of political parties, and the extraordinary rise of pollsters and consultants have effected a professionalization and commercialization of campaigning since the fall of Suharto. Political parties are now tending to become more market-oriented.

  17. OLYMPEX Counterflow Spectrometer and Impactor Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Poellot, Michael [Univ. of North Dakota, Grand Forks, ND (United States)

    2016-07-01

    The U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s ARM Aerial Facility (AAF) Counterflow Spectrometer and Impactor (CSI) probe was flown on the University of North Dakota Cessna Citation research aircraft during the Olympic Mountain Experiment (OLYMPEX). The field campaign took place from November 12 through December 19, 2015, over the Olympic Mountains and coastal waters of Washington State as part of a National Aeronautics and Space Administration (NASA) Global Precipitation Measurement (GPM) validation campaign. The CSI was added to the Citation instrument suite to support the NASA Aerosol-Cloud Ecosystem (ACE) satellite program and flights of the NASA Lockheed Earth Resources (ER-2) aircraft. ACE funded extra ER-2 flights to focus on clouds that are weakly precipitating, which are also of interest to the DOE Atmospheric System Research (ASR) program.

  18. New perspectives and evidence on political communication and campaign effects.

    Science.gov (United States)

    Iyengar, S; Simon, A F

    2000-01-01

    We review recent empirical evidence that shows political campaigns are more potent than widely believed, focusing on the conceptual and methodological advances that have produced these findings. Conceptually, a broader definition of effects--that includes learning and agenda-control, as well as vote choice--characterizes contemporary research. This research also features two kinds of interactive models that are more complex than the traditional hypodermic (message-based) approach. The resonance model considers the relationship between message content and receivers' predispositions, while the strategic model highlights the interactions between competing messages. Finally, we attribute the emergence of stronger evidence in favor of campaign effects to the use of new methodologies including experimentation and content analysis, as well as the more sophisticated use of sample surveys.

  19. The OLI Radiometric Scale Realization Round Robin Measurement Campaign

    Science.gov (United States)

    Cutlip, Hansford; Cole,Jerold; Johnson, B. Carol; Maxwell, Stephen; Markham, Brian; Ong, Lawrence; Hom, Milton; Biggar, Stuart

    2011-01-01

    A round robin radiometric scale realization was performed at the Ball Aerospace Radiometric Calibration Laboratory in January/February 2011 in support of the Operational Land Imager (OLI) Program. Participants included Ball Aerospace, NIST, NASA Goddard Space Flight Center, and the University of Arizona. The eight day campaign included multiple observations of three integrating sphere sources by nine radiometers. The objective of the campaign was to validate the radiance calibration uncertainty ascribed to the integrating sphere used to calibrate the OLI instrument. The instrument level calibration source uncertainty was validated by quatnifying: (1) the long term stability of the NIST calibrated radiance artifact, (2) the responsivity scale of the Ball Aerospace transfer radiometer and (3) the operational characteristics of the large integrating sphere.

  20. A campaign with street cred to target teenagers with asthma.

    Science.gov (United States)

    Lowery, M

    Failure to use asthma medication among young people has contributed to significant levels of morbidity. This report describes an attempt to address this issue through the development of a teenage-asthma initiative focusing on an inhaler rap record. The help of Byker Grove stars, the former Newcastle United player Scott Sellars and many other famous names was enlisted to facilitate the campaign. A nine-minute pop video which has been produced in collaboration with the multidisciplinary health care team forms the campaign's centerpiece. The video is supported by karaoke version of the inhaler rap, aerobic type exercises, posters, T-shirts and baseball caps. An education quiz is used to evaluate the programme.

  1. USING SOCIAL MEDIA IN POLITICAL CAMPAIGNS. EVIDENCE FROM ROMANIA

    Directory of Open Access Journals (Sweden)

    Andra-Ioana ANDRONICIUC

    2016-05-01

    Full Text Available In this paper, we aim at gaining insight into the Romanian president’s online campaign during the 2014 elections. Although there is a growing body of literature on online political campaigns in Western democracies, little research exists on using Social Media in an emergent economy like Romania. In order to take a closer look at the president’s online communication strategy, we conducted a content analysis on the posts published on the president’s official Facebook page over the two weeks leading up to Election Day. This study is the first of this kind and it indicates that president Iohannis used close-ended messages to control the speech, while reaching out to emotion to gain users’ support.

  2. Imaging Mercury's polar deposits during MESSENGER's low-altitude campaign

    Science.gov (United States)

    Chabot, Nancy L.; Ernst, Carolyn M.; Paige, David A.; Nair, Hari; Denevi, Brett W.; Blewett, David T.; Murchie, Scott L.; Deutsch, Ariel N.; Head, James W.; Solomon, Sean C.

    2016-09-01

    Images obtained during the low-altitude campaign in the final year of the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) mission provide the highest-spatial-resolution views of Mercury's polar deposits. Images for distinct areas of permanent shadow within 35 north polar craters were successfully captured during the campaign. All of these regions of permanent shadow were found to have low-reflectance surfaces with well-defined boundaries. Additionally, brightness variations across the deposits correlate with variations in the biannual maximum surface temperature across the permanently shadowed regions, supporting the conclusion that multiple volatile organic compounds are contained in Mercury's polar deposits, in addition to water ice. A recent large impact event or ongoing bombardment by micrometeoroids could deliver water as well as many volatile organic compounds to Mercury. Either scenario is consistent with the distinctive reflectance properties and well-defined boundaries of Mercury's polar deposits and the presence of volatiles in all available cold traps.

  3. Papua New Guinea: multi-level awareness campaign.

    Science.gov (United States)

    1980-01-01

    The Population Awareness Campaign in Papua New Guinea has been launched as a nationwide population education effort. Provinical workshops will be held for local leaders and community groups to create an awareness of the ways in which rapid population growth interferes with development efforts. Other activities involving more specific family planning-related messages will be films, radio programs, and plays in the Pidgin language. These are all designed to air in rural areas.

  4. The Forgotten Airwar: Airpower in the Mesopotamian Campaign

    Science.gov (United States)

    2003-01-01

    Caudrons completed the mapping of Turkish positions, and allowed Major General Gorringe , GOC XII Division, to prepare for the attack. On 22 and 23 July...artillery fire was directed for the first time in the Campaign by one of the Caudrons in preparation for the attack. On 24 July Gorringe launched the...played a critical role in developing plans by both Townshend along the Tigris, and Gorringe along the Euphrates. In spite of the harsh climate and lack

  5. Seeing Stars: A GLOBE at Night Campaign Update

    Science.gov (United States)

    Walker, Constance E.; Pompea, S. M.; Sparks, R. T.; Newhouse, M.

    2012-01-01

    The emphasis in the international citizen-science, star-hunting campaign, GLOBE at Night, is in bringing awareness to the public on issues of light pollution. Light pollution threatens not only observatory sites and our "right to starlight", but can affect energy consumption, wildlife and health. GLOBE at Night has successfully reached a few 100,000 citizen-scientists. What has done in the last year to contribute to its success? • To promote the campaign via popular social media, GLOBE at Night created Facebook and Twitter pages. • Videos have been created for 4 out of 8 Dark Skies Rangers activities. • Sky brightness measurements can be submitted in real time with smart phones or tablets using the new Web application at www.globeatnight.org/webapp/. The location, date and time register automatically. • As a proto-type, an adopt-a-street program had people in Tucson take measurements every mile for the length of the street. Grid measurements canvassed the town, allowing for comparisons of light levels over time. • The increase to 2 campaigns in 2011 re-enforces these studies. In 2012, the campaign will be offered 4 times for 10 days a month: January 14-23, February 12-21, March 13-22 and April 11-20. • A new Web application (www.globeatnight.org/mapapp/) allows for mapping GLOBE at Night data points within a specified distance around a city or area of choice. The resulting maps are bookmarkable and shareable. • NOAO and Arizona Game and Fish Department started a project with GLOBE at Night data and bat telemetry to examine a dark skies corridor in Tucson where endangered bats fly. While providing these updates to the GLOBE at Night program, the presentation will highlight the education and outreach value of the program's resources and outcomes, lessons learned, successes and pitfalls in communicating awareness with the public and attracting young people to study science.

  6. Barrow Black Carbon Source and Impact Study Final Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, Tate

    2014-07-01

    The goal of the Barrow Black Carbon Source and Impact campaign was to characterize the concentration and isotopic composition of carbonaceous atmospheric particulate matter (PM) at the Atmospheric Radiation Measurement (ARM) Climate Research Facility site in Barrow, Alaska. The carbonaceous component was characterized by measuring the organic and black carbon (OC and BC) components of the total PM. To facilitate complete characterization of the PM, filter-based collections were used, including a medium volume PM2.5 sampler and a high volume PM10 sampler. Thirty-eight fine PM fractions (PM2.5) and 49 coarse (PM10) PM fractions were collected at weekly and bi-monthly intervals. The PM2.5 sampler operated with minimal maintenance during the 12 month campaign. The PM10 sampler used for the Barrow Black Carbon Source and Impact (BBCSI) study used standard Tisch “hi-vol” motors that have a known lifetime of approximately 1 month under constant use; this necessitated monthly maintenance, and it is suggested that, for future deployment in the Arctic, the motors be upgraded to industrial blowers. The BBCSI sampling campaign successfully collected and archived 87 ambient atmospheric PM samples from Barrow, Alaska, from July 2012 to June 2013. Preliminary analysis of the OC and BC concentrations has been completed. This campaign confirmed known trends of high BC lasting from the winter through to spring haze periods and low BC concentrations in the summer. However, the annual OC concentrations had a very different seasonal pattern with the highest concentrations during the summer, lowest concentrations during the fall, and increased concentrations during the winter and spring (Figure 1).

  7. Target Asteroids! Observing Campaigns for April through June 2017

    Science.gov (United States)

    Hergenrother, Carl; Hill, Dolores

    2017-04-01

    Asteroid campaigns to be conducted by the Target Asteroids! program during the April-June 2017 quarter are described. In addition to asteroids on the original Target Asteroids! list of easily accessible spacecraft targets, an effort has been made to identify other asteroids that are 1) brighter and easier to observe for small telescope users and 2) analogous to (101955) Bennu and (162173) Ryugu, targets of the OSIRIS-REx and Hayabusa-2 sample return missions.

  8. Automated System for Effective Internet Marketing Campaign (ASEIMC)

    OpenAIRE

    Kovacheva, Todorka

    2008-01-01

    The purpose of the paper is to present an automated system for realization of effective internet marketing campaign (ASEIMC). The constantly growing number of websites available online brings more problems for the contemporary enterprises to reach their potential customers. Therefore the companies have to discover novel approaches to increase their online sales. The presented ASEIMC system gives such an approach and helps small and medium enterprises to compete for customers ...

  9. Tips From Former Smokers – 2013 Campaign

    Centers for Disease Control (CDC) Podcasts

    2013-03-28

    Tim McAfee, MD, MPH, of CDC’s Office on Smoking and Health, discusses the 2013 Tips campaign, and his personal experience as a doctor treating people with diseases caused by smoking, or made worse by it. He also offers advice on how people can quit smoking.  Created: 3/28/2013 by Office on Smoking and Health, National Center for Chronic Disease Prevention and Health Promotion.   Date Released: 3/28/2013.

  10. Revised sampling campaigns to provide sludge for treatment process testing

    Energy Technology Data Exchange (ETDEWEB)

    PETERSEN, C.A.

    1999-02-18

    The purpose of this document is to review the impact to the sludge sampling campaigns planned for FY 1999 given the recent decision to delete any further sludge sampling in the K West Basin. Requirements for Sludge sample material for Sludge treatment process testing are reviewed. Options are discussed for obtaining the volume sample material required and an optimized plan for obtaining this sludge is summarized.

  11. Stroke risk perception among participants of a stroke awareness campaign

    OpenAIRE

    Heuschmann Peter U; Heidrich Jan; Kraywinkel Klaus; Wagner Markus; Berger Klaus

    2007-01-01

    Abstract Background Subjective risk factor perception is an important component of the motivation to change unhealthy life styles. While prior studies assessed cardiovascular risk factor knowledge, little is known about determinants of the individual perception of stroke risk. Methods Survey by mailed questionnaire among 1483 participants of a prior public stroke campaign in Germany. Participants had been informed about their individual stroke risk based on the Framingham stroke risk score. S...

  12. Asymmetric Campaigning as a Rational Choice: Planning Considerations

    Science.gov (United States)

    2006-06-01

    Maslow identified five levels: survival, safety, belonging, esteem, and self-actualization. He presented his theory as a pyramid with five layers...to be sustained by actions of the asymmetric opponent. For the media-fed frenzy over constraints and protraction to continue, the asymmetric...lot of people. The reason for this is twofold. First, the actor needs sufficient support to exist and to sustain an asymmetric campaign. Second, the

  13. The Hadia Story: Digital Storytelling in Election Campaigns

    Directory of Open Access Journals (Sweden)

    Øyvind Kalnes

    2010-06-01

    Full Text Available Digital storytelling in election campaigns is a relatively recent phenomenon, which needs to be investigated in order to enhance our understanding of changes and developments in modern political communication. This article is an analysis of how the Norwegian-Pakistani Labour politician, Hadia Tajik, has used digital storytelling to construct her political identity, and a discussion of the consequences of her experiments with this genre. The focus is on the five video stories she released during the 2009 parliamentary election campaign and the reactions they evoked on the net and in the traditional media during the same (time period.During the 2009 electoral campaign Tajik moved from being a relatively unknown politician to becoming a political household name and the only member of the new Parliament with a migrant background. The digital stories were instrumental in this development for numerous reasons, the most important probably being that they gave her prime time television coverage. Norwegian news media have in general been very concerned with Web 2.0 and Tajik’s videos were regarded as an innovative kind of political communication. The videos also functioned as an effective marketing tool on the net. As an integral part of her extensive viral network, they attracted numerous views and they were with a few exceptions met with positive reactions. This was probably due to their relatively high production values and their catch-all communication strategy that downplayed her ethnic, educational and political background and emphasized her universal human qualities.

  14. Barrow Black Carbon Source and Impact Study Final Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, Tate [Baylor Univ., Waco, TX (United States)

    2014-07-01

    The goal of the Barrow Black Carbon Source and Impact (BBCSI) Study was to characterize the concentration and isotopic composition of carbonaceous atmospheric particulate matter (PM) at the Atmospheric Radiation Measurement site in Barrow, AK. The carbonaceous component was characterized via measurement of the organic and black carbon (OC and BC) components of the total PM. To facilitate complete characterization of the particulate matter, filter-based collections were used, including a medium volume PM2.5 sampler and a high volume PM10 sampler. Thirty-eight fine (PM2.5) and 49 coarse (PM10) particulate matter fractions were collected at weekly and bi-monthly intervals. The PM2.5 sampler operated with minimal maintenance during the 12 month campaign. The PM10 sampler used for the BBCSI used standard Tisch hi-vol motors which have a known lifetime of ~1 month under constant use; this necessitated monthly maintenance and it is suggested that the motors be upgraded to industrial blowers for future deployment in the Arctic. The BBCSI sampling campaign successfully collected and archived 87 ambient atmospheric particulate matter samples from Barrow, AK from July 2012 to June 2013. Preliminary analysis of the organic and black carbon concentrations has been completed. This campaign confirmed known trends of high BC lasting from the winter through to spring haze periods and low BC concentrations in the summer.

  15. The WEBT BL Lacertae Campaign 2001 and its extension

    CERN Document Server

    Villata, M; Kurtanidze, O M; Nikolashvili, M G; Ibrahimov, M A; Papadakis, I E; Tosti, G; Hroch, F; Takalo, L O; Sillanpää, A; Hagen-Thorn, V A; Larionov, V M; Schwartz, R D; Basler, J; Brown, L F; Balonek, T J; Benítez, E; Ramírez, A; Sadun, A C; Boltwood, P; Carini, M T; Barnaby, D; Coloma, J M; Ros, J A; Dai, B Z; Xie, G Z; Mattox, J R; Rodríguez, D; Asfandiyarov, I M; Atkerson, A; Beem, J L; Bloom, S D; Chanturiya, S M; Ciprini, S; Crapanzano, S; De Diego, J A; Efimova, N V; Gardiol, D; Guerra, J C; Kahharov, B B; Kapanadze, B Z; Karttunen, H; Kato, T; Kimeridze, G N; Kudryavtseva, N A; Lainela, M; Lanteri, L; Larionova, E G; Maesano, M; Marchili, N; Massone, G; Monroe, T; Montagni, F; Nesci, R; Nilsson, K; Noble, J C; Nucciarelli, G; Ostorero, L; Papamastorakis, J; Pasanen, M; Peters, C S; Pursimo, T; Reig, P; Ryle, W; Sclavi, S; Sigua, L A; Uemura, M; Wills, W

    2004-01-01

    BL Lacertae has been the target of four observing campaigns by the Whole Earth Blazar Telescope (WEBT) collaboration. In this paper we present $UBVRI$ light curves obtained by the WEBT from 1994 to 2002, including the last, extended BL Lac 2001 campaign. A total of about 7500 optical observations performed by 31 telescopes from Japan to Mexico have been collected, to be added to the $\\sim 15600$ observations of the BL Lac Campaign 2000. All these data allow one to follow the source optical emission behaviour with unprecedented detail. The analysis of the colour indices reveals that the flux variability can be interpreted in terms of two components: longer-term variations occurring on a few-day time scale appear as mildly-chromatic events, while a strong bluer-when-brighter chromatism characterizes very fast (intraday) flares. By decoupling the two components, we quantify the degree of chromatism inferring that longer-term flux changes imply moving along a $\\sim 0.1$ bluer-when-brighter slope in the $B-R$ vers...

  16. Columnar Aerosol Optical Properties during "El Arenosillo 2004 Summer Campaign"

    Energy Technology Data Exchange (ETDEWEB)

    Prats, N.; Cachorro, V. E.; Sorribas, M.; Mogo, S.; Berjon, A.; Toledano, C.; de Frutos, A. M.; de la Rosa, J.; Laulainen, Nels S.; de la Morena, B. A.

    2008-04-14

    A detailed analysis of the microphysical and radiative columnar aerosol parameters has been carried out for data collected during the “El Arenosillo 2004” summer campaign. These data are derived from a Cimel sun-photometer, as part of the PHOTONS-AERONET network at the El Arenosillo site in south-western Spain, over the period 1 June to 31 October 2004. The aim of this campaign was to obtain a more complete set of data on aerosol microphysical, optical/radiative, and chemical properties for use in closure studies. Previous papers addressed the climatology of the AOD-alpha parameters at this site. In this paper, we focus on the characterization of the particle size distribution and associated microphysical parameters, such as volume concentration, effective radius, etc., in order to define the features and ranges of these physical parameters associated with both fine and coarse particle modes. The requirement of high AOD values for using the optical inversion technique puts significant constraints on the estimation of these parameters and, thus, necessitates great care in the analysis. As a result, only the characterizations for desert dust events are considered reliable. Moreover, summer 2004 had the most frequent desert dust intrusions, including the most intense event, ever recorded at the El Arensillo site. We summarize the results for the intensive summer campaign in terms of the range of values of the physical and optical parameters of the mixed aerosol types present in this area of Spain.

  17. Romanian Campaigns on Corporate Social Responsibility – Signs of Globalization

    Directory of Open Access Journals (Sweden)

    Monica Patrut

    2016-03-01

    Full Text Available Organizations play an important role in the development of the modern society since managers have become aware that financial profit highly depends on community involvement. The active participation of organizations in community life implies to adapt global strategies to local issues or to promote local issues at a global level. Actually this is the essence of glocalization. The means by which organizations can achieve these glocal objectives is CSR campaigns.  CSR represents an instrument used to solve diverse issues, such as: human rights, environment and climate change, education, support for vulnerable groups, sustainable development, or establishment of moral capitalism. Within the context of the ever-rising internet access of all audiences, CSR campaigns have become more visible and have capitalized on the advantages of collective intelligence, internet users’ participation and their user generated contents. The purpose of our study is to provide an insight into (1 the prominence of Romanian organizations which are the most socially responsible, (2 the domains in which Romanian organizations have invested; (3 the salience of CSR 1.0 and CSR 2.0 tools used in the promotion of CSR campaigns in Romania. 

  18. Skin and Colon Cancer Media Campaigns in Utah

    Directory of Open Access Journals (Sweden)

    Camille Broadwater

    2004-10-01

    Full Text Available The mission of the Utah Cancer Action Network is to reduce cancer incidence and mortality in Utah. Established in 2003, the network selected skin and colon cancers as the first priorities in its comprehensive plan. In its first year of operation, the network planned and implemented a cancer awareness campaign that was organized along two tracks: 1 marketing research, consisting of two telephone surveys, and 2 two advertising/awareness campaigns, one for colon cancer and one for skin cancer. The first telephone survey was conducted in January 2003 to obtain a baseline measurement of the Utah population’s knowledge, attitudes, and behaviors. The advertising campaigns were launched in April 2003, and the second telephone survey was conducted in May. In January 2003, 18% of survey respondents reported seeing or hearing skin cancer prevention or sun protection announcements; in May, this percentage increased to 76%. In January, 36% indicated they had seen, read, or heard colorectal cancer early detection announcements; in May, this percentage increased to 79%.

  19. Clustering Methods Application for Customer Segmentation to Manage Advertisement Campaign

    Directory of Open Access Journals (Sweden)

    Maciej Kutera

    2010-10-01

    Full Text Available Clustering methods are recently so advanced elaborated algorithms for large collection data analysis that they have been already included today to data mining methods. Clustering methods are nowadays larger and larger group of methods, very quickly evolving and having more and more various applications. In the article, our research concerning usefulness of clustering methods in customer segmentation to manage advertisement campaign is presented. We introduce results obtained by using four selected methods which have been chosen because their peculiarities suggested their applicability to our purposes. One of the analyzed method – k-means clustering with random selected initial cluster seeds gave very good results in customer segmentation to manage advertisement campaign and these results were presented in details in the article. In contrast one of the methods (hierarchical average linkage was found useless in customer segmentation. Further investigations concerning benefits of clustering methods in customer segmentation to manage advertisement campaign is worth continuing, particularly that finding solutions in this field can give measurable profits for marketing activity.

  20. Cost-effectiveness of a ROPS social marketing campaign.

    Science.gov (United States)

    Sorensen, J A; Jenkins, P; Bayes, B; Clark, S; May, J J

    2010-01-01

    Tractor rollovers are the most frequent cause of death in the farm community. Rollover protection structures (ROPS) can prevent the injuries and fatalities associated with these events; however, almost half of U.S. farms lack these essential devices. One promising strategy for increasing ROPS use is social marketing. The purpose of this study was to assess the costs associated with the New York ROPS Social Marketing Campaign in relation to the cost of fatalities and injuries averted as a result of the campaign to determine whether cost savings could be demonstrated in the initial years of program implementation. A total of 524 farmers who had retrofitted a tractor through the program were mailed a survey to assess the number of rollovers or close calls that occurred since ROPS installation. Responses were obtained from 382 farmers, two of whom indicated that they had a potential fatality/injury scenario since retrofitting their tractor through the program. The cost savings associated with the intervention was estimated using a decision-tree analysis adapted from Myers and Pana-Cryan with appropriate consumer price index adjustments. The data were compared to the cost of the New York ROPS Social Marketing Campaign to arrive at an associated cost-savings estimate relative to the intervention. This study indicates that a net savings will likely be demonstrated within the third year of the New York ROPS Social Marketing initiative. These data may provide evidence for researchers hoping to generate support from state and private agencies for similar initiatives.

  1. Native Generations: A campaign addressing infant mortality among American Indians and Alaska Natives in urban areas.

    Science.gov (United States)

    Rutman, Shira; Loughran, Julie; Tanner, Leah; Randall, Leslie L

    2016-01-01

    This study describes the development and evaluation of Native Generations, a campaign addressing high rates of infant mortality (IM) among American Indians and Alaska Natives (AI/ANs) in urban areas. Campaign development included reviews of literature and previous campaigns, an advisory council, and focus groups. Campaign messages are strength-based, encouraging AI/AN caregivers to utilize available Native-specific resources, including health care, support services, and programming as IM protective factors. The primary campaign material is an 11-minute video. Pilot survey data indicate the video may help increase awareness of IM and Native-specific resources, and increase connection to Native identity, culture, and community.

  2. ADVERTISING CAMPAIGN STRATEGY BASED ON THE COMMUNICATION OBJECTIVE: A CASE STUDY AT TOKOBAGUS ADVERTISING CAMPAIGNS (2011-2014

    Directory of Open Access Journals (Sweden)

    Angela Oscario

    2016-09-01

    Full Text Available Article focused on advertising as one of the most important parts of marketing communication in one of the online shop, TokoBagus. Advertising communicated a message from a certain brand to the target audience through a particular medium. The aim of this research was making advertising with a powerful message, so it was able to become a captain of consciousness that could play an important role in economic and social systems of modern society. Because of its potential power, the creative advertising workers had a big responsibility in their hands. It was not only to explore the creativity visually or verbally to a creative worker, but also, they should understand the purpose of communication, the communication strategy, and the creative strategy. In this case, TokoBagus run this in making advertisement campaign to promote its brand. The method used in this research was the qualitative method and inductive model. Data were collected through an interview, literature, and visual data. Those collected data were analyzed using a qualitative-verificative strategy and case study method. The case study was Toko Bagus advertising campaign from the year 2011 to the year 2014 when finally its name changes into OLX. It finds that the advertisements only become beautiful works of art, but it does not solve the problem of the brand. Therefore, this research is important to document the communication strategy and the creative strategy of an advertising campaign so it can be a reference for a young designers or students.

  3. Lessons learned from public health mass media campaigns: marketing health in a crowded media world.

    Science.gov (United States)

    Randolph, Whitney; Viswanath, K

    2004-01-01

    Every year, new public health mass media campaigns are launched attempting to change health behavior and improve health outcomes. These campaigns enter a crowded media environment filled with messages from competing sources. Public health practitioners have to capture not only the attention of the public amid such competition, but also motivate them to change health behaviors that are often entrenched or to initiate habits that may be new or difficult. In what ways are public health mass media campaigns now attempting to succeed in a world crowded with media messages from a myriad of sources? What are the conditions that are necessary for a media campaign to successfully alter health behaviors and alter outcomes in the long term? To what extent can the successes and failures of previous campaigns be useful in teaching important lessons to those planning campaigns in the future? In this chapter we attempt to answer these questions, drawing from recent literature on public health mass media campaigns.

  4. Thinking about "Think Again" in Canada: assessing a social marketing HIV/AIDS prevention campaign.

    Science.gov (United States)

    Lombardo, Anthony P; Léger, Yves A

    2007-06-01

    The Canadian "Think Again" social marketing HIV/AIDS prevention campaign, adapted from an American effort, encourages gay men to rethink their assumptions about their partners' HIV statuses and the risks of unsafe sex with them. To improve future efforts, existing HIV/AIDS prevention initiatives require critical reflection. While a formal evaluation of this campaign has been carried out elsewhere, here we use the campaign as a social marketing case study to illustrate its strengths and weaknesses, as a learning tool for other campaigns. After describing the campaign and its key results, we assess how it utilized central tenets of the social marketing process, such as formative research and the marketing mix. We then speak to the importance of theoretical influence in campaign design and the need to account for social-contextual factors in safer sex decision making. We conclude with a summary of the lessons learned from the assessment of this campaign.

  5. The alcohol industry's way to discipline pleasure. Prevention campaigns aimed at Danish youth

    DEFF Research Database (Denmark)

    Demant, Jakob Johan; Houborg, Esben

    2011-01-01

    ) to analyze drug prevention campaigns in Sweden. After this a more detailed analysis of how the two campaigns articulate pleasure is done. Results – Both campaigns recognize recreational motives for consuming alcohol. In both campaigns pleasure is central to the regulation of alcohol consumption among young...... people. Both campaigns aim to associate alcohol consumption with a disciplined pleasure that does not involve intoxication. In this way alcohol policy becomes a politics of pleasure. Conclusion – Alcohol prevention that aims to moderate alcohol consumption among young people by associating alcohol......Aims – To analyze how two youth alcohol prevention campaigns funded by the Danish alcohol industry articulate the relationship between alcohol, intoxication and pleasure. Design – The two campaigns are first analyzed by applying an analytical model developed by Karlsson and Bergmark (2009...

  6. Some Claims of Liman von Sanders On The Gallipoli Campaign

    Directory of Open Access Journals (Sweden)

    Sezen Kılıç

    2014-06-01

    Full Text Available The Gallipoli campaign is still a widely studied issue in Turkey and abroad. Gallipoli reminds us of t he Anafartalar hero Mustafa Kemal and the legend of the victory written by the Turkish soldiers despite all the impossibilities. It is little known that the Turkish troops were commanded by a German general Liman von Sanders, and the fact that there were a lot of German officers in his command chain should be remembered. Nevertheless, incomparable to the number of the Turkish soldiers and much less than them, there were a small number of German troops who fought and lost their lives during the GalThe Gallipoli campaign is still a widely studied issue in Turkey and abroad. Gallipoli reminds us of the Anafartalar hero Mustafa Kemal and the legend of the victory written by the Turkish soldiers despite all the impossibilities. It is little known that the Turkish troops were commanded by a German general called Liman von Sanders, and the fact that there were a lot of German officers in his command chain should be remembered. Nevertheless, incomparable to the number of the Turkish soldiers and much less than them, there were a small number of German troops who fought and lost their lives during the GalThe Gallipoli campaign is still a widely studied issue in Turkey and abroad. Gallipoli reminds us of the Anafartalar hero Mustafa Kemal and the legend of the victory written by the Turkish soldiers despite all the impossibilities. It is little known that the Turkish troops were commanded by a German general called Liman von Sanders, and the fact that there were a lot of German officers in his command chain should be remembered. Nevertheless, incomparable to the number of the Turkish soldiers and much less than them, there were a small number of German troops who fought and lost their lives during the GalThe Gallipoli campaign is still a widely studied issue in Turkey and abroad. Gallipoli reminds us of the Anafartalar hero Mustafa Kemal and the legend

  7. Persuasive appeals in road safety communication campaigns: Theoretical frameworks and practical implications from the analysis of a decade of road safety campaign materials.

    Science.gov (United States)

    Guttman, Nurit

    2015-11-01

    Communication campaigns are employed as an important tool to promote road safety practices. Researchers maintain road safety communication campaigns are more effective when their persuasive appeals, which are central to their communicative strategy, are based on explicit theoretical frameworks. This study's main objectives were to develop a detailed categorization of persuasive appeals used in road safety communication campaigns that differentiate between appeals that appear to be similar but differ conceptually, and to indicate the advantages, limitations and ethical issues associated with each type, drawing on behavior change theories. Materials from over 300 campaigns were obtained from 41 countries, mainly using road safety organizations' websites. Drawing on the literature, five types of main approaches were identified, and the analysis yielded a more detailed categorizations of appeals within these general categories. The analysis points to advantages, limitations, ethical issues and challenges in using different types of appeals. The discussion summarizes challenges in designing persuasive-appeals for road safety communication campaigns.

  8. Parsivel Disdrometer Support for MAGIC Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Kollias, Pavlos [Stony Brook Univ., NY (United States); Bartholomew, Mary Jane [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-06-01

    In the Marine ARM GPCI Investigation of Clouds (MAGIC) field campaign, the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s second Mobile Facility (AMF2) was deployed on the Horizon Lines cargo ship Spirit traversing a route between Los Angeles, California and Honolulu, Hawaii for one full year. The transect for this deployment was chosen specifically because it crosses the stratocumulus-to-cumulus transition of the North-East Pacific, a region of great climatic interest and a close approximation to the transect used for several focused model intercomparison efforts. The cloud type and cover along this transect vary from low marine stratocumulus with high areal coverage near the California coast to isolated shallow cumulus with much lower areal coverage in the trade wind regime near Hawaii. The low marine stratocumulus decks, with their high albedo, exert a major influence on the shortwave radiation budget in the ocean environment, and thus provide an extremely important forcing of Earth’s climate. The trade cumulus clouds play a large role in the global surface evaporation and also in Earth’s albedo. One of the important science drivers of the MAGIC campaign was to measure the properties of clouds and precipitation, specifically cloud type, fractional coverage, base height, physical thickness, liquid water path (LWP), optical depth, and drizzle and precipitation frequency, amount, and extent. Retrievals of cloud and precipitation properties during the MAGIC campaign relied critically on the calibration of the AMF2 radar systems. For MAGIC this included the KAZR and M-WACR, both fixed zenith-pointing systems, and the 1290 MHz beam steerable wind profiler.

  9. CNES super pressure balloons upgrade for Strateole-2 campaign

    Science.gov (United States)

    Venel, Stephanie; Cocquerez, Philippe; Hertzog, Albert

    2016-07-01

    The French Space Agency, CNES, has developed, since about twelve years ago, super pressure balloons (SPB) that float on constant density (isopycnic) surfaces in the lowermost stratosphere, carrying 40 to 50 kg payloads, during typically three months. These SPB have been successfully deployed in flotilla of about 20 balloons for different scientific campaigns all over the world in different configuration sizes from 8,5 to 12 m diameter, mainly to document the chemistry and dynamics of the atmosphere, to study gravity waves, and to provide in-situ atmospheric profiles thanks to the NCAR driftsonde payload. The SPB housekeeping gondola used from 2005 to 2011 now needs to be upgraded in order to increase the flights' safety and to improve its performance with up to date equipment's. The control center will also be redesigned. These modifications take into account the experience acquired during the last SPB campaigns, mainly during CONCORDIASI, with 19 flights over Antarctica from September 2010 to January 2011. After a successful preliminary design review, the project is now conducting the detailed conception phase. This new system is developed for STRATEOLE-2, a project dedicated to the coupling processes between the troposphere and the stratosphere in the deep tropics, using several types of instruments, both for in situ and remote measurements in the atmosphere. STRATEOLE -2 includes two measurement campaigns, three years spaced to study the quasi biennial oscillation. Since the scientific payloads are fully self-standing, some technical solutions will be common with the CNES housekeeping gondola, such as the renewable power system. This paper will describe the STRATEOLE-2 project and the developments in progress for the SPB system upgrade.

  10. Lower Atmospheric Boundary Layer Experiment (LABLE) Final Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Klein, P [University of Oklahoma - School of Meteorology; Bonin, TA; Newman, JF [National Renewable Energy Laboratory; Turner, DD [National Oceanic and Atmospheric Administration; Chilson, P [University of Oklahoma; Blumberg, WG [University of Oklahoma; Mishra, S; Wainwright, CE; Carney, M [University of Oklahoma - School of Meteorology; Jacobsen, EP [University of Oklahoma; Wharton, S [Lawrence Livermore National Laboratory

    2015-11-01

    The Lower Atmospheric Boundary Layer Experiment (LABLE) included two measurement campaigns conducted at the Atmospheric Radiation Measurement (ARM) Southern Great Plains site in Oklahoma during 2012 and 2013. LABLE was designed as a multi-phase, low-cost collaboration among the University of Oklahoma, the National Severe Storms Laboratory, Lawrence Livermore National Laboratory, and the ARM program. A unique aspect was the role of graduate students in LABLE. They served as principal investigators and took the lead in designing and conducting experiments using different sampling strategies to best resolve boundary-layer phenomena.

  11. The linguistic aspect of strategic framing in modern political campaigns

    Directory of Open Access Journals (Sweden)

    Agnieszka Pluwak

    2015-11-01

    Full Text Available The linguistic aspect of strategic framing in modern political campaigns The following article describes the role of semantics in political marketing, emphasizing the mechanism of framing and perspectivising in discourse. The complexity of the framing process is discussed in the introduction, then the linguistic aspect of political framing is debated and the technique of wording formulation in political discourse analyzed. Finally, implications and conclusions for further research are presented. Examples of political framing provided within the paper are based on the analysis of contemporary public discourses.

  12. Women’s Cloth-Making Campaign in Shanxi(1)

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    THE cloth-making campaign was a great activity carried out to pull through and win the victory of the War of Resistance Against Japan (1937-1945). In the northwest of Shanxi Province, with mountains and long winters, local industry and agriculture developed slowly. Moreover, the Kuomintang and Yan Xishan’s troops feudalist rule and oppression, the warlords harassing and looting, and the Japanese aggressors’ destruction impoverished the farmers, wasted their land, and ruined their dwellings. The original small handicraft industries were almost shut-down completely. The local people lived destitute

  13. Gemini Planet Imager Calibrations, Pipeline Updates, and Campaign Data Processing

    Science.gov (United States)

    Perrin, Marshall D.; Follette, Katherine B.; Millar-Blanchaer, Max; Wang, Jason; Wolff, Schulyer; Hung, Li-Wei; Arriaga, Pauline; Savransky, Dmitry; Bailey, Vanessa P.; Bruzzone, Sebastian; Chilcote, Jeffrey K.; De Rosa, Robert J.; Draper, Zachary; Fitzgerald, Michael P.; Greenbaum, Alexandra; Ingraham, Patrick; Konopacky, Quinn M.; Macintosh, Bruce; Marchis, Franck; Marois, Christian; Maire, Jerome; Nielsen, Eric L.; Rajan, Abhijith; Rameau, Julien; Rantakyro, Fredrik; Ruffio, Jean-Baptise; Tran, Debby; Ward-Duong, Kimberly; Zalesky, Joe; GPIES Team

    2017-01-01

    In support of GPI imaging and spectroscopy of exoplanets, polarimetry of disks, and the ongoing Exoplanet Survey we continue to refine calibrations, improve data reduction methods, and develop other enhancements to the data pipeline. We summarize here the latest updates to the open-source GPI Data Reduction Pipeline, including recent improvements spectroscopic and photometric calibrations and polarimetric data processing. For the GPI Exoplanet Survey we have incorporated the GPI Data Pipeline into a larger campaign data system that provides automatic data processing including rapid PSF subtraction and contrast measurements in real time during observations and fully automated PSF subtractions using several state-of-the-art algorithms shortly after each observation completes.

  14. It's what you do! Reflections on the VERB campaign.

    Science.gov (United States)

    Wong, Faye L; Greenwell, Michael; Gates, Suzanne; Berkowitz, Judy M

    2008-06-01

    This article shares the first-hand experiences of the CDC's VERB team in planning, executing, and evaluating a campaign that used social marketing principles, which involved paid media advertising, promotions, and national and community partnerships to increase physical activity among children aged 9-13 years (tweens). VERB staff gained valuable experience in applying commercial marketing techniques to a public health issue. This article describes how marketing, partnership, and evaluation activities were implemented to reach a tween audience. In doing so, fundamental differences in marketing between public health and the private sector were revealed.

  15. Vaccination campaigns against poliomyelitis in Spain in 1963

    Directory of Open Access Journals (Sweden)

    Rodríguez Sánchez, Juan Antonio

    2009-06-01

    Full Text Available Two anti-poliomyelitic vaccination campaigns coexisted in 1963: the Salk vaccine used by the Compulsory Health Insurance and the pilot experience with the oral Sabin vaccine promoted by the Health General Office. This simultaneity of campaigns was due to the interest that both bodies had to control the Preventive Medicine in Spain. The Compulsory Sickness Insurance used the antipolio vaccine to promote itself socially in a time when the Basic Law on Social Security was being developed. Under these circumstances, the Health General Office allegedly brought forward its vaccine campaign by using a test of an innovative oral trivalent vaccine in the province of León, something which was hidden to the public. The Health General Office’s claim of competence in prevention and the need of a massive response to a voluntary vaccine led to a singular advertising campaign with old messages in innovative means of communication.

    En 1963 coexistieron en el tiempo dos campañas de vacunación antipoliomielítica: la llevada a cabo con vacuna Salk por el Seguro Obligatorio de Enfermedad y la experiencia piloto con vacuna oral Sabin que promovió la Dirección General de Sanidad. La simultaneidad obedecía a la pugna entre ambos organismos por controlar la Medicina Preventiva en España. El Seguro Obligatorio de Enfermedad utilizó la vacunación antipolio para promocionarse socialmente en unos momentos de gestación de la Ley de Bases de la Seguridad Social. En estas circunstancias, la Dirección General de Sanidad debió anticipar su campaña de vacunación mediante un ensayo de una novedosa vacuna trivalente oral en la provincia de León, aspectos que fueron ocultados a la población. La reivindicación de su competencia en la prevención y la necesidad de una respuesta masiva ante una vacunación voluntaria originaron una singular campaña publicitaria de añejos mensajes pero en novedosos medios de comunicación.

  16. The NIF x-ray spectrometer calibration campaign at Omega.

    Science.gov (United States)

    Pérez, F; Kemp, G E; Regan, S P; Barrios, M A; Pino, J; Scott, H; Ayers, S; Chen, H; Emig, J; Colvin, J D; Bedzyk, M; Shoup, M J; Agliata, A; Yaakobi, B; Marshall, F J; Hamilton, R A; Jaquez, J; Farrell, M; Nikroo, A; Fournier, K B

    2014-11-01

    The calibration campaign of the National Ignition Facility X-ray Spectrometer (NXS) was carried out at the Omega laser facility. Spherically symmetric, laser-driven, millimeter-scale x-ray sources of K-shell and L-shell emission from various mid-Z elements were designed for the 2-18 keV energy range of the NXS. The absolute spectral brightness was measured by two calibrated spectrometers. We compare the measured performance of the target design to radiation hydrodynamics simulations.

  17. Saladin and the Ayyubid Campaigns in the Maghrib

    OpenAIRE

    Baadj, Amar

    2013-01-01

    This article concerns the conquest of Libya and Tunisia by Saladin (Salah al-Din) and the Ayyubids in the 1170s and 1180s. First it presents a reconstruction of the campaigns conducted by the Ayyubid mamlūks Sharaf al-Dīn Qarāqūsh and Ibn Qarātikīn in Libya and the conflict in Ifrīqiya (Tunisia) between the Almohads and the Ayyubids based on the relevant primary sources. Then the extent to which Saladin was responsible for these military expeditions is considered and finally the issue of the ...

  18. [International guidelines of the Surviving Sepsis Campaign : update 2012].

    Science.gov (United States)

    Briegel, J; Möhnle, P

    2013-04-01

    An update of the international guidelines for therapy of sepsis was published in February 2012 by the Surviving Sepsis Campaign (SSC). The update includes a further development of the guidelines from 2004 and 2008. The guidelines are divided into three sections, sepsis-specific therapeutic measures, recommendations on general intensive care measures for sepsis and finally special features of sepsis in pediatric intensive care medicine are presented in detail. This article discusses the most important amendments in the first two sections and delving deeper into the guidelines.

  19. Marketing physical activity: lessons learned from a statewide media campaign.

    Science.gov (United States)

    Peterson, Michael; Abraham, Avron; Waterfield, Allan

    2005-10-01

    Steps taken to create, implement, and initially assess a statewide physical activity social marketing campaign targeted to 18-to 30-year-olds are presented. Included is a summary demonstration of the application of the associative group analysis in formative market research and message development. Initial postcampaign questionnaire (n = 363) results indicated that 39.1% of respondents had seen the television ad, of which 31.2% indicated they intended to be more active, and 62.5% of respondents had been exposed to either the television or outdoor media ads. Lessons learned through the social marketing process including media channel effectiveness, message development and assessment, and marketing firm relationships are provided.

  20. Transgender DeKalb: observations of an advocacy campaign.

    Science.gov (United States)

    Butler, John R

    2003-01-01

    In September 2000, the Community Members Against Discrimination (CMAD), a grassroots LGBT organization in DeKalb, Illinois, convinced their city council to add protection against discrimination on the basis of gender identity and expression. Written as an autoethnography, this essay considers the events of the campaign in terms of queer theory and the study of public argument by isolating a set of episodes that bring the reader closer to the experiences of transgender citizens who act in a public culture. The author also explores his own responsibilities as a scholar of communication, an activist, and a member of the LGBT community.

  1. A 10-year systematic review of HIV/AIDS mass communication campaigns: Have we made progress?

    Science.gov (United States)

    Noar, Seth M; Palmgreen, Philip; Chabot, Melissa; Dobransky, Nicole; Zimmerman, Rick S

    2009-01-01

    The purpose of the current study was to conduct a 10-year systematic review of HIV/AIDS mass communication campaigns focused on sexual behavior, HIV testing, or both (1998-2007) and to compare the results with the last comprehensive review of such campaigns, conducted by Myhre and Flora (2000). A comprehensive search strategy yielded 38 HIV/AIDS campaign evaluation articles published in peer-reviewed journals, representing 34 distinct campaign efforts conducted in 23 countries. The articles were coded on a variety of campaign design and evaluation dimensions by two independent coders. Results indicated that compared with the previous systematic review (1986-1998 period), campaigns increasingly have employed the following strategies: (1) targeted defined audiences developed through audience segmentation procedures; (2) designed campaign themes around behavior change (rather than knowledge change); (3) used behavioral theories; (4) achieved high message exposure; (5) used stronger research designs for outcome evaluation; and (6) included measures of behavior (or behavioral intentions) in outcome assessments. In addition, an examination of 10 campaign efforts that used more rigorous quasi-experimental designs revealed that the majority (8 of 10) demonstrated effects on behavior change or behavioral intentions. Despite these positive developments, most HIV/AIDS campaigns continue to use weak (i.e., preexperimental) outcome evaluation designs. Implications of these results for improved design, implementation, and evaluation of HIV/AIDS campaign efforts are discussed.

  2. The unique effects of environmental strategies in health promotion campaigns: a review.

    Science.gov (United States)

    Randolph, Karen A; Whitaker, Pippin; Arellano, Adriana

    2012-08-01

    Various strategies are used as tools in health promotion campaigns to increase health-related outcomes among target populations. Evaluations of these campaigns examine effects on changing people's knowledge, attitudes, and/or behaviors. Most evaluations examine the combined impact of multiple strategies. Less is known about the unique effects of particular strategies. To address this gap, we used highly systematic methods to identify and review scientifically rigorous evaluations of 18 campaigns that examined the unique effects of three sets of intervention strategies (entertainment education, law enforcement, and mass media) on changes in knowledge, attitudes, and practice with regard to various health behaviors. Results showed differences in evaluation processes based on the type of strategy used to promote campaign messages. For instance, evaluations of mass-media based campaigns were more likely to examine changes in knowledge, relative to evaluations of campaigns that used law enforcement strategies. In addition, campaign effects varied by particular strategies. Mass media-based campaigns were more likely to affect knowledge, relative to behaviors. Law enforcement and entertainment education-based campaigns showed positive effects on behaviors. The implications for planning and evaluating health promotion campaigns are described.

  3. No drama: key elements to the success of an HIV/STI-prevention mass-media campaign.

    Science.gov (United States)

    Pedrana, Alisa E; Hellard, Margaret E; Higgs, Peter; Asselin, Jason; Batrouney, Colin; Stoovè, Mark

    2014-05-01

    We qualitatively examined gay men's reactions to the national "Drama Downunder" HIV/STI social marketing campaign targeting gay men in Australia to identify key campaign elements that underpinned the demonstrated effectiveness of the campaign. We present findings from six qualitative focus groups held with 49 participants as part of the evaluation of the sexual-health-promotion campaign over 2008-2009. Participants identified attention-grabbing images, a humorous approach, positive and simple tailored messaging, and the use of mainstream media as campaign features crucial in normalizing sexual health testing, driving campaign engagement, and ensuring high message exposure. Our results suggest that designers of future campaigns should strive to balance positive and negative campaign images and messages, and find new ways to engage men with sexual health topics, particularly younger gay men. We discuss the implications of our findings about campaign effectiveness for future health-promotion campaigns and message design.

  4. Correlates of Initial Recall of a Multimedia Communication Campaign to Promote Physical Activity among Tweens: the WIXX Campaign.

    Science.gov (United States)

    Bélanger-Gravel, Ariane; Cutumisu, Nicoleta; Gauvin, Lise; Lagarde, François; Laferté, Marilie

    2017-01-01

    This study examined factors associated with children's and parents' recall of a communication campaign aimed at promoting children's physical activity. A cross-sectional population-based telephone survey was conducted among 1001 children and their parents. Respondents were recruited through a random digit dialing procedure. Respondents' recall of the campaign, beliefs, sociodemographics as well as levels of physical activity and sedentary behaviors were self-reported. Logistic regression analyses were conducted for tweens and their parents separately. Girls (odds ratio [OR] = 2.1; 95%confidence interval (CI): 1.3, 3.5) were more likely to have unaided recall when compared to boys. Tweens in primary school (OR = 1.9; 95%CI: 1.0, 3.4 and OR = 2.1; 95%CI: 1.4, 3.0) and those speaking French (OR = 3.3; 95%CI: 1.4, 8.1 and OR = 2.9; 95%CI: 1.8, 4.7) were more likely to have unaided and aided recall, respectively. Among parents, tweens' unaided (OR = 12.0; 95%CI: 5.2, 28.1) and aided (OR = 3.3; 95%CI: 1.5, 7.3) recall, obesity status (OR = 2.6; 95%CI: 1.3, 5.3), and low income (OR = 5.2; 95%CI: 1.9, 14.3) were positively associated with recall. Additional beliefs were associated with tweens' and parents' recall of the campaign. The association between sex, language, and recall is in line with the branding strategy adopted and no clear evidence for communication inequalities was observed.

  5. MIZOPEX - A UAS Arctic Campaign During Summer 2013

    Science.gov (United States)

    Tschudi, M. A.; Maslanik, J. A.; Emery, W. J.; Palo, S. E.; Bradley, A. C.; Weibel, D.; Zappa, C. J.; Brown, S.; Lawrence, D.; Fladeland, M. M.; Ligon, L.; Elstner, P.; Berthold, R.; Adler, J.

    2014-12-01

    Despite the significance of the marginal ice zones of the Arctic Ocean, basic parameters such as sea surface temperature (SST) and a range of sea ice characteristics are still insufficiently understood in these areas, and especially so during the summer melt period. The Marginal Ice Zone Ocean and Ice Observations and Processes Experiment (MIZOPEX) was conceived to address directly these information gaps through a targeted, intensive observing campaign that would take advantage of the capabilities of multiple classes of UAS combined with in-situ sensing and satellite observations. The MIZOPEX campaign took place during July-August 2013. A total of 24 UAS flights were performed prior to the last field day on 9 August; 2 NASA SIERRA flights, 16 University of Alaska-Fairbanks ScanEagle flights, and 4 CU-Boulder DataHawk flights, for a total of 54 flight hours. Flight operations for all three UAS were based from the active USAF DEW Line station and runway at Oliktok Point, AK. As the ice cover evolved over the July-August period, two separate regions of focus were identified for the UAS flights - a southern region that was within the flying range of the non-Iridium-equipped ScanEagles, and a more northern area where ice concentration was greater. Mapping-type missions were carried out over these locations on multiple days, along with Air-Deployed Micro-Buoy (ADMB) deployment and data uploading.

  6. Miniaturized hyperspectral imager calibration and UAV flight campaigns

    Science.gov (United States)

    Saari, Heikki; Pölönen, Ilkka; Salo, Heikki; Honkavaara, Eija; Hakala, Teemu; Holmlund, Christer; Mäkynen, Jussi; Mannila, Rami; Antila, Tapani; Akujärvi, Altti

    2013-10-01

    VTT Technical Research Centre of Finland has developed Tunable Fabry-Perot Interferometer (FPI) based miniaturized hyperspectral imager which can be operated from light weight Unmanned Aerial Vehicles (UAV). The concept of the hyperspectral imager has been published in the SPIE Proc. 7474, 8174 and 8374. This instrument requires dedicated laboratory and on-board calibration procedures which are described. During summer 2012 extensive UAV Hyperspectral imaging campaigns in the wavelength range 400 - 900 nm at resolution range 10 - 40 nm @ FWHM were performed to study forest inventory, crop biomass and nitrogen distributions and environmental status of natural water applications. The instrument includes spectral band limiting filters which can be used for the on-board wavelength scale calibration by scanning the FPI pass band center wavelength through the low and high edge of the operational wavelength band. The procedure and results of the calibration tests will be presented. A short summary of the performed extensive UAV imaging campaign during summer 2012 will be presented.

  7. Atmospheric CO2 Variability Observed From ASCENDS Flight Campaigns

    Science.gov (United States)

    Lin, Bing; Browell, Edward; Campbell, Joel; Choi, Yonghoon; Dobler, Jeremy; Fan, Tai-Fang; Harrison, F. Wallace; Kooi, Susan; Liu, Zhaoyan; Meadows, Byron; Nehrir, Amin; Obland, Michael; Plant, James; Yang, Melissa

    2015-01-01

    Significant atmospheric CO2 variations on various spatiotemporal scales were observed during ASCENDS flight campaigns. For example, around 10-ppm CO2 changes were found within free troposphere in a region of about 200x300 sq km over Iowa during a summer 2014 flight. Even over extended forests, about 2-ppm CO2 column variability was measured within about 500-km distance. For winter times, especially over snow covered ground, relatively less horizontal CO2 variability was observed, likely owing to minimal interactions between the atmosphere and land surface. Inter-annual variations of CO2 drawdown over cornfields in the Mid-West were found to be larger than 5 ppm due to slight differences in the corn growing phase and meteorological conditions even in the same time period of a year. Furthermore, considerable differences in atmospheric CO2 profiles were found during winter and summer campaigns. In the winter CO2 was found to decrease from about 400 ppm in the atmospheric boundary layer (ABL) to about 392 ppm above 10 km, while in the summer CO2 increased from 386 ppm in the ABL to about 396 ppm in free troposphere. These and other CO2 observations are discussed in this presentation.

  8. An Overview of the 2014 ALMA Long Baseline Campaign

    CERN Document Server

    Partnership, ALMA; Vlahakis, C; Corder, S; Remijan, A; Barkats, D; Lucas, R; Hunter, T R; Brogan, C L; Asaki, Y; Matsushita, S; Dent, W R F; Hills, R E; Phillips, N; Richards, A M S; Cox, P; Amestica, R; Broguiere, D; Cotton, W; Hales, A S; Hiriart, R; Hirota, A; Hodge, J A; Impellizzeri, C M V; Kern, J; Kneissl, R; Liuzzo, E; Marcelino, N; Marson, R; Mignano, A; Nakanishi, K; Nikolic, B; Perez, J E; Pérez, L M; Toledo, I; Aladro, R; Butler, B; Cortes, J; Cortes, P; Dhawan, V; Di Francesco, J; Espada, D; Galarza, F; Garcia-Appadoo, D; Guzman-Ramirez, L; Humphreys, E M; Jung, T; Kameno, S; Laing, R A; Leon, S; Mangum, J; Marconi, G; Nagai, H; Nyman, L -A; Perley, R; Radiszcz, M; Rodón, J A; Sawada, T; Takahashi, S; Tilanus, R P J; van Kempen, T; Vilaro, B Vila; Watson, L C; Wiklind, T; Gueth, F; Tatematsu, K; Wootten, A; Castro-Carrizo, A; Chapillon, E; Dumas, G; de Gregorio-Monsalvo, I; Francke, H; Gallardo, J; Garcia, J; Gonzalez, S; Hibbard, J E; Hill, T; Kaminski, T; Karim, A; Krips, M; Kurono, Y; Lopez, C; Martin, S; Maud, L; Morales, F; Pietu, V; Plarre, K; Schieven, G; Testi, L; Videla, L; Villard, E; Whyborn, N; Zwaan, M A; Alves, F; Andreani, P; Avison, A; Barta, M; Bedosti, F; Bendo, G J; Bertoldi, F; Bethermin, M; Biggs, A; Boissier, J; Brand, J; Burkutean, S; Casasola, V; Conway, J; Cortese, L; Dabrowski, B; Davis, T A; Trigo, M Diaz; Fontani, F; Franco-Hernandez, R; Fuller, G; Madrid, R Galvan; Giannetti, A; Ginsburg, A; Graves, S F; Hatziminaoglou, E; Hogerheijde, M; Jachym, P; Serra, I Jimenez; Karlicky, M; Klaasen, P; Kraus, M; Kunneriath, D; Lagos, C; Longmore, S; Leurini, S; Maercker, M; Magnelli, B; Vidal, I Marti; Massardi, M; Maury, A; Muehle, S; Muller, S; Muxlow, T; O'Gorman, E; Paladino, R; Petry, D; Pineda, J; Randall, S; Richer, J S; Rossetti, A; Rushton, A; Rygl, K; Monge, A Sanchez; Schaaf, R; Schilke, P; Stanke, T; Schmalzl, M; Stoehr, F; Urban, S; van Kampen, E; Vlemmings, W; Wang, K; Wild, W; Yang, Y; Iguchi, S; Hasegawa, T; Saito, M; Inatani, J; Mizuno, N; Asayama, S; Kosugi, G; Morita, K -I; Chiba, K; Kawashima, S; Okumura, S K; Ohashi, N; Ogasawara, R; Sakamoto, S; Noguchi, T; Huang, Y -D; Liu, S -Y; Kemper, F; Koch, P M; Chen, M -T; Chikada, Y; Hiramatsu, M; Iono, D; Shimojo, M; Komugi, S; Kim, J; Lyo, A -R; Muller, E; Herrera, C; Miura, R E; Ueda, J; Chibueze, J; Su, Y -N; Trejo-Cruz, A; Wang, K -S; Kiuchi, H; Ukita, N; Sugimoto, M; Kawabe, R; Hayashi, M; Miyama, S; Ho, P T P; Kaifu, N; Ishiguro, M; Beasley, A J; Bhatnagar, S; Braatz, J A; Brisbin, D G; Brunetti, N; Carilli, C; Crossley, J H; D'Addario, L; Meyer, J L Donovan; Emerson, D T; Evans, A S; Fisher, P; Golap, K; Griffith, D M; Hale, A E; Halstead, D; Hardy, E J; Hatz, M C; Holdaway, M; Indebetouw, R; Jewell, P R; Kepley, A A; Kim, D -C; Lacy, M D; Leroy, A K; Liszt, H S; Lonsdale, C J; Matthews, B; McKinnon, M; Mason, B S; Moellenbrock, G; Moullet, A; Myers, S T; Ott, J; Peck, A B; Pisano, J; Radford, S J E; Randolph, W T; Venkata, U Rao; Rawlings, M; Rosen, R; Schnee, S L; Scott, K S; Sharp, N K; Sheth, K J; Simon, R S; Tsutsumi, T; Wood, S J

    2015-01-01

    A major goal of the Atacama Large Millimeter/submillimeter Array (ALMA) is to make accurate images with resolutions of tens of milliarcseconds, which at submillimeter (submm) wavelengths requires baselines up to ~15 km. To develop and test this capability, a Long Baseline Campaign (LBC) was carried out from September to late November 2014, culminating in end-to-end observations, calibrations, and imaging of selected Science Verification (SV) targets. This paper presents an overview of the campaign and its main results, including an investigation of the short-term coherence properties and systematic phase errors over the long baselines at the ALMA site, a summary of the SV targets and observations, and recommendations for science observing strategies at long baselines. Deep ALMA images of the quasar 3C138 at 97 and 241 GHz are also compared to VLA 43 GHz results, demonstrating an agreement at a level of a few percent. As a result of the extensive program of LBC testing, the highly successful SV imaging at long...

  9. ARM Cloud-Aerosol-Precipitation Experiment (ACAPEX) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Leung, L Ruby [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-03-01

    The U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility’s ARM Cloud-Aerosol-Precipitation Experiment (ACAPEX) field campaign contributes to CalWater 2015, a multi-agency field campaign that aims to improve understanding of atmospheric rivers and aerosol sources and transport that influence cloud and precipitation processes. The ultimate goal is to reduce uncertainties in weather predictions and climate projections of droughts and floods in California. With the DOE G-1 aircraft and ARM Mobile Facility 2 (AMF2) well equipped for making aerosol and cloud measurements, ACAPEX focuses specifically on understanding how aerosols from local pollution and long-range transport affect the amount and phase of precipitation associated with atmospheric rivers. ACAPEX took place between January 12, 2015 and March 8, 2015 as part of CalWater 2015, which included four aircraft (DOE G-1, National Oceanic and Atmospheric Administration [NOAA] G-IV and P-3, and National Aeronautics and Space Administration [NASA] ER-2), the NOAA research ship Ron Brown, carrying onboard the AMF2, National Science Foundation (NSF)-sponsored aerosol and precipitation measurements at Bodega Bay, and the California Department of Water Resources extreme precipitation network.

  10. Nacelle lidar for power curve measurement - Avedoere campaign

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, R.; Davoust, S.

    2013-01-15

    Wind turbine power performance requires the measurement of the free wind speed at hub height upstream of the turbine. For modern multi-megawatt wind turbines, this means that the wind speed needs to be measured at great heights, from 80m to 150m. The standard wind speed measurement with a cup anemometer, requiring the erection of a tall met mast, then becomes more and more challenging and expensive. A forward looking lidar, mounted on the turbine nacelle, combines the advantages of a nacelle based instrument - no mast/platform installation difficulties - and those of the lidar technology - remote measurement of the wind speed away from the instrument. In the first phase of the EUDP project: ''Nacelle lidar for power performance measurement'', a measurement campaign with a nacelle lidar prototype placed on an onshore turbine demonstrated the potential of the technology for power curve measurement. The main deviations of this method to the requirement of the IEC 61400-12-1 were identified and a procedure was established for the use of a nacelle lidar specifically for power curve measurement. This report describes the results of a second measurement campaign aiming at testing and finalising the procedure. (Author)

  11. Radio Monitoring Campaigns of Six Strongly Lensed Quasars

    CERN Document Server

    Rumbaugh, N; McKean, J P; Koopmans, L V E; Auger, M W; Suyu, S H

    2014-01-01

    We observed six strongly lensed, radio-loud quasars (MG 0414+0534, CLASS B0712+472, JVAS B1030+074, CLASS B1127+385, CLASS B1152+199, and JVAS B1938+666) in order to identify systems suitable for measuring cosmological parameters using time delays between their multiple images. These systems are in standard two and four image configurations, with B1938 having a faint secondary pair of images. Two separate monitoring campaigns were carried out using the VLA and upgraded JVLA. Lightcurves were extracted for each individual lensed image and analyzed for signs of intrinsic variability. While it was not possible to measure time delays from these data, $\\chi^2$-based and structure function tests found evidence for variability in a majority of the lightcurves. B0712 and B1030 had particularly strong variations, exhibiting linear flux trends. These results show that most of these systems should be targeted with followup monitoring campaigns, especially B0712 and B1030.

  12. THE 2014 ALMA LONG BASELINE CAMPAIGN: AN OVERVIEW

    Energy Technology Data Exchange (ETDEWEB)

    Partnership, ALMA [Astrophysics Research Institute, Liverpool John Moores University, IC2, Liverpool Science Park, 146 Brownlow Hill, Liverpool L3 5RF (United Kingdom); Fomalont, E. B.; Vlahakis, C.; Corder, S.; Remijan, A.; Barkats, D.; Dent, W. R. F.; Phillips, N.; Cox, P.; Hales, A. S. [Joint ALMA Observatory, Alonso de Córdova 3107, Vitacura, Santiago (Chile); Lucas, R. [Institut de Planétologie et d’Astrophysique de Grenoble (UMR 5274), BP 53, F-38041 Grenoble Cedex 9 (France); Hunter, T. R.; Brogan, C. L.; Amestica, R.; Cotton, W. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Asaki, Y. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Matsushita, S. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 106, Taiwan (China); Hills, R. E. [Astrophysics Group, Cavendish Laboratory, JJ Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Richards, A. M. S. [Jodrell Bank Centre for Astrophysics, School of Physics and Astronomy, University of Manchester, Oxford Road, Manchester M13 9PL (United Kingdom); Broguiere, D., E-mail: efomalon@nrao.edu [Institut de Radioastronomie Millime´trique (IRAM), 300 rue de la Piscine, Domaine Universitaire, F-38406 Saint Martin d’Hères (France); and others

    2015-07-20

    A major goal of the Atacama Large Millimeter/submillimeter Array (ALMA) is to make accurate images with resolutions of tens of milliarcseconds, which at submillimeter (submm) wavelengths requires baselines up to ∼15 km. To develop and test this capability, a Long Baseline Campaign (LBC) was carried out from 2014 September to late November, culminating in end-to-end observations, calibrations, and imaging of selected Science Verification (SV) targets. This paper presents an overview of the campaign and its main results, including an investigation of the short-term coherence properties and systematic phase errors over the long baselines at the ALMA site, a summary of the SV targets and observations, and recommendations for science observing strategies at long baselines. Deep ALMA images of the quasar 3C 138 at 97 and 241 GHz are also compared to VLA 43 GHz results, demonstrating an agreement at a level of a few percent. As a result of the extensive program of LBC testing, the highly successful SV imaging at long baselines achieved angular resolutions as fine as 19 mas at ∼350 GHz. Observing with ALMA on baselines of up to 15 km is now possible, and opens up new parameter space for submm astronomy.

  13. Campaigning against female genital mutilation in Ethiopia using popular education.

    Science.gov (United States)

    Spadacini, B; Nichols, P

    1998-07-01

    In Ethiopia, the Italian Association for Women in Development (AIDOS) has been working with Ethiopia's National Committee on Traditional Practices Affecting the Health of Women and Children for 5 years. AIDOS began working on female genital mutilation in the early 1980s and rejects charges of cultural imperialism that are applied to Northern organizations attempting to help African organizations address this violation of universal human rights. In Ethiopia, 85% of women are mutilated, with most undergoing Sunna, or removal of the prepuce of the clitoris. The joint project seeks to increase awareness about the health consequences of female genital mutilation in the target group. The primary technique used is provision of training of trainers courses and presentation of four modular units and audiovisual materials specifically designed for use with socially influential women, male and female secondary school students, community leaders, and health workers. In addition, an information/education campaign uses videos and sound and slide shows with accompanying story books. A second category of communication tools was developed for a mass information campaign, including radio spots, posters, information leaflets, and a newsletter. When the project was ready for expansion into the southern region of the country, it became clear that a new participatory communication strategy was required to stimulate discussion, such as the use of role playing and theater. Working together, the two organizations have successfully confronted project constraints such as the difficulty in assessing project impact, scheduling problems, and gender-biased assess to information.

  14. Laser Ceilometer CL51 Demonstration Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Morris, Victor [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Winston, Herb A. [Vaisala, Inc., Vantaa (Finland)

    2016-05-01

    Improvements in the measurements of clouds and the ability to support observation systems are critically important to advancing our understanding and improving global climate model performance. The purpose of a demonstration of the Vaisala CL51 ceilometer was to evaluate its high-range capabilities as a possible augmentation to data provided by the CL31 ceilometer that currently is deployed at U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility sites. Vaisala performed a no-cost demonstration of the equipment; Pacific Northwest National Laboratory (PNNL) supported the data analysis; and ARM provided logistical support, power, maintenance, etc. The laser ceilometer provided measurements of cloud-base height, vertical visibility, and backscatter profile at a vertical range of 15 km. The ceilometer demonstration was conducted during the Characterization of Cirrus and Aerosol Properties campaign (CCAP) to provide coincident observations of cirrus cloud heights and potential backscatter signals by aerosols. This campaign included deployment of a CL51 ceilometer at the ARM Facility’s Southern Great Plains (SGP) site, co-located with the current CL31, micropulse lidar, and balloon-borne sounding system. Data collected from these sensors were analyzed to compare and contrast the data from the CL51 ceilometer.

  15. Aerosol Properties Downwind of Biomass Burns Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Buseck, Peter R [Arizona State Univ., Tempe, AZ (United States)

    2016-04-01

    We determined the morphological, chemical, and thermal properties of aerosol particles generated by biomass burning during the Biomass Burning Observation Project (BBOP) campaign during the wildland fire season in the Pacific Northwest from July to mid-September, 2013, and in October, 2013 from prescribed agricultural burns in the lower Mississippi River Valley. BBOP was a field campaign of the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility. The morphological information was both two-dimensional, as is typical of most microscopy images and that have many of the characteristic of shadows in that they lack depth data, and three-dimensional (3D). The electron tomographic measurements will provided 3D data, including the presence and nature of pores and interstices, and whether the individual particles are coated by or embedded within other materials. These microphysical properties were determined for particles as a function of time and distance from the respective sources in order to obtain detailed information regarding the time evolution of changes during aging.

  16. Power Systems Development Facility Gasification Test Campaign TC17

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services

    2004-11-30

    In support of technology development to utilize coal for efficient, affordable, and environmentally clean power generation, the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama, routinely demonstrates gasification technologies using various types of coals. The PSDF is an engineering scale demonstration of key features of advanced coal-fired power systems, including a KBR (formerly Kellogg Brown & Root) Transport Gasifier, a hot gas particulate control device, advanced syngas cleanup systems, and high-pressure solids handling systems. This report summarizes the results gasification operation with Illinois Basin bituminous coal in PSDF test campaign TC17. The test campaign was completed from October 25, 2004, to November 18, 2004. System startup and initial operation was accomplished with Powder River Basin (PRB) subbituminous coal, and then the system was transitioned to Illinois Basin coal operation. The major objective for this test was to evaluate the PSDF gasification process operational stability and performance using the Illinois Basin coal. The Transport Gasifier train was operated for 92 hours using PRB coal and for 221 hours using Illinois Basin coal.

  17. SS 433: Results of a Recent Multi-wavelength Campaign

    CERN Document Server

    Chakrabarti, S K; Pal, S; Mondal, S A; Nandi, A; Bhattacharya, A; Mandal, S; Sagar, R; Pandey, J C; Pati, A; Saha, S K; Chakrabarti, Sandip K.; Mondal, Soumen; Mandal, Samir; Sagar, Ram

    2005-01-01

    We conducted a multi-wavelength campaign in September-October, 2002, to observe SS 433. We used 45 meter sized 30 dishes of Giant Meter Radio Telescope (GMRT) for radio observation, 1.2 meter Physical Research Laboratory Infra-red telescope at Mt Abu for IR, 1 meter Telescope at the State Observatory, Nainital for Optical photometry, 2.3 meter optical telescope at the Vainu Bappu observatory for spectrum and Rossi X-ray Timing Explorer (RXTE) Target of Opportunity (TOO) observation for X-ray observations. We find sharp variations in intensity in time-scales of a few minutes in X-rays, IR and radio wavelengths. Differential photometry at the IR observation clearly indicated significant intrinsic variations in short time scales of minutes throughout the campaign. Combining results of these wavelengths, we find a signature of delay of about two days between IR and Radio. The X-ray spectrum yielded double Fe line profiles which corresponded to red and blue components of the relativistic jet. We also present the b...

  18. Carbonyl Sulfide for Tracing Carbon Fluxes Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, J. Elliott [Univ. of California, Merced, CA (United States); Berry, Joseph A. [Carnegie Inst. of Science, Stanford, CA (United States); Billesbach, Dave [Univ. of Nebraska, Lincoln, NE (United States); Torn, Margaret S [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Zahniser, Mark [Aerodyne Research, Inc., Billerica, MA (United States); Seibt, Ulrike [Univ. of California, Los Angeles, CA (United States); Maseyk, Kadmiel [Pierre and Marie Curie Univ., Paris (France)

    2016-04-01

    The April-June 2012 campaign was located at the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains (SGP) site Central Facility and had three purposes. One goal was to demonstrate the ability of current instrumentation to correctly measure fluxes of atmospheric carbonyl sulfide (COS). The approach has been describe previously as a critical approach to advancing carbon cycle science1,2, but requires further investigation at the canopy scale to resolve ecosystem processes. Previous canopy-scale efforts were limited to data rates of 1Hz. While 1 Hz measurements may work in a few ecosystems, it is widely accepted that data rates of 10 to 20 Hz are needed to fully capture the exchange of traces gases between the atmosphere and vegetative canopy. A second goal of this campaign was to determine if canopy observations could provide information to help interpret the seasonal double peak in airborne observations at SGP of CO2 and COS mixing ratios. A third goal was to detect potential sources and sinks of COS that must be resolved before using COS as a tracer of gross primary productivity (GPP).

  19. First results from the CAWSES-India Tidal Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Gurubaran, S. [Indian Inst. of Geomagnetism, Tirunelveli (India). Equatorial Geophysical Research Lab.; Narayana Rao, D.; Ramkumar, T.K. [National Atmospheric Research Lab., Gadanki (India); Ramkumar, G. [Vikram Sarabhai Space Centre, Thiruvananthapuram (India). Space Physics Lab.; Dutta, G. [Anwarul-uloom College, Hyderabad (India); Krishna Murthy, B.V.

    2008-07-01

    The first CAWSES-India Tidal Campaign was conducted by the Indian scientific community during March-April 2006. The objectives of this campaign were: (1) To determine the characteristics of tides in the troposphere and lower stratosphere (0-20 km) and mesosphere and lower thermosphere (MLT) region (80-100 km), (2) to explore and identify what lower atmospheric processes drive middle atmospheric tides in the Indian continental region and (3) to provide information on those short-term variabilities of MLT tides that are likely to have an impact on the ionospheric variabilities and contribute to the upper atmospheric weather. Data sets from experiments conducted at the three low latitude radar sites, namely, Trivandrum (8.5 N, 76.9 E), Tirunelveli (8.7 N, 77.8 E) and Gadanki (13.5 N, 79.2 E) and fortnightly rocket launches from Thumba were made use of in this study. An important observational finding reported in this work is that the radar observations at Tirunelveli/Trivandrum indicate the presence of 15-20 day modulation of diurnal tide activity at MLT heights during the February-March period. A similar variation in the OLR fields in the western Pacific (120-160 longitude region) suggests a possible link between the observed tidal variabilities and the variations in the deep tropical convection through the nonmigrating tides it generates. (orig.)

  20. Second SNPP Cal/Val campaign: environmental data retrieval analysis

    Science.gov (United States)

    Zhou, Daniel K.; Larar, Allen M.; Liu, Xu; Tian, Jialin; Smith, William L.; Kizer, Susan H.; Goldberg, Mitch D.

    2016-05-01

    Satellite ultraspectral infrared sensors provide key data records essential for weather forecasting and climate change science. The Suomi National Polar-orbiting Partnership (Soumi NPP) satellite Environmental Data Records (EDRs) are retrieved from calibrated ultraspectral radiance or Sensor Data Records (SDRs). Understanding the accuracy of retrieved EDRs is critical. The second Suomi NPP Calibration/Validation field campaign was conducted during March 2015 with flights over Greenland. The NASA high-altitude ER-2 aircraft carrying ultraspectral interferometer sounders such as the National Airborne Sounder Testbed-Interferometer (NAST-I) flew under the Suomi NPP satellite that carries the Crosstrack Infrared Sounder (CrIS) and the Advanced Technology Microwave Sounder (ATMS). Herein we inter-compare the EDRs produced from different retrieval algorithms employed on these satellite and aircraft campaign data. The available radiosonde measurements together with the European Centre for Medium-Range Weather Forecasts (ECMWF) analyses are used to assess atmospheric temperature and moisture retrievals from the aircraft and satellite platforms. Preliminary results of this experiment under a winter, Arctic environment are presented.

  1. The tree-felling campaign has to continue

    CERN Multimedia

    2013-01-01

    The tree-felling campaign that began in 2010 continued last winter, as we reported in our article of 4 March 2013 (see here). While safety concerns* are the main driver, the campaign will also allow a coherent landscaping plan to be implemented.   The areas where trees have already been felled are currently being redesigned, and replanting is scheduled to begin in 2014. CERN has initiated a study in collaboration with the Geneva nature and countryside directorate (Direction générale de la nature et du paysage, DGNP) with a view to drawing up a master plan covering all the green spaces on the Meyrin site. The aim of the study is to understand the landscaping issues at stake and to define a comprehensive redevelopment and landscaping programme for the whole site. In this framework, the areas where trees have been cut down since 2010 will be replanted. The study will also allow CERN to identify the areas that need to be redeveloped as a priority and to establish how this can be ...

  2. Stop the sores: the making and evaluation of a successful social marketing campaign.

    Science.gov (United States)

    Plant, Aaron; Montoya, Jorge A; Rotblatt, Harlan; Kerndt, Peter R; Mall, Karen L; Pappas, Les G; Kent, Charlotte K; Klausner, Jeffrey D

    2010-01-01

    Los Angeles County has experienced a rapid increase in early syphilis among men who have sex with men (MSM) in recent years, with the number of cases rising from 126 in 2000 to 809 in 2005. As part of the public health response to this outbreak, a sustained social marketing campaign was launched in 2002, with the objectives of increasing syphilis testing, knowledge, and awareness among MSM in Los Angeles. This campaign, as implemented, exemplified key principles of social marketing, including market research, audience segmentation, and branding. A cross-sectional study conducted in 2004 to evaluate the campaign found that those MSM who were aware of the campaign were nearly twice as likely to have tested for syphilis in the past 6 months as those MSM who were not aware of the campaign. Those MSM who were aware of the campaign also had more syphilis awareness and knowledge in key areas.

  3. Reduced All-Cause Child Mortality After General Measles Vaccination Campaign in Rural Guinea-Bissau

    DEFF Research Database (Denmark)

    Fisker, Ane Bærent; Rodrigues, Amabelia; Martins, Cesario

    2015-01-01

    BACKGROUND: Randomised trials have shown that measles vaccine (MV) prevents non-measles deaths. MV-campaigns are conducted to eliminate measles infection.The overall mortality effect of MV-campaigns has not been studied. METHODS: Bandim Health Project (BHP) surveys children aged 0-4 years in rural...... Guinea-Bissau through a health and demographic surveillance system. A nationalMV-campaign in 2006 targeted children aged 6 months-15 years. In a Cox proportional-hazards model with age as underlying time-scale we compared mortality for children aged 6-59 months after the campaign with mortality...... in the same age group during the two previous years. RESULTS: 8158 children aged 6-59 months were under BHP surveillance during the 2006-campaign and 7999 and 8108 during similar periods in 2004 and 2005. At least 90% of the eligible children received MV in the campaign. There were 161 non-accident deaths...

  4. Analysis of Social Marketing for Anti-corruption Campaign: Case study of Film Kita versus Korupsi

    Directory of Open Access Journals (Sweden)

    Rosidah

    2012-03-01

    Full Text Available The paper aims to explain the application of commercial marketing theory in a social marketing campaign. This study derives from secondary sources have been conducted, including previous researchers and published articles. The writer finds what the theory of marketing mix has been used to study the film proposition. Furthermore, another P, namely Partnership, and segmentation has also been added to the campaign. The marketer has applied the commercial marketing approach in the film, as one of the campaigns for anticorruption in Indonesia, to ensure that the campaign will be effectively delivered for the target audience. This finding can serve as a guideline for best practices in social marketing campaign for other sector or mission. In addition, the paper doesn't aim to evaluate the effectiveness of the film as a social marketing campaign. It just wants to analyze the application of commercial sector marketing that applied in the film.

  5. Appealing to the crowd: ethical justifications in Canadian medical crowdfunding campaigns.

    Science.gov (United States)

    Snyder, Jeremy; Crooks, Valorie A; Mathers, Annalise; Chow-White, Peter

    2017-01-30

    Medical crowdfunding is growing in terms of the number of active campaigns, amount of funding raised and public visibility. Little is known about how campaigners appeal to potential donors outside of anecdotal evidence collected in news reports on specific medical crowdfunding campaigns. This paper offers a first step towards addressing this knowledge gap by examining medical crowdfunding campaigns for Canadian recipients. Using 80 medical crowdfunding campaigns for Canadian recipients, we analyse how Canadians justify to others that they ought to contribute to funding their health needs. We find the justifications campaigners tend to fall into three themes: personal connections, depth of need and giving back. We further discuss how these appeals can understood in terms of ethical justifications for giving and how these justifications should be assessed in light of the academic literature on ethical concerns raised by medical crowdfunding.

  6. An Analysis of Oral Health Campaigns from a Social Marketing Perspective

    OpenAIRE

    MUMCU, KÖKSAL, ŞİŞMAN, Gonca, Leyla, Nur

    2014-01-01

    Objective: The aim of this study is to analyse oral health campaigns according to their use of social marketing in Turkey. Method: 35 oral health campaigns regarding oral health were assessed according to social marketing principles including message, target group, aim, communication strategies and tactics, and mass media tools.Results: The prominent aims of the campaigns were to facilitate awareness of oral health (24.5%, n=12), oral examination (26.5%, n=13), preventative oral healthcare an...

  7. A campaign to convey the scientific consensus about human-caused climate change: rationale, formative research, and campaign overview. (Invited)

    Science.gov (United States)

    Maibach, E.; Leiserowitz, A.; Gould, R.

    2013-12-01

    Large numbers of Americans mistakenly believe that there is disagreement among the experts about the reality of climate change. For example, in our nationally representative survey conducted in April 2013, only 42% of respondents reported 'most scientists think global warming is happening;' conversely, 33% reported 'there is a lot of disagreement among scientists about whether or not global warming is happening,' and an additional 20% responded they 'don't know enough to say.' Our research has also shown that this common misperception is highly consequential: people who misunderstand the scientific consensus are less convinced that climate change is occurring, is human-caused, serious, and solvable; they are also less likely to support societal responses to address the problem. In this paper, we will present the results of a series of randomized controlled message experiments conducted to determine the most effective means of conveying the extent of the scientific consensus about human-caused climate change. The variables tested include quantitative vs. qualitative consensus descriptions, more vs. less precise descriptions, contextualizing metaphors, graphical representations, and explanations regarding why people may have developed a misperception. The findings from this formative research are being used to create a communication campaign that will be launched in fall 2013 by a leading American scientific society prior to the AGU Annual Meeting. A full description of the campaign will be presented.

  8. How do Major, Violent and Nonviolent Opposition Campaigns, Impact Predicted Life Expectancy at birth?

    Directory of Open Access Journals (Sweden)

    Judith Stoddard

    2013-08-01

    Full Text Available This study compared the effects of major violent and nonviolent opposition campaigns for regime change, on predicted life expectancy at birth. The study measured life expectancy five and ten years after the campaign ended, so that deaths which occurred during the campaign would not be included in the metric, and thus enabling the study of changes made in the state on the social determinants affecting longevity, after the campaign was over. Life expectancy is one of the best reported World Development Indicators and is considered to be a good indication of the overall health and general living conditions of the state and therefore is an ideal indicator to reflect the changes made in the state following a major campaign. The results of this analysis showed that states have a hard time recovering from a major opposition campaign and initially drop behind the growth trend in the world average for predicted life expectancy at birth. But, the type of campaign that was waged and whether it was successful, greatly affects the state’s ability to recover. Encouragingly by a decade after the campaign ends, states that experienced a nonviolent campaign that was successful had caught up to the world average and inched ahead of it. This shows that on this important development indicator, new governments that were ushered into power by nonviolent social movements, had made positive changes in the state that enabled it to surpass world averages.

  9. Catalyzing community action within a national campaign: VERB community and national partnerships.

    Science.gov (United States)

    Bretthauer-Mueller, Rosemary; Berkowitz, Judy M; Thomas, Melonie; McCarthy, Susan; Green, Lula Anna; Melancon, Heidi; Courtney, Anita H; Bryant, Carol A; Dodge, Kristin

    2008-06-01

    The VERB campaign used a social marketing approach to deliver its message through the mass media, school and community promotions, and partnerships to encourage children aged 9-13 years (tweens) to be physically active every day. This paper presents the VERB campaign's community and national partnership strategy, highlights three successful partnerships, and discusses challenges associated with the efforts. The national advertising generated awareness of and affinity for the product's brand and motivated the primary audience to seek out the product. The campaign's national and community partners were engaged to facilitate a product-distribution channel. The campaign developed a three-pronged partnership strategy to integrate the promotion with the placement of the campaign's product (physical activity): (1) reframe the way physical activity is positioned and delivered; (2) connect the brand to the point-of-purchase; and (3) refer (or drive) the audience to the action outlets, opportunities, places, spaces and programs to purchase the product. The VERB campaign provided partners with marketing training and resources to assist them as they leveraged tweens' brand awareness and supported regular physical activity among tweens. The method of technical assistance and the types of marketing tools were provided in relationship to four characteristics of the partner: (1) partner's network, (2) leaders and champions in the network, (3) partner's financial resources for community campaigns; and (4) partner's understanding of the marketing mindset. Coordinated, collaborative, and strong mass-media and community-based interventions within a national social marketing campaign can sustain the immediate effects of such campaigns.

  10. Applying Quantitative Approaches to the Formative Evaluation of Antismoking Campaign Messages.

    Science.gov (United States)

    Parvanta, Sarah; Gibson, Laura; Forquer, Heather; Shapiro-Luft, Dina; Dean, Lorraine; Freres, Derek; Lerman, Caryn; Mallya, Giridhar; Moldovan-Johnson, Mihaela; Tan, Andy; Cappella, Joseph; Hornik, Robert

    2013-12-01

    This article shares an in-depth summary of a formative evaluation that used quantitative data to inform the development and selection of promotional ads for the antismoking communication component of a social marketing campaign. A foundational survey provided cross-sectional data to identify beliefs about quitting smoking that campaign messages should target, as well as beliefs to avoid. Pretesting draft ads against quantitative indicators of message effectiveness further facilitated the selection and rejection of final campaign ads. Finally, we consider lessons learned from the process of balancing quantitative methods and judgment to make formative decisions about more and less promising persuasive messages for campaigns.

  11. Human rights from the grassroots up: Vermont's campaign for universal health care.

    Science.gov (United States)

    McGill, Mariah

    2012-06-15

    In 2008, the Vermont Workers' Center launched the "Healthcare Is a Human Right Campaign," a grassroots campaign to secure the creation of a universal health care system in Vermont. Campaign organizers used a human rights framework to mobilize thousands of voters in support of universal health care. In response to this extraordinary grassroots effort, the state legislature passed health care legislation that incorporates human rights principles into Vermont law and provides a framework for universal health care. The United States has often lagged behind other nations in recognizing economic, social, and cultural (ESC) rights, including the right to health. Nonetheless, activists have begun to incorporate ESC rights into domestic advocacy campaigns, and state and local governments are beginning to respond where the federal government has not. Vermont serves as a powerful example of how a human rights framework can inform health care policy and inspire grassroots campaigns in the United States. This three-part article documents the Vermont Workers' Center campaign and discusses the impact that human rights activity at the grassroots level may have on attitudes towards ESC rights in the United States. The first part describes the Vermont health care crisis and explains why the center adopted international human rights principles for their campaign. The article then goes on to discuss the three-year campaign and analyze the health care reform bill that the Vermont legislature passed. Finally, the article discusses the campaign's local and national impact.

  12. Lidar Inter-Comparison Exercise Final Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Protat, A [Australian Bureau of Meterology; Young, S

    2015-02-01

    The objective of this field campaign was to evaluate the performance of the new Leosphere R-MAN 510 lidar, procured by the Australian Bureau of Meteorology, by testing it against the MicroPulse Lidar (MPL) and Raman lidars, at the Darwin Atmospheric Radiation Measurement (ARM) site. This lidar is an eye-safe (355 nm), turn-key mini Raman lidar, which allows for the detection of aerosols and cloud properties, and the retrieval of particulate extinction profiles. To accomplish this evaluation, the R-MAN 510 lidar has been operated at the Darwin ARM site, next to the MPL, Raman lidar, and Vaisala ceilometer (VCEIL) for three months (from 20 January 2013 to 20 April 2013) in order to collect a sufficient sample size for statistical comparisons.

  13. Negative election campaign – violence in political communication?

    Directory of Open Access Journals (Sweden)

    Ionela Carmen Boșoteanu

    2011-10-01

    Full Text Available Today, at the beginning of the XXIst century, politics has come to display itself, under all its forms, in front of a mass public through communication media, within the daily exercise of democracy practice. All of the political actors admit that one of the main conditions for having a successful intervention in public debate, in making decisions is to understand the way communication and media work. The growing immixture of communication mass media in the political arena, as well as the tendency to propagate politics – a show with more and more violent and aggressive acts, in absence of arguments, the way political parties and politicians use public relations, marketing and advertising techniques in elections campaigns testify to the political fervour and degradation of political speech.

  14. Phase closure nulling: results from the 2009 campaign

    Science.gov (United States)

    Duvert, Gilles; Malbet, Fabien; Chelli, Alain; Millan-Gabet, Rafael; Monnier, John D.; Schaefer, Gail H.

    2010-07-01

    We present here a new observational technique, Phase Closure Nulling (PCN), which has the potential to obtain very high contrast detection and spectroscopy of faint companions to bright stars. PCN consists in measuring closure phases of fully resolved objects with a baseline triplet where one of the baselines crosses a null of the object visibility function. For scenes dominated by the presence of a stellar disk, the correlated flux of the star around nulls is essentially canceled out, and in these regions the signature of fainter, unresolved, scene object(s) dominates the imaginary part of the visibility in particular the closure phase. We present here the basics of the PCN method, the initial proof-of-concept observation, the envisioned science cases and report about the first observing campaign made on VLTI/AMBER and CHARA/MIRC using this technique.

  15. Phase Closure Nulling: results from the 2009 campaign

    CERN Document Server

    Duvert, Gilles; Chelli, Alain; Millan-Gabet, Rafael; Monnier, John D; Schaefer, Gail H

    2010-01-01

    We present here a new observational technique, Phase Closure Nulling (PCN), which has the potential to obtain very high contrast detection and spectroscopy of faint companions to bright stars. PCN consists in measuring closure phases of fully resolved objects with a baseline triplet where one of the baselines crosses a null of the object visibility function. For scenes dominated by the presence of a stellar disk, the correlated flux of the star around nulls is essentially canceled out, and in these regions the signature of fainter, unresolved, scene object(s) dominates the imaginary part of the visibility in particular the closure phase. We present here the basics of the PCN method, the initial proof-of-concept observation, the envisioned science cases and report about the first observing campaign made on VLTI/AMBER and CHARA/MIRC using this technique.

  16. Communication Strategy of a successful Frack Campaign in the Netherlands

    Science.gov (United States)

    Hoogerduijn Strating, Eilard; Seinen, Chiel; Heeringa, Henk; Pestman, Bart

    2016-04-01

    In 2011, after several years without frack activities onshore in the Netherlands, a new conventional frack campaign was planned. In the interim, anti-shalegas sentiments had carried over from the US to Europe and various countries had announced a frack moratorium. The Netherlands was not amongst these yet, but it was recognized that starting a new conventional frack campaign could potentially result in a significant negative public sentiment and affect our License to Operate. A team of subsurface and communication experts drafted a communication strategy that was premised on the "Discuss > Decide > Deliver" philosophy, implying that a decision on the campaign-start would only be taken after the results of the engagements with key stakeholders indicated sufficient support. It was recognized that in order to start communication with stakeholders and the general public through engagements, infographics, websites etc., several minimum requirements had to be in place: 1] An explanation about why fracking is done and what it entails 2] An assessment and description of the risks (eg groundwater contamination, tremors) 3] A description of the REACH compliant chemicals used (composition & quantities). With the basic info in place, a staged engagement process was set up where key stakeholders at the national level were informed first, followed by those at regional level (including waterboards), followed by local stakeholders. Several "Go-No go" decision points were build in. Throughout it was agreed that a target date for the actual frack campaign was only to be set once local engagements were going to start. Several of the technical staff (eg subsurface and well engineers) received media and communication training to prep them for the engagements with external stakeholders and communities. Also several staff were identified that would be involved in the writing of Q&A's, external bulletins etc. Having technical staff involved in such communications helped build credibility

  17. ACME-III and ACME-IV Final Campaign Reports

    Energy Technology Data Exchange (ETDEWEB)

    Biraud, S. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2016-01-01

    The goals of the Atmospheric Radiation Measurement (ARM) Climate Research Facility’s third and fourth Airborne Carbon Measurements (ACME) field campaigns, ACME-III and ACME-IV, are: 1) to measure and model the exchange of CO2, water vapor, and other greenhouse gases by the natural, agricultural, and industrial ecosystems of the Southern Great Plains (SGP) region; 2) to develop quantitative approaches to relate these local fluxes to the concentration of greenhouse gases measured at the Central Facility tower and in the atmospheric column above the ARM SGP Central Facility, 3) to develop and test bottom-up measurement and modeling approaches to estimate regional scale carbon balances, and 4) to develop and test inverse modeling approaches to estimate regional scale carbon balance and anthropogenic sources over continental regions. Regular soundings of the atmosphere from near the surface into the mid-troposphere are essential for this research.

  18. The Multifrequency Campaign on 3C 279 in January 2006

    CERN Document Server

    Collmar, W; Krichbaum, T P; Agudo, I; Bottacini, E; Bremer, M; Burwitz, V; Cuccchiara, A; Grupe, D; Gurwell, M

    2010-01-01

    We present the results of a multifrequency campaign from radio to hard X-ray energies on the blazar 3C 279 during an optical high-state in January 2006. We give the observational results (multifrequency light curves and spectra) and compile an SED. This complements an SED from an optical low-state in June 2003. Surprisingly the two SEDs differ only in their high-energy synchrotron emission (near-IR - UV), while the low-energy inverse-Compton emission (X- to Gamma-rays) remained unchanged. By interpreting with a steady-state leptonic emission model, the variability among the SED can be reproduced by a change solely of the low-energy cutoff of the relativistic electron distribution. In an internal shock model for blazar emission, such a change could e.g. achieved through a varying relative Lorentz factor of colliding shells producing internal shocks in the jet.

  19. Public funding of political parties when campaigns are informative

    DEFF Research Database (Denmark)

    Ortín, Ignacio Ortuño; Schultz, Christian

    The paper considers public funding of political parties when some voters are poorly informed about parties’ candidates and campaigns are informative. For symmetric equilibria, it is shown that more pub- lic funding leads parties to chose more moderate candidates, and that an increase in the funding’s...... dependence on vote shares induces fur- ther moderation and improves welfare. If parties are asymmetric, vote share dependent public funding bene…ts the large party and makes it moderate its candidate, while the smaller party reacts by choosing a more extremist candidate. On balance, however, if the parties...... are not too asymmetric, an increase in vote share dependent funding improves welfare and increases the likelihood that a moderate candidate wins the election...

  20. Plasma phenomena observed in the MAP-WINE campaign

    Science.gov (United States)

    Friedrich, M.

    The wealth of plasma data gathered in the MAP-WINE campaign allows insight into the generation and morphology of electron densities on a large scale, and the nature of the ions on a small scale. The associated measurements of winds and charged particles help to understand the morphology of the mid-latitude ionisation which turns out to correlate poorly with geomagnetic activity, but at least slightly with the prevailing winds. A somewhat clearer connection seems to exist between stratospheric warmings and radio wave absorption minima. On the local scale the interpretation of the rocket measurements of positive ions was helped by simultaneous observations of temperatures and atomic oxygen. The relevance of the description ``winter anomaly'' for high latitude electron density profiles will be examined.

  1. A Radio SETI Campaign for microsec-sec Periodic Signals

    CERN Document Server

    Harp, G R; Astorga, Alfredo; Arbunich, Jack; Hightower, Kristin; Meitzner, Seth; Barott, W C; Nolan, Michael C; Messerschmitt, D G; Vakoch, Douglas A; Shostak, Seth; Tarter, J C

    2015-01-01

    We report a novel radio autocorrelation (AC) search for extraterrestrial intelligence (SETI). For selected frequencies across the terrestrial microwave window (1-10 GHz) observations were conducted at the Allen Telescope Array to identify artificial non-sinusoidal periodic signals with radio bandwidths greater than 1 kHz, which are capable of carrying substantial messages with symbol-rates from 10-10e6 Hz. Out of 243 observations, about half (101) were directed toward sources with known continuum flux greater than 1 Jy (quasars, pulsars, supernova remnants and masers), based on the hypothesis that they might harbor heretofore undiscovered natural or artificial, repetitive, phase or frequency modulation. The rest of the targets were mostly toward exoplanet stars and similarly interesting targets from the standpoint of SETI. This campaign rules out several previously untested hypotheses relating to the number of artificially modulated "natural" sources. Since we are using a phase sensitive detector, these obser...

  2. Recent ProAm Campaigns: Be stars, COROT and others

    CERN Document Server

    Ribeiro, José

    2011-01-01

    The ProAm effort in modern astronomy and astrophysics is now a reality. The achievements of amateur astronomers throughout the early history of astronomy are well known. However, during the 20th century, the high specialisation and the technology required for dealing with the astronomical issues of that epoch, forced a natural separation of the professional activities from the amateur ones. Nowadays, technology has become much cheaper. Amateur astronomers have equipment capable of producing scientific results within their reach. Good equipment pushes some amateur astronomers to learn more, recovering their dialog with professionals. ProAm activities may be fruitful in data mining, in database feeding, in long-term campaigns and even in casual observations.

  3. The NAME 2004 Field Campaign and Modeling Strategy.

    Science.gov (United States)

    Higgins, Wayne; Ahijevych, Dave; Amador, Jorge; Barros, Ana; Berbery, E. Hugo; Caetano, Ernesto; Carbone, Richard; Ciesielski, Paul; Cifelli, Rob; Cortez-Vazquez, Miguel; Douglas, Art; Douglas, Michael; Emmanuel, Gus; Fairall, Chris; Gochis, David; Gutzler, David; Jackson, Thomas; Johnson, Richard; King, Clark; Lang, Timothy; Lee, Myong-In; Lettenmaier, Dennis; Lobato, Rene; Magaña, Victor; Meiten, Jose; Mo, Kingtse; Nesbitt, Stephen; Ocampo-Torres, Francisco; Pytlak, Erik; Rogers, Peter; Rutledge, Steven; Schemm, Jae; Schubert, Siegfried; White, Allen; Williams, Christopher; Wood, Andrew; Zamora, Robert; Zhang, Chidong

    2006-01-01

    The North American Monsoon Experiment (NAME) is an internationally coordinated process study aimed at determining the sources and limits of predictability of warm-season precipitation over North America. The scientific objectives of NAME are to promote a better understanding and more realistic simulation of warm-season convective processes in complex terrain, intraseasonal variability of the monsoon, and the response of the warm-season atmospheric circulation and precipitation patterns to slowly varying, potentially predictable surface boundary conditions.During the summer of 2004, the NAME community implemented an international (United States, Mexico, Central America), multiagency (NOAA, NASA, NSF, USDA) field experiment called NAME 2004. This article presents early results from the NAME 2004 campaign and describes how the NAME modeling community will leverage the NAME 2004 data to accelerate improvements in warm-season precipitation forecasts for North America.

  4. SGP Cloud and Land Surface Interaction Campaign (CLASIC): Measurement Platforms

    Energy Technology Data Exchange (ETDEWEB)

    MA Miller; R Avissar; LK Berg; SA Edgerton; ML Fischer; TJ Jackson; B. Kustas; PJ Lamb; G McFarquhar; Q Min; B Schmid; MS Torn; DD Tuner

    2007-06-01

    The Cloud and Land Surface Interaction Campaign (CLASIC) will be conducted from June 8 to June 30, 2007, at the U.S. Department of Energy’s Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) Southern Great Plains (SGP) site. Data will be collected using eight aircraft equipped with a variety of specialized sensors, four specially instrumented surface sites, and two prototype surface radar systems. The architecture of CLASIC includes a high-altitude surveillance aircraft and enhanced vertical thermodynamic and wind profile measurements that will characterize the synoptic scale structure of the clouds and the land surface within the ACRF SGP site. Mesoscale and microscale structures will be sampled with a variety of aircraft, surface, and radar observations. An overview of the measurement platforms that will be used during the CLASIC are described in this report. The coordination of measurements, especially as it relates to aircraft flight plans, will be discussed in the CLASIC Implementation Plan.

  5. Upgradation of MOT and its Relevance to WET Campaigns

    Indian Academy of Sciences (India)

    Alisher S. Hojaev

    2005-06-01

    The Maidanak One-meter Telescope (MOT) is a Ritchey-Chretien telescope by Carl Zeiss, located atop Maidanak in Uzbekistan, where site parameters indicate excellent atmospheric seeing conditions. An effort to computerize the MOT, jointly made by an Uzbek, Taiwanese and Baltic consortium, is expected to complete in 2005. Monitoring the variability of star clusters will be among the first scientific projects to be carried out. Equipped with sensitive CCD cameras, the MOT, with its middle-Asia geographic location, will be a desirable addition to the Whole Earth Telescope (WET) network.We describe the upgrade engineering and instrumentation of the telescope and how the system can be used in future campaigns.

  6. Deep Impact: observations from a worldwide Earth-based campaign.

    Science.gov (United States)

    Meech, K J; Ageorges, N; A'Hearn, M F; Arpigny, C; Ates, A; Aycock, J; Bagnulo, S; Bailey, J; Barber, R; Barrera, L; Barrena, R; Bauer, J M; Belton, M J S; Bensch, F; Bhattacharya, B; Biver, N; Blake, G; Bockelée-Morvan, D; Boehnhardt, H; Bonev, B P; Bonev, T; Buie, M W; Burton, M G; Butner, H M; Cabanac, R; Campbell, R; Campins, H; Capria, M T; Carroll, T; Chaffee, F; Charnley, S B; Cleis, R; Coates, A; Cochran, A; Colom, P; Conrad, A; Coulson, I M; Crovisier, J; deBuizer, J; Dekany, R; de Léon, J; Dello Russo, N; Delsanti, A; DiSanti, M; Drummond, J; Dundon, L; Etzel, P B; Farnham, T L; Feldman, P; Fernández, Y R; Filipovic, M D; Fisher, S; Fitzsimmons, A; Fong, D; Fugate, R; Fujiwara, H; Fujiyoshi, T; Furusho, R; Fuse, T; Gibb, E; Groussin, O; Gulkis, S; Gurwell, M; Hadamcik, E; Hainaut, O; Harker, D; Harrington, D; Harwit, M; Hasegawa, S; Hergenrother, C W; Hirst, P; Hodapp, K; Honda, M; Howell, E S; Hutsemékers, D; Iono, D; Ip, W-H; Jackson, W; Jehin, E; Jiang, Z J; Jones, G H; Jones, P A; Kadono, T; Kamath, U W; Käufl, H U; Kasuga, T; Kawakita, H; Kelley, M S; Kerber, F; Kidger, M; Kinoshita, D; Knight, M; Lara, L; Larson, S M; Lederer, S; Lee, C-F; Levasseur-Regourd, A C; Li, J Y; Li, Q-S; Licandro, J; Lin, Z-Y; Lisse, C M; LoCurto, G; Lovell, A J; Lowry, S C; Lyke, J; Lynch, D; Ma, J; Magee-Sauer, K; Maheswar, G; Manfroid, J; Marco, O; Martin, P; Melnick, G; Miller, S; Miyata, T; Moriarty-Schieven, G H; Moskovitz, N; Mueller, B E A; Mumma, M J; Muneer, S; Neufeld, D A; Ootsubo, T; Osip, D; Pandea, S K; Pantin, E; Paterno-Mahler, R; Patten, B; Penprase, B E; Peck, A; Petitas, G; Pinilla-Alonso, N; Pittichova, J; Pompei, E; Prabhu, T P; Qi, C; Rao, R; Rauer, H; Reitsema, H; Rodgers, S D; Rodriguez, P; Ruane, R; Ruch, G; Rujopakarn, W; Sahu, D K; Sako, S; Sakon, I; Samarasinha, N; Sarkissian, J M; Saviane, I; Schirmer, M; Schultz, P; Schulz, R; Seitzer, P; Sekiguchi, T; Selman, F; Serra-Ricart, M; Sharp, R; Snell, R L; Snodgrass, C; Stallard, T; Stecklein, G; Sterken, C; Stüwe, J A; Sugita, S; Sumner, M; Suntzeff, N; Swaters, R; Takakuwa, S; Takato, N; Thomas-Osip, J; Thompson, E; Tokunaga, A T; Tozzi, G P; Tran, H; Troy, M; Trujillo, C; Van Cleve, J; Vasundhara, R; Vazquez, R; Vilas, F; Villanueva, G; von Braun, K; Vora, P; Wainscoat, R J; Walsh, K; Watanabe, J; Weaver, H A; Weaver, W; Weiler, M; Weissman, P R; Welsh, W F; Wilner, D; Wolk, S; Womack, M; Wooden, D; Woodney, L M; Woodward, C; Wu, Z-Y; Wu, J-H; Yamashita, T; Yang, B; Yang, Y-B; Yokogawa, S; Zook, A C; Zauderer, A; Zhao, X; Zhou, X; Zucconi, J-M

    2005-10-14

    On 4 July 2005, many observatories around the world and in space observed the collision of Deep Impact with comet 9P/Tempel 1 or its aftermath. This was an unprecedented coordinated observational campaign. These data show that (i) there was new material after impact that was compositionally different from that seen before impact; (ii) the ratio of dust mass to gas mass in the ejecta was much larger than before impact; (iii) the new activity did not last more than a few days, and by 9 July the comet's behavior was indistinguishable from its pre-impact behavior; and (iv) there were interesting transient phenomena that may be correlated with cratering physics.

  7. Large-scale CO2 measurement campaigns in Danish schools

    DEFF Research Database (Denmark)

    Clausen, Geo; Toftum, Jørn; Bekö, Gabriel

    2016-01-01

    In two large measurement campaigns performed in 2009 and 2014 more than 1500 spot measurements of CO2 were made by pupils in Danish primary school classes. In 2009 56% of the measurements exceeded the recommended value of 1000 ppm CO2. This percentage had increased to 60% in 2014. Changing...... the behaviour of the pupils had a positive effect, as the proportion of classrooms exceeding 1000 ppm CO2 in separate measurement (students outside and airing in the break preceding the measurement lesson in which the measurement was made) was 39%. The principle of ventilation had a substantial impact...... on the measured CO2 concentrations. In 80% of the classrooms with natural ventilation the concentration of CO2 exceeded 1000 ppm, while the fraction was 40% in classrooms with balanced mechanical ventilation....

  8. IceBridge: Bringing a Field Campaign Home

    Science.gov (United States)

    Woods, J.; Beck, J.; Bartholow, S.

    2015-12-01

    IceBridge, a six-year NASA mission, is the largest airborne survey of Earth's polar ice ever flown. It will yield an unprecedented three-dimensional view of Arctic and Antarctic ice sheets, ice shelves and sea ice. These flights will provide a yearly, multi-instrument look at the behavior of the rapidly changing features of the Greenland and Antarctic ice. Data collected during IceBridge will help scientists bridge the gap in polar observations between NASA's Ice, Cloud and Land Elevation Satellite (ICESat) -- in orbit since 2003 -- and ICESat-2, planned for 2017. ICESat stopped collecting science data in 2009, making IceBridge critical for ensuring a continuous series of observations. IceBridge will use airborne instruments to map Arctic and Antarctic areas once a year at a minimum, with new campaigns being developed during the Arctic melt season. IceBridge flights are conducted in the spring and summer for the Arctic and in the fall over Antarctica. Other smaller airborne surveys around the world are also part of the IceBridge campaign. IceBridge actively engages the public and educators through a variety of outlets ranging from communications strategies through social media outlets, to larger organized efforts such as PolarTREC. In field activities include blog posts, photo updates, in flight chat sessions, and more intensive live events to include google hangouts, where field team members can interact with the public during a scheduled broadcast. The IceBridge team provides scientists and other team members with the training and support to become communicators in their own right. There is an exciting new initiative where IceBridge will be collaborating with Undergraduate and Graduate students to integrate the next generation of scientists and communicators into the Science Teams. This will be explored through partnerships with institutions that are interested in mentoring through project based initiatives.

  9. Power Systems Development Facility Gasification Test Campaign TC25

    Energy Technology Data Exchange (ETDEWEB)

    Southern Company Services

    2008-12-01

    In support of technology development to utilize coal for efficient, affordable, and environmentally clean power generation, the Power Systems Development Facility (PSDF), located in Wilsonville, Alabama, routinely demonstrates gasification technologies using various types of coals. The PSDF is an engineering scale demonstration of key features of advanced coal-fired power systems, including a KBR Transport Gasifier, a hot gas particulate control device, advanced syngas cleanup systems, and high-pressure solids handling systems. This report summarizes the results of TC25, the second test campaign using a high moisture lignite coal from the Red Hills mine in Mississippi as the feedstock in the modified Transport Gasifier configuration. TC25 was conducted from July 4, 2008, through August 12, 2008. During TC25, the PSDF gasification process operated for 742 hours in air-blown gasification mode. Operation with the Mississippi lignite was significantly improved in TC25 compared to the previous test (TC22) with this fuel due to the addition of a fluid bed coal dryer. The new dryer was installed to dry coals with very high moisture contents for reliable coal feeding. The TC25 test campaign demonstrated steady operation with high carbon conversion and optimized performance of the coal handling and gasifier systems. Operation during TC25 provided the opportunity for further testing of instrumentation enhancements, hot gas filter materials, and advanced syngas cleanup technologies. The PSDF site was also made available for testing of the National Energy Technology Laboratory's fuel cell module and Media Process Technology's hydrogen selective membrane with syngas from the Transport Gasifier.

  10. The Sodankyla Total Ozone Intercomparison and Validation Campaign: ozonesonde observations

    Science.gov (United States)

    Kivi, Rigel; Bojkov, Bojan; Kyro, Esko; Heikkinen, Pauli; McGee, Thomas; Brinksma, Ellen

    Ozonesondes are widely used to validate satellite borne atmospheric remote sensing measurements. Sonde data quality depends on the sonde type and the preparation procedure. It is important to assess the accuracy of sonde measurements to be used for the validation of satellite instruments. Here we investigate the performance of ENSCI ozonesondes during the Sodankyl¨ a Total Ozone Intercomparison and Validation Campaign (SAUNA), which took place in March -April 2006 and in February-March 2007 in Sodankyl¨, Finland (67.4 ° N, 26.6 ° E). The cama paign provided a large set of ground-based observational data to validate the performance of ground-based and satellite borne ozone sensors at a high latitude site. We present comparisons with satellite instruments, an ozone lidar and Brewer spectrophotometers and results from dual ozonesonde flights. During March 22- April 14, 2006 we performed altogether 31 balloon flights, and from February 1 to March 3, 2007 in total 54 flights. The balloon launches were timed to the ozone measurements on board the NASA Aura satellite. In each payload an ENSCI ozonesonde was flown prepared with the cathode solution concentration of 0.5% KI. In addition, we made a series of dual sonde flights, which included also a SPC ozonesonde with the cathode solution concentration of 1 % KI. As a result of all dual sonde flights we found relative difference less than 2 % between the sonde types in the stratosphere, and from 3 to 4 % in the troposphere. Total ozone from sondes was in good agreement with the Ozone Monitoring Instrument (OMI) observations on board the Aura satellite. During the first campaign phase the average ratio OMI/ sonde was 0.99 +/- 0.02 % and during the second phase 1.00 +/- 0.05 %. The average ratio Brewer/sonde was 1.00 +/- 0.02 %.

  11. Study of Atmospheric Forcing and Responses (SAFAR campaign: overview

    Directory of Open Access Journals (Sweden)

    A. Jayaraman

    2010-01-01

    Full Text Available Study of Atmospheric Forcing and Responses (SAFAR is a five year (2009–2014 research programme specifically to address the responses of the earth's atmosphere to both natural and anthropogenic forcings using a host of collocated instruments operational at the National Atmospheric Research Laboratory, Gadanki (13.5° N, 79.2° E, India from a unified viewpoint of studying the vertical coupling between the forcings and responses from surface layer to the ionosphere. As a prelude to the main program a pilot campaign was conducted at Gadanki during May–November 2008 using collocated observations from the MST radar, Rayleigh lidar, GPS balloonsonde, and instruments measuring aerosol, radiation and precipitation, and supporting satellite data. We show the importance of the large radiative heating caused by absorption of solar radiation by soot particles in the lower atmosphere, the observed high vertical winds in the convective updrafts extending up to tropopause, and the difficulty in simulating the same with existing models, the upward traveling waves in the middle atmosphere coupling the lower atmosphere with the upper atmosphere, their manifestation in the mesospheric temperature structure and inversion layers, the mesopause height extending up to 100 km, and the electro-dynamical coupling between mesosphere and the ionosphere which causes irregularities in the ionospheric F-region. The purpose of this communication is not only to share the knowledge that we gained from the SAFAR pilot campaign, but also to inform the international atmospheric science community about the SAFAR program as well as to extend our invitation to join in our journey.

  12. Enhanced Soundings for Local Coupling Studies Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Ferguson, Craig R [University at Albany, State University of New York; Santanello, Joseph A [NASA Goddard Space Flight Center (GSFC), Greenbelt, MD (United States); Gentine, Pierre [Columbia Univ., New York, NY (United States)

    2016-04-01

    This document presents initial analyses of the enhanced radiosonde observations obtained during the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility Enhanced Soundings for Local Coupling Studies Field Campaign (ESLCS), which took place at the ARM Southern Great Plains (SGP) Central Facility (CF) from June 15 to August 31, 2015. During ESLCS, routine 4-times-daily radiosonde measurements at the ARM-SGP CF were augmented on 12 days (June 18 and 29; July 11, 14, 19, and 26; August 15, 16, 21, 25, 26, and 27) with daytime 1-hourly radiosondes and 10-minute ‘trailer’ radiosondes every 3 hours. These 12 intensive operational period (IOP) days were selected on the basis of prior-day qualitative forecasts of potential land-atmosphere coupling strength. The campaign captured 2 dry soil convection advantage days (June 29 and July 14) and 10 atmospherically controlled days. Other noteworthy IOP events include: 2 soil dry-down sequences (July 11-14-19 and August 21-25-26), a 2-day clear-sky case (August 15-16), and the passing of Tropical Storm Bill (June 18). To date, the ESLCS data set constitutes the highest-temporal-resolution sampling of the evolution of the daytime planetary boundary layer (PBL) using radiosondes at the ARM-SGP. The data set is expected to contribute to: 1) improved understanding and modeling of the diurnal evolution of the PBL, particularly with regard to the role of local soil wetness, and (2) new insights into the appropriateness of current ARM-SGP CF thermodynamic sampling strategies.

  13. Comparison of Human Exploration Architecture and Campaign Approaches

    Science.gov (United States)

    Goodliff, Kandyce; Cirillo, William; Mattfeld, Bryan; Stromgren, Chel; Shyface, Hilary

    2015-01-01

    As part of an overall focus on space exploration, National Aeronautics and Space Administration (NASA) continues to evaluate potential approaches for sending humans beyond low Earth orbit (LEO). In addition, various external organizations are studying options for beyond LEO exploration. Recent studies include NASA's Evolvable Mars Campaign and Design Reference Architecture (DRA) 5.0, JPL's Minimal Mars Architecture; the Inspiration Mars mission; the Mars One campaign; and the Global Exploration Roadmap (GER). Each of these potential exploration constructs applies unique methods, architectures, and philosophies for human exploration. It is beneficial to compare potential approaches in order to better understand the range of options available for exploration. Since most of these studies were conducted independently, the approaches, ground rules, and assumptions used to conduct the analysis differ. In addition, the outputs and metrics presented for each construct differ substantially. This paper will describe the results of an effort to compare and contrast the results of these different studies under a common set of metrics. The paper will first present a summary of each of the proposed constructs, including a description of the overall approach and philosophy for exploration. Utilizing a common set of metrics for comparison, the paper will present the results of an evaluation of the potential benefits, critical challenges, and uncertainties associated with each construct. The analysis framework will include a detailed evaluation of key characteristics of each construct. These will include but are not limited to: a description of the technology and capability developments required to enable the construct and the uncertainties associated with these developments; an analysis of significant operational and programmatic risks associated with that construct; and an evaluation of the extent to which exploration is enabled by the construct, including the destinations

  14. Campaign Finance Regulation: the Resilence of the American Model

    Directory of Open Access Journals (Sweden)

    William D. Araiza

    2009-12-01

    Full Text Available

    The current term of the United States Supreme Court, which began this past October, is notable for its concentration of cases testing the permissible scope of federal regulation of business. But if this term’s docket reflects the pressure faced by the American economic model – a model marked by lax regulation, faith in private choices and market outcomes, and toleration of large inequalities in results – then this term will likely also mark a reaffirmation of that model in the context of free expression. In September the Court held a rare off-schedule oral argument in Citizens United v. Federal Election Commission, a case that may result in significant changes in the constitutional status of American campaign finance law.  Citizens United presents the Court’s emerging conservative majority with an opportunity to deregulate corporations’ campaign speech by finding restrictions on that speech to violate the First Amendment. Depending on the breadth of the Court’s holding, Citizens United may well result in the triumph of the American economic model in the context of the political marketplace exactly when that model is coming under severe strain on other fronts.

  15. Combination and long term stability of the IGS Reprocessing campaign

    Science.gov (United States)

    Booker, David; Clarke, Peter J.; Lavallée, David A.

    2010-05-01

    During the relatively short life of the Global Positioning System (GPS) there have been several changes to the analysis procedure, leading to inhomogeneous coordinate time series. Although they have reduced systematic errors in more recent solutions, these changes have modified the apparent periodic signals observed and led to spurious discontinuities. The International GNSS Service (IGS) reprocessing campaign uses the latest operational models and techniques to reprocess the back catalogue of GPS data to produce remove inconsistencies caused by the various model changes, thus producing a homogeneous time series of station coordinates and Earth Rotation Parameters (ERPs). Weekly coordinate and ERP solutions from up to 11 reprocessing analysis centres (ACs) have been aligned to the ITRF and combined using the TANYA software in a rigorous weighted least-squares solution. Analysis of the time series of station coordinates and Helmert transformation parameters between the combined solution and the ITRF shows a at least a 50 percent improvement in the stability of the reprocessed weekly solutions compared with earlier operational products. There is a gradual decrease in the weighted root mean square coordinate difference, both between the combined weekly solutions and the ITRF and between the individual AC solutions and their weekly combination, which reaches a minimum around the end of 2005 with a slight increase thereafter. We observe clear differences in the periodicity of Helmert transformation parameters between the individual AC solutions and the combined solution, which presumably result from variations in AC processing strategy. There is a clear annual or near annual periodic variation in the scale difference between the combined solution and the ITRF05 and some less clear variation between the translation parameters, which needs further analysis as to its cause. Keywords: GPS, ITRF, IGS reprocessing campaign, periodic errors

  16. ParticipACTION: A mass media campaign targeting parents of inactive children; knowledge, saliency, and trialing behaviours

    Directory of Open Access Journals (Sweden)

    Gauvin Lise

    2009-12-01

    Full Text Available Abstract Background In late 2007, Canada's ParticipACTION national physical activity mass media campaign was re-launched, with an initial campaign targeting parents of elementary school-aged children. The campaign informed them about the risks of physical inactivity for children and youth. The purpose of this study was to assess campaign awareness and understanding following the campaign, and to identify whether exposure to this campaign was likely associated with behaviour change. Methods A convenience sample of 1,500 adults was recruited though an existing panel (n = 60,000 of Canadian adults to participate in online surveys. Initial campaign exposure included "prompted" and "unprompted" recall of specific physical activity messages from the 2007 ParticipACTION campaign, knowledge of the benefits of PA, saliency, and initial trial behaviours to help their children become more active. Results One quarter of respondents showed unprompted recall of specific message content from the ParticipACTION campaign, and prompted recall was 57%. Message recall and understanding was associated with knowledge about physical activity, and that in turn was related to high saliency. Saliency was associated with each of the physical activity-related trial behaviours asked. Conclusion Campaign awareness and understanding was high following this ParticipACTION campaign, and was associated with intermediate campaign outcomes, including saliency and trial behaviours. This is relevant to campaign evaluations, as it suggests that an initial focus on influencing awareness and understanding is likely to lead to more substantial change in campaign endpoints.

  17. Influence of a nationwide social marketing campaign on adolescent drug use.

    Science.gov (United States)

    Scheier, Lawrence M; Grenard, Jerry L

    2010-04-01

    In this study, we examined whether awareness (recall) of the National Youth Anti-Drug Media Campaign (NYADMC) benefited youth by attenuating their drug use. Data were obtained from the National Survey of Parents and Youth (NSPY), an evaluative survey tool designed to monitor campaign progress over 4 years. A growth modeling strategy was used to examine whether change in message recall or campaign brand awareness was related to declining patterns of drug use. Two distinct growth trajectories were modeled to account for growth among younger (12 to 14) versus older (15 to 18) youth. Growth trajectories indicated steady and positive increases in alcohol, cigarette, and marijuana use over time. During the early portion of adolescence, youth reported more "brand" awareness, remembered more of the video clips depicting campaign messages, recalled more media stories about youth and drugs and more antitobacco ads, and reported more radio listening and less television watching. When they were older, these same youth reported declines in these same awareness categories except for specifically recalling campaign ads and radio listening. Models positing simultaneous growth in drug use and campaign awareness indicated mixed findings for the campaign. Overall early levels of campaign awareness had a limited influence on rates of growth, and in a few cases higher levels were associated with quicker acquisition of drug use behaviors. When they were younger, these youth accelerated their drug use and reported increasing amounts of campaign awareness. When they were older, increasing awareness was associated with declines in binge drinking and cigarette smoking. No effects for marijuana were significant but trended in the direction of increased awareness associated with declining drug use. The findings are discussed in terms of how they depart from previous reports of campaign efficacy and the potential efficacy of social marketing campaigns to reach a large and impressionable

  18. The importance of campaign saliency as a predictor of attitude and behavior change: A pilot evaluation of social marketing campaign Fat Talk Free Week.

    Science.gov (United States)

    Garnett, Bernice Raveche; Buelow, Robert; Franko, Debra L; Becker, Carolyn; Rodgers, Rachel F; Austin, S Bryn

    2014-01-01

    Fat Talk Free Week (FTFW), a social marketing campaign designed to decrease self-disparaging talk about body and weight, has not yet been evaluated. We conducted a theory-informed pilot evaluation of FTFW with two college samples using a pre- and posttest design. Aligned with the central tenets of the Elaboration Likelihood Model (ELM), we investigated the importance of FTFW saliency as a predictor of fat talk behavior change. Our analytic sample consisted of 118 female participants (83% of original sample). Approximately 76% of the sample was non-Hispanic White, 14% Asian, and 8% Hispanic. At baseline, more than 50% of respondents reported engaging in frequent self fat talk; at posttest, this number dropped to 34% of respondents. Multivariable regression models supported campaign saliency as the single strongest predictor of a decrease in self fat talk. Our results support the social diffusion of campaign messages among shared communities, as we found significant decreases in fat talk among campaign attenders and nonattenders. FTFW may be a promising short-term health communication campaign to reduce fat talk, as campaign messages are salient among university women and may encourage interpersonal communication.

  19. Meteorological Sensor Array (MSA)-Phase I. Volume 3 (Pre-Field Campaign Sensor Calibration)

    Science.gov (United States)

    2015-07-01

    ARL-TR-7362 ● JULY 2015 US Army Research Laboratory Meteorological Sensor Array (MSA)–Phase I, Volume 3 (Pre-Field Campaign... Sensor Calibration) by Gail Vaucher and Robert Edmonds Approved for public release; distribution is unlimited...Meteorological Sensor Array (MSA)–Phase I, Volume 3 (Pre-Field Campaign Sensor Calibration) by Gail Vaucher and Robert Edmonds

  20. Health Communications in Rural America: Lessons Learned from an Arthritis Campaign in Rural Arkansas

    Science.gov (United States)

    Balamurugan, Appathurai; Rivera, Mark; Sutphin, Kim; Campbell, Debbie

    2007-01-01

    Context: Lack of awareness about diseases and associated risk factors could partially account for some rural health disparities. Health communications campaigns can be an effective means of increasing awareness in these areas. Purpose: To review findings and lessons learned from a rural health communications campaign. Methods: The health…

  1. Night of Darkness Campaign: Make Light Pollution Something Everybody Cares About

    Science.gov (United States)

    Pas, Friedel

    2015-03-01

    To battle light pollution issues, influence the market so that customers request only good lighting. An important factor in doing this is to convince decision makers that light pollution is something the whole society cares about. This article gives an overview of an existing campaign that does this and emphasizes some important factors to consider in your campaign.

  2. Overview of the synoptic and pollution situation over Europe during the EUCAARI-LONGREX field campaign

    NARCIS (Netherlands)

    Hamburger, T.; McMeeking, G.; Minikin, A.; Birmili, W.; Dall'Osto, M.; O'Dowd, C.; Flentje, H.; Henzing, B.; Junninen, H.; Kristensson, A.; Leeuw, G. de; Stohl, A.; Burkhart, J.F.; Coe, H.; Krejci, R.; Petzold, A.

    2011-01-01

    In May 2008 the EUCAARI-LONGREX aircraft field campaign was conducted within the EUCAARI intensive observational period. The campaign aimed at studying the distribution and evolution of air mass properties on a continental scale. Airborne aerosol and trace gas measurements were performed aboard the

  3. Population-Based Evaluation of the "Livelighter" Healthy Weight and Lifestyle Mass Media Campaign

    Science.gov (United States)

    Morley, B.; Niven, P.; Dixon, H.; Swanson, M.; Szybiak, M.; Shilton, T.; Pratt, I. S.; Slevin, T.; Hill, D.; Wakefield, M.

    2016-01-01

    The Western Australian (WA) "LiveLighter" (LL) mass media campaign ran during June-August and September-October 2012. The principal campaign ad graphically depicts visceral fat of an overweight individual ("why" change message), whereas supporting ads demonstrate simple changes to increase activity and eat healthier…

  4. 49 CFR 579.5 - Notices, bulletins, customer satisfaction campaigns, consumer advisories, and other communications.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Notices, bulletins, customer satisfaction... General § 579.5 Notices, bulletins, customer satisfaction campaigns, consumer advisories, and other... to NHTSA a copy of each communication relating to a customer satisfaction campaign, consumer...

  5. 76 FR 21873 - Notice Inviting Proposals for Taking Ownership and Operation of the TEACH Campaign

    Science.gov (United States)

    2011-04-19

    ... ] encourage a large and diverse group of high-performing individuals to pursue a career in teaching. As one... help develop the TEACH Campaign into a nationally prominent effort to bring a large number of high... Notice Inviting Proposals for Taking Ownership and Operation of the TEACH Campaign AGENCY: Office...

  6. Doing the "Work of Hearing": Girls' Voices in Transnational Educational Development Campaigns

    Science.gov (United States)

    Khoja-Moolji, Shenila

    2016-01-01

    There is an increasing focus in transnational campaigns for girls' education and empowerment on highlighting the voices of girls from the global south. These moves are made in response to feminist critiques of said campaigns for not attending to the diverse, multiple and complex lived experiences of girls. This article engages in theorising these…

  7. The Political Discourse of the Campaign against Bilingual Education: From "Proposition 227" to "Horne v. Flores"

    Science.gov (United States)

    Yamagami, Mai

    2012-01-01

    Using the frameworks of critical discourse analysis, representation theory, and legitimization theory, this study examines the political discourse of the campaign for Proposition 227 in California--particularly, the key social representations of languages, their speakers, and the main political actors in the campaign. The analysis examines the…

  8. The Cabauw Intercomparison campaign for Nitrogen Dioxide measuring Instruments (CINDI): Design, execution, and early results

    NARCIS (Netherlands)

    Piters, A.J.M.; Boersma, K.F.; Kroon, M.; Hains, J.C.; Roozendael, M. van; Wittrock, F.; Abuhassan, N.; Adams, C.; Akrami, M.; Allaart, M.A.F.; Apituley, A.; Beirle, S.; Bergwerff, J.B.; Berkhout, A.J.C.; Brunner, D.; Cede, A.; Chong, J.; Clémer, K.; Fayt, C.; Frieß, U.; Gast, L.F.L.; Gil-Ojeda, M.; Goutail, F.; Graves, R.; Griesfeller, A.; Großmann, K.; Hemerijckx, G.; Hendrick, F.; Henzing, B.; Herman, J.; Hermans, C.; Hoexum, M.; Hoff, G.R. van der; Irie, H.; Johnston, P.V.; Kanaya, Y.; Kim, Y.J.; Klein Baltink, H.; Kreher, K.; Leeuw, G. de; Leigh, R.; Merlaud, A.; Moerman, M.M.; Monks, P.S.; Mount, G.H.; Navarro-Comas, M.; Oetjen, H.; Pazmino, A.; Perez-Camacho, M.; Peters, E.; Du Piesanie, A.; Pinardi, G.; Puentedura, O.; Richter, A.; Roscoe, H.K.; Schönhardt, A.; Schwarzenbach, B.; Shaiganfar, R.; Sluis, W.; Spinei, E.; Stolk, A.P.; Strong, K.; Swart, D.P.J.; Takashima, H.; Vlemmix, T.; Vrekoussis, M.; Wagner, T.; Whyte, C.; Wilson, K.M.; Yela, M.; Yilmaz, S.; Zieger, P.; Zhou, Y.

    2012-01-01

    From June to July 2009 more than thirty different in-situ and remote sensing instruments from all over the world participated in the Cabauw Intercomparison campaign for Nitrogen Dioxide measuring Instruments (CINDI). The campaign took place at KNMI's Cabauw Experimental Site for Atmospheric Research

  9. The Cabauw Intercomparison campaign for Nitrogen Dioxide measuring Instruments (CINDI): design, execution, and early results

    NARCIS (Netherlands)

    Henzing, J.S.; Leeuw, G. de; Piters, A.J.M.; Boersma, K.F.; Kroon, M.; Hains, J.C.; Roozendael, M. van; Wittrock, F.; Abuhassan, N.; Adams, C.; Akrami, M.; Allaart, M.A.F.; Apituley, A.; Bergwerff, J.B.; Berkhout, A.J.C.; Brunner, D.; Cede, A.; Chong, J.; Clémer, K.; Fayt, C.; Friess, U.; Gast, L.F.L.; Gil-Ojeda, M.; Goutail, F.; Graves, R.; Griesfeller, A.; Grossmann, K.; Hemerijckx, G.; Hendrick, F.; Herman, J.; Hermans, C.; Hoexum, M.; Hoff, G.R. van der; Irie, H.; Johnston, P.V.; Kanaya, Y.; Kim, Y.J.; Klein Baltink, H.; Kreher, K.; Leigh, R.; Merlaud, A.; Moerman, M.M.; Monks, P.S.; Mount, G.H.; Navarro-Comas, M.; Oetjen, H.; Pazmino, A.; Perez-Camacho, M.; Peters, E.; Piesanie, A. du; Pinardi, G.; Puentadura, O.; Richter, A.; Roscoe, H.K.; Schönhardt, A.; Schwarzenbach, B.; Shaiganfar, R.; Sluis, W.; Spinei, E.; Stolk, A.P.; Strong, K.; Swart, D.P.J.; Takashima, H.; Vlemmix, T.; Vrekoussis, M.; Wagner, T.; Whyte, C.; Wilson, K.M.; Yela, M.; Yilmaz, S.; Zieger, P.; Zhou, Y.

    2011-01-01

    From June to July 2009 more than thirty different in-situ and remote sensing instruments from all over the world participated in the Cabauw Intercomparison campaign for Nitrogen Dioxide measuring Instruments (CINDI). The campaign took place at KNMI’s 5 Cabauw Experimental Site for Atmospheric Resear

  10. Let's talk about alcohol: The role of interpersonal communication and health campaigns

    NARCIS (Netherlands)

    Hendriks, H.

    2014-01-01

    Inspired by the varying degrees of success of health campaigns, this dissertation shows that interpersonal communication plays a vital role for the prediction of health behaviors and health campaign effects. In the context of alcohol abuse and binge drinking, this dissertation provides insight into

  11. The Dutch 'Folic Acid Campaign'-have the goals been achieved?

    NARCIS (Netherlands)

    van der Pal-de Bruin, KM; de Walle, HEK; Jeeninga, W; de Rover, C; Cornel, MC; de Jong-van den Berg, LTW; Schouten, J; Brand, R; Buitendijk, SE

    2000-01-01

    Periconceptional folic acid use considerably reduces the risk of neural tube defects. The aim of this study was to measure the effect of the national and the local 'Folic Acid Campaign' on periconceptional folic acid use. Before (1995 survey) and 1 year after the campaign (1996 survey), the awarenes

  12. Alabama's Illiteracy Campaign for Black Adults, 1915-1930: An Analysis.

    Science.gov (United States)

    Akenson, James E.; Neufeldt, Harvey G.

    1985-01-01

    From 1910 to 1930, illiteracy rates among Alabama's Black population decreased. Yet it is doubtful that the State's literacy campaign was a major contributor to the decline in Black illiteracy; the campaign was closely tied to the White supremacy movement, and most of the funds were directed toward White education. (GC)

  13. Long-term effects of a climate change teaching campaign – a case study

    DEFF Research Database (Denmark)

    Cruys-Bagger, Søren Ib; Daugbjerg, Peer

    2008-01-01

    The authors perform in association with School of Education, Aarhus University an evaluation of the long term effects of the campaign visit. We are investigating the sustainable effect of science campaigns for schools by collecting teachers reflection on the value of the visit of “Klimakaravanen...

  14. Measuring and Monitoring in the South African "Kha Ri Gude" Mass Literacy Campaign

    Science.gov (United States)

    McKay, Veronica

    2015-01-01

    After many previous failed attempts to reach illiterate adults, the award-winning South African "Kha Ri Gude" mass literacy campaign, launched in 2008, undertook to ensure that learners seized the opportunity to learn--for many adults, this was a "last chance". Written from an insider perspective by the campaign's founding…

  15. Lessons learned from a community campaign on child safety in the Netherlands

    NARCIS (Netherlands)

    Wortel, E.; Vries, H. de; Geus, G.H. de

    1996-01-01

    A 1-year community campaign was carried out in The Netherlands to reduce home-related injuries of preschool-aged children by 20%. Because health education directed at parents of preschool-aged children was a main instrument in this campaign, several guidelines on behalf of effective health education

  16. Campaign Documentaries: Behind-the-Scenes Perspectives Make Useful Teaching Tools

    Science.gov (United States)

    Wolfford, David

    2012-01-01

    Over the last 20 years, independent filmmakers have produced insightful documentaries of high profile political campaigns with behind-the-scenes footage. These documentaries offer inside looks and unique perspectives on electoral politics. This campaign season, consider "The War Room"; "A Perfect Candidate"; "Journeys With George;" "Chisholm '72";…

  17. Short, sharp shock public health campaign had limited impact on raising awareness of laryngeal cancer.

    Science.gov (United States)

    Sethi, Neeraj; Rafferty, Amy; Rawnsley, Trisha; Jose, Jemy

    2016-09-01

    Laryngeal cancer has poorer outcomes if diagnosed at a later stage. Improving awareness could encourage earlier presentation and improve outcomes. This study aimed to evaluate a public engagement campaign targeted at raising awareness of laryngeal cancer. An epidemiological study identified high-risk populations in the region. A target population as well as a matched control population was selected. A cancer awareness survey combined with focus groups guided the design of a 3-month multimedia campaign. The survey was repeated post-campaign to evaluate the campaign effectiveness. The study identified populations with the highest rates of laryngeal cancer and late stage disease at presentation. The surveys performed revealed a limited effect of the multimedia campaign in raising awareness of the signs and symptoms of laryngeal cancer. Recall of the campaign also faded rapidly. This is the first public awareness campaign aimed at laryngeal cancer carried out in the UK. The results suggest that short-term campaigns have a limited effect and a more prolonged approach should be considered.

  18. Promoting Tobacco-Free School Policies through a Statewide Media Campaign

    Science.gov (United States)

    Summerlin-Long, Shelley K.; Goldstein, Adam O.; Davis, James; Shah, Vandana

    2009-01-01

    Background: Comprehensive, enforced tobacco-free school (TFS) policies lead to significant reductions in youth tobacco use. North Carolina is the first state in the United States to develop a statewide mass media campaign to promote the adoption of and compliance with TFS policies. Methods: In order to guide campaign development, researchers…

  19. Bias in the News: Network Television Coverage of the 1972 Election Campaign.

    Science.gov (United States)

    Hofstetter, C. Richard

    This book analyzes the coverage of the 1972 presidential election campaign by the three major television networks, focusing on weekday-evening news broadcasts from 10 July to 6 November 1972. The study's two objectives are to identify and explain discernible patterns of campaign news coverage and to show how these patterns relate to the…

  20. Biased News in the 1972 Campaign: A Multi-Media Analysis.

    Science.gov (United States)

    Hofstetter, C. Richard

    The purpose of this study is to present systematic findings concerning bias in TV news coverage of the 1972 presidential campaign and to describe the kinds of coverage that the candidates and parties received during the campaign. News about the election was analyzed from weekday network evening news programs, AP day and night wire coverage, a…