WorldWideScience

Sample records for campaign cfc cruise-in

  1. Chlorofluorocarbons: CFC-11, CFC-12, CFC-113, HCFC-21, HCFC-31, HCFC-133a

    DEFF Research Database (Denmark)

    Bredsdorff, Lea; Nielsen, Else

    The Danish EPA has requested documentation for health-based quality criteria in air and groundwater for the following six chlorofluorocarbons: CFC-11, CFC-12, HCFC-21, HCFC-31, CFC-113 (1,1,2-trichloro-1,2,2-trifluoroethane) and HCFC-133a (1-chloro-2,2,2-trifluoroethane). A concern for toxic...

  2. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  3. CFC Outdoor Tournament 2011

    CERN Multimedia

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  4. Study of groundwater mixing using CFC data

    Institute of Scientific and Technical Information of China (English)

    韩良丰; 庞忠和

    2001-01-01

    CFCs (Chlorofluorocarbons) are sensitive tools in the study of groundwater mixing. Based on results of CFC concentrations, the extent of mixing can be identified by three methods: 1. discrepancy between apparent ages determined by individual CFC compounds; 2. inconsistency between CFC concentration ratios and their respective apparent ages; and 3. correlation between the concentrations of two CFC compounds for a group of samples. The principle of determination of mixing ratios and apparent CFC water age in the case of a two component mixing of CFC-containing water with CFC-free water is described.

  5. Simplified CFC sampling method and spreadsheet based CFC data evaluation

    International Nuclear Information System (INIS)

    Several sampling methods exist to collect groundwater samples for CFC analysis. The established methods like sealing water samples in glass ampoules, using field-crimped copper tubes or taking large volume samples in glass bottles have some drawbacks when intended to be applied worldwide at remote locations without special trained staff. After establishment of a CFC analysis facility at IAEA, efforts were undertaken to develop a more robust and simple technique for CFC sampling. The method developed at IAEA uses commercial 50 ml glass bottles with plastic caps. In order to prevent the sample contamination via CFCs absorbed in the plastic cap, a round metal foil liner of laboratory grade aluminum is placed into the inside of the plastic cap. After extensive flushing of both bottle and cap with sample water in a metal container, the bottle is sealed under water with the cap. The glass bottle and the metal-foil liner provide a gas-tight sealing suitable for sample storage of more than one year. Essential for a successful sampling is the absence of any visible air bubble in the bottle directly after sampling, which of course can be easily checked. The method facilitates the strongly recommended custom to take multiple samples at each sampling site, being cheap and using small sized samples. Altogether five different sampling techniques with several variations were tested during a field experiment at a remote site at the Reichenkar glacier mound in the Oetztal region, Western Alps, Austria. The suitability of the sampling method described above was verified by those results and was further on extensively tested with CFC free water stored for extended time periods before analysis. For easy evaluation of measured CFC data it was desired to have available a suitable spreadsheet program. QCFC ('Quick-CFC') is an easy-to-use interactive Excel spreadsheet program for carrying out quick calculations in hydrologic studies using chlorofluorocarbons as time-dependent tracers

  6. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2010-11-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments (e.g., enhancements of 13 pptv and 11 pptv for CFC-11 and CFC-12, respectively. Emissions estimates of HFC-152a (0.98±0.05 Gg and HFC-134a (1.40±0.11 Gg in LA County for 2008 were obtained using the observed HFC:CO enhancement ratio. The emission rates were extrapolated to the SoCAB (1.48±0.07 Gg for HFC-152a and 2.12±0.17 Gg for HFC-134a and US (30.1±1.5 Gg for HFC-152a and 43.0±3.4 Gg for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB also were calculated by a second method that utilizes air quality modeling. Estimates obtained using both methods agree well.

  7. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  8. Detected CFCs: UV Absorption Spectra, Atmospheric Lifetimes, Global Warming and Ozone Depletion Potentials for CFC-112, CFC-112a, CFC-113a and CFC-114a

    Science.gov (United States)

    Bernard, F.; Davis, M. E.; McGillen, M.; Fleming, E. L.; Burkholder, J. B.

    2015-12-01

    Chlorofluorocarbons (CFCs) are ozone depleting substances (ODSs) and potent greenhouse gases. Measurements have observed CFC-112 (CFCl2CFCl2), CFC-112a (CF2ClCCl3), and CFC-113a (CCl3CF3) in the atmosphere (Laube et al., 2014). The current atmospheric abundances of CFC-112 and CFC-112a are ~0.4 and ~0.06 ppt, respectively, with decreasing abundance since 1995. In contrast, CFC-113a was found to show continuous growth over the past 50 years with a current atmospheric abundance of ~0.5 ppt. The major atmospheric removal process for these compounds is expected to be UV photolysis in the stratosphere. To date there is, however, no UV absorption spectra for these compounds available in the literature. To better determine the atmospheric lifetimes and environmental impact of these CFCs, laboratory measurements of the UV absorption spectra of CFC-112, CFC-112a, CFC-113a, and CFC-114a (Cl2FCF3) between 195 and 235 nm and over the temperature range 207 to 323 K were performed. Spectrum parametrizations were developed for use in atmospheric models. Atmospheric lifetimes and ozone depletion potentials (ODPs) were calculated using the Goddard Space Flight Center 2-D atmospheric chemistry model. Infrared absorption spectra of these compounds were also measured and used to calculate their global warming potentials. The results of the laboratory measurements and model calculations will be presented. J. C. Laube et al., Newly detected ozone-depleting substances in the atmosphere, Nature Geoscience, 7, 266-269, 2014

  9. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-06-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their global loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 111(96–132 yr for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 112(97–133 yr for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 112(96–135 yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.47±0.04 and the CFC-12 lifetime estimate is 112(102–123 yr. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 yr and 102(88–122 yr, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime of 110(95–129 yr, based on

  10. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-11-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer–tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 years for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 112(96–133 years for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 113(97–134 years for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 114(98–136 years for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46±0.04 and the CFC-12 lifetime estimate is 113(103–124 years. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 years and 102(88–122 years, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime

  11. Dicty_cDB: CFC502 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlffycfkyff*neknniifnsttciiiw*n*itfiyemcglgfwfkfmc sipkkl*il*ttrrwflipkr*ihktipn*igsim*pstkkkffnyqsl*fktsng...qrnii*hvli**fpvevhiitmnhkdhleknthkdhlvknfkekkdkei kknkp*eerdkmmsilnckekkkenkcnvi*reklqqkspeninqpfsnil*emvnwken...5 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116982 |AC116982.2 Dictyostelium di...ive seq. ID CFC502P (Link to Original site) Representative DNA sequence >CFC502 (CFC502Q) /CSM/CF/CFC5-A/CFC...kfps wskdlptmaskkpcdcikswyr*flpfskndigcsrrsksrcilpkfnpfkpiwklykil *kyk*cnmycmf*ftngy--- ---ssiflgv*skgilfnmc

  12. Atmospheric Abundances, Trends and Emissions of CFC-216ba, CFC-216ca and HCFC-225ca

    Directory of Open Access Journals (Sweden)

    Corinna Kloss

    2014-06-01

    Full Text Available The first observations of the feedstocks, CFC-216ba (1,2-dichlorohexafluoropropane and CFC-216ca (1,3-dichlorohexafluoropropane, as well as the CFC substitute HCFC-225ca (3,3-dichloro-1,1,1,2,2-pentafluoropropane, are reported in air samples collected between 1978 and 2012 at Cape Grim, Tasmania. Present day (2012 mixing ratios are 37.8 ± 0.08 ppq (parts per quadrillion; 1015 and 20.2 ± 0.3 ppq for CFC-216ba and CFC-216ca, respectively. The abundance of CFC-216ba has been approximately constant for the past 20 years, whilst that of CFC-216ca is increasing, at a current rate of 0.2 ppq/year. Upper tropospheric air samples collected in 2013 suggest a further continuation of this trend. Inferred annual emissions peaked 421 at 0.18 Gg/year (CFC-216ba and 0.05 Gg/year (CFC-216ca in the mid-1980s and then decreased sharply as expected from the Montreal Protocol phase-out schedule for CFCs. The atmospheric trend of CFC-216ca and CFC-216ba translates into continuing emissions of around 0.01 Gg/year in 2011, indicating that significant banks still exist or that they are still being used. HCFC-225ca was not detected in air samples collected before 1992. The highest mixing ratio of 52 ± 1 ppq was observed in 2001. Increasing annual emissions were found in the 1990s (i.e., when HCFC-225ca was being introduced as a replacement for CFCs. Emissions peaked around 1999 at about 1.51 Gg/year. In accordance with the Montreal Protocol, restrictions on HCFC consumption and the short lifetime of HCFC-225ca, mixing ratios declined after 2001 to 23.3 ± 0.7 ppq by 2012.

  13. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Science.gov (United States)

    Hoffmann, Lars; Hoppe, Charlotte; Müller, Rolf; Dutton, Geoffrey S.; Gille, John C.; Griessbach, Sabine; Jones, Ashley; Meyer, Catrin I.; Spang, Reinhold; Volk, C. Michael; Walker, Kaley A.

    2015-04-01

    Chlorofluorocarbons (CFCs) play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11) and CF2Cl2 (CFC-12). We present new estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS), the HIgh Resolution Dynamics Limb Sounder (HIRDLS), and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS). We found a CFC-11/CFC-12 lifetime ratio of 0.47 ± 0.08 and a CFC-12 lifetime of 112(96 - 133) yr for ACE-FTS, a ratio of 0.46 ± 0.07 and a lifetime of 113(97 - 134) yr for HIRDLS, and a ratio of 0.46 ± 0.08 and a lifetime of 114(98 - 136) yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46 ± 0.04 and the CFC-12 lifetime estimate is 113(103 - 124) yr. These results are in excellent agreement with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC) reassessment, which recommends lifetimes of 52(43 - 67) yr for CFC-11 and 102(88 - 122) yr for CFC-12, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled EMAC/CLaMS model we found a CFC-11/CFC-12 lifetime ratio

  14. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    Directory of Open Access Journals (Sweden)

    S. J. Allin

    2014-12-01

    Full Text Available The stratospheric degradation of chlorofluorocarbons (CFCs releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O3. A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, similar to effects seen in nitrous oxide (N2O. Using air archives to obtain a long-term record of chlorine isotope ratios in CFCs could help to identify and quantify their sources and sinks. We analyse the three most abundant CFCs and show that CFC-11 (CCl3F and CFC-113 (CClF2CCl2F exhibit significant stratospheric chlorine isotope fractionation, in common with CFC-12. The apparent isotope fractionation (ϵapp for mid- and high-latitude stratospheric samples are (−2.4 ± 0.5 and (−2.3 ± 0.4‰ for CFC-11, (−12.2 ± 1.6 and (−6.8 ± 0.8‰ for CFC-12 and (−3.5 ± 1.5 and (−3.3 ± 1.2‰ for CFC-113, respectively. Assuming a constant source isotope composition, we estimate the expected trends in the tropospheric isotope signature of these gases due to their stratospheric 37Cl enrichment and stratosphere–troposphere exchange. We compare these model results to the long-term δ(37Cl trends of all three CFCs, measured on background tropospheric samples from the Cape Grim air archive (Tasmania, 1978–2010 and tropospheric firn air samples from Greenland (NEEM site and Antarctica (Fletcher Promontory site. Model trends agree with tropospheric measurements within analytical uncertainties. From 1970 to the present-day, we find no evidence for variations in chlorine isotope ratios associated with changes in CFC manufacturing processes. Our study increases the suite of trace gases amenable to direct isotope ratio measurements in small air volumes, using a single-detector gas chromatography-mass spectrometry system.

  15. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION

    Science.gov (United States)

    The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...

  16. Dicty_cDB: CFC290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC290 (Link to dictyBase) - - - Contig-U16382-1 CFC290E (Link to Original ... ctnlrrlcittcyftfrfsws*sy*lhdenln*twllihnnc*krnr*ry*reis ... ircigf*s*nancsliicireii*itrwssyynw**tfplsrstfptiil ...

  17. Dicty_cDB: CFC279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC279 (Link to dictyBase) - - - Contig-U16477-1 CFC279P (Link to Original ... sirerffigfgtwhwwctsfsqss*ti*lcisitllvatyss*yv*tlvl crn *sfmrtqisiikhwsrsksystmskrw*nya*ystsnskksw**lgwffry ...

  18. Dicty_cDB: CFC658 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC658 (Link to dictyBase) - - - Contig-U16291-1 CFC658P (Link to Original ... mino Acid sequence KIWVLTGDKQETAINIGFSCHLLTSDMRIIILNGS NQEDVHNQIQGAIDAYFSDDAENHQ NSGFALVVEGSCLNFALEGELKSVF ... klwlcigcrrfmsklclgrrieigfp*igcql*icyllsyhstsksssc*ngs *yitcry ignwxwckrcfydsssshwywy*ws*gyassygirlfdcti*f ... xxexnx*xg Frame B: KIWVLTGDKQETAINIGFSCHLLTSDMRIIILNGS NQEDVHNQIQGAIDAYFSDDAENHQ NSGFALVVEGSCLNFALEGELKSVF ... XLTW Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CFC658 (CFC658 ...

  19. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ... MANAGEMENT CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Establishment of advisory.... Please contact the Office of Personnel Management at the address shown below if you wish to present..., 2011 at 2 p.m. Location: U.S. Office of Personnel Management, Theodore Roosevelt Executive...

  20. Stratospheric loss and atmospheric lifetimes of CFC-11 and CFC-12 derived from satellite observations

    Directory of Open Access Journals (Sweden)

    K. Minschwaner

    2012-11-01

    Full Text Available The lifetimes of CFC-11 and CFC-12 have been evaluated using global observations of their stratospheric distributions from satellite-based instruments between the period 1992 and 2010. The CFC data sets are from the Cryogen Limb Array Etalon Spectrometer (CLAES, the Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA-1 and CRISTA-2, the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS, and the Atmospheric Chemistry Experiment (ACE. Stratospheric loss rates were calculated using an ultraviolet radiative transfer code with updated cross section and solar irradiance data. Mean steady state lifetimes based on these observations are 50.3 ± 16.8 yr for CFC-11 and 106.9 ± 21.7 yr for CFC-12, which are in reasonable agreement with the most recent WMO Ozone Assessment recommendations but are somewhat longer by 12% and 7%, respectively. There are two major sources of error in calculating lifetimes using this method. One error source is due to uncertainties in tropical stratospheric measurements, particularly for CFC-11. Another large contribution to the error arises from uncertainties in the penetration of solar ultraviolet radiation at wavelengths between 185 and 220 nm, primarily in the tropical stratosphere between 20 and 35 km altitude.

  1. Stratospheric loss and atmospheric lifetimes of CFC-11 and CFC-12 derived from satellite observations

    Directory of Open Access Journals (Sweden)

    K. Minschwaner

    2013-04-01

    Full Text Available The lifetimes of CFC-11 and CFC-12 have been evaluated using global observations of their stratospheric distributions from satellite-based instruments over the time period from 1992 to 2010. The chlorofluorocarbon (CFC datasets are from the Cryogen Limb Array Etalon Spectrometer (CLAES, the Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA-1 and CRISTA-2, the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS, and the Atmospheric Chemistry Experiment (ACE. Stratospheric loss rates were calculated using an ultraviolet radiative transfer code with updated cross section and solar irradiance data. Mean steady-state lifetimes based on these observations are 44.7 (36–58 yr for CFC-11 and 106.6 (90–130 yr for CFC-12, which are in good agreement with the most recent WMO ozone assessment. There are two major sources of error in calculating lifetimes using this method. The first important error arises from uncertainties in tropical stratospheric observations, particularly for CFC-11. Another large contribution to the error is due to uncertainties in the penetration of solar ultraviolet radiation at wavelengths between 185 and 220 nm, primarily in the tropical stratosphere between 20 and 35 km altitude.

  2. International research into chlorofluorocarbon (CFC) alternatives

    Energy Technology Data Exchange (ETDEWEB)

    Marseille, T.J.; Shankle, D.L.; Thurman, A.G.

    1992-05-01

    Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.

  3. "Annan finansiell verksamhet" - En tolkning i ljuset av CFC-lagstiftningen : En tolkning i ljuset av CFC-lagstiftningen

    OpenAIRE

    Kiryo, Josef

    2010-01-01

    The initial provisions concerning CFC-legislation were introduced 1990 and has since been subject to several revisions and adaptations. The fundamental purpose of the CFC-legislation is to prohibit and prevent tax evasion undertaken by such companies that own other foreign companies where generated income is subject to low rates of taxation. The CFC-legislation aims to provide the Swedish government with an op-portunity to tax this income. This is important in order to prevent tax avoidance a...

  4. CFC concentrations in fresh groundwater in Latvia

    Science.gov (United States)

    Bikše, J.; DÄ`liĆa, A.; Babre, A.; RetiÄ·e, I.; Raga, B.; PÄ`rkone, E.

    2012-04-01

    One of the main issues in groundwater studies is groundwater age, also known as residence time. This is important for investigating the groundwater filtration rate and to solve variety issues of groundwater use, management and protection. Groundwater age studies in Latvia have been rare, and the latest study, which defined the new results of age of groundwater using CFC dating method, was during years 2002 - 2006 and it was carried out by Denmark and Greenland Geological Survey (GEUS) and the Latvian State Geological Survey as a joint study on the impact of agriculture on groundwater quality in Latvia. Within the project "Interdisciplinary research groups and model system for groundwater studies" (PUMA) the studies of groundwater age by CFCs and 3H methods is continued. The concentration of tritium will be determined in about 60 samples, but the CFC concentration is now analyzed in 39 samples because previous studies have shown that Latvian CFC method is appropriate for aquifers to an average depth of 30-50 m. CFCs concentrations were analyzed in the laboratory at GEUS after Busenberg and Plummer described method by gas chromatography equipped with an EDC detector. Interpretation of the results was carried out by laboratory expert Troels Laier. Samples are taken on both from the unconfined aquifer and the first confined aquifer, the sampling interval varies from 5-10 m up to 120-130 m for tritium analysis and up to 80 m depth for most CFC analysis except one sample that comes from 128 m depth. It is stated that most of determined groundwater from both - confined and unconfined aquifer - has residence time of 35-55 years. So far, the results suggest that groundwater movement is fairly rapid in places where fractured dolomite forms the aquifer as the water residence time at 60-70 m depth is only 35-55 years. On the other hand, the composition of overlying Quaternary deposits (clay, glacial till loam or sand, sand - gravel sediments) has great importance on variations

  5. Dicty_cDB: CFC301 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC301 (Link to dictyBase) - - - Contig-U12859-1 | Contig-U16301-1 CFC301P ... kg*kycickw*qyyy* kckesngsryll*tsmsnhcckvctkw*lyckw*csr *ftylgyitkgtylksnlqsiew cnp*ycmdir*stfscsw*w*reiwcs ...

  6. Dicty_cDB: CFC347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC347 (Link to dictyBase) - - - Contig-U12859-1 | Contig-U16301-1 CFC347P ... kg*kycickw*qyyy *kckesngsryll*tsmsnhcckvctkw*lyckw*csr *ftylgyitkgtylksnlqsie wcnp*ycmdir*stfscsw*w*reiwcs ...

  7. Dicty_cDB: CFC325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC325 (Link to dictyBase) - - - Contig-U16240-1 CFC325P (Link to Original ... il**mvq***slfklffkls irsrslg*f*ynrwwwtictn*wcwiw*p*sip *vck*siqsvslf*assliystr*i*- -- ---vhmk*fqivnvtlqlvs ...

  8. Dicty_cDB: CFC602 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC602 (Link to dictyBase) - - - Contig-U16240-1 CFC602P (Link to Original ... sfnkwfnsddlcsnyflsyq ldldlwdkf*ynrwwwtictn*wcwiw*p*sip *vck*siqsvslf*assliystr*i** lfpffnyg*nlgflq*yfns*ss ...

  9. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...

  10. Dicty_cDB: CFC537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC537 (Link to dictyBase) - - - Contig-U16463-1 CFC537P (Link to Original ... d process for preparing catalase using the genetic engineering ... technology. 86 1e-32 4 AP004595 |AP004595.1 Oceano ...

  11. Dicty_cDB: CFC557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC557 (Link to dictyBase) - - - Contig-U16243-1 CFC557P (Link to Original ... o... 403 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 243 e-113 AM474896_9( AM4 ...

  12. Dicty_cDB: CFC614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC614 (Link to dictyBase) - - - Contig-U16243-1 CFC614P (Link to Original ... o... 753 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 411 e-113 AM474896_9( AM4 ...

  13. Dicty_cDB: CFC892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC892 (Link to dictyBase) - - - Contig-U16243-1 CFC892P (Link to Original ... o... 694 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 385 e-105 AM474896_9( AM4 ...

  14. Dicty_cDB: CFC445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC445 (Link to dictyBase) - - - Contig-U16243-1 CFC445E (Link to Original ... o... 760 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 419 e-116 AM474896_9( AM4 ...

  15. Dicty_cDB: CFC529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC529 (Link to dictyBase) - - - Contig-U16243-1 CFC529E (Link to Original ... o... 758 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 416 e-115 AM474896_9( AM4 ...

  16. Dicty_cDB: CFC254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce kylflflfffiifqhnni*l*FGINSVIFVFFFFXKGGXWVX--- Translated Amino Acid sequence (All Frames) Frame A: iniyfyfyffl*fsnit...s) Value N L16578 |L16578.1 Dictyostelium discoideum HIV1 TAT-binding protein homologous protein mRNA, complete...CF (Link to library) CFC254 (Link to dictyBase) - - - Contig-U15589-1 CFC254F (Link to Original site...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL http://dict...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC254Q.Seq.d/ Representative seq. ID CFC254F (Link to Original site

  17. Alternative non-CFC mobile air conditioning

    Energy Technology Data Exchange (ETDEWEB)

    Mei, V.C.; Chen, F.C.; Kyle, D.M.

    1992-09-01

    Concern about the destruction of the global environment by chlorofluorocarbon (CFC) fluids has become an impetus in the search for alternative, non-CFC refrigerants and cooling methods for mobile air conditioning (MAC). While some alternative refrigerants have been identified, they are not considered a lasting solution because of their high global warming potential, which could result in their eventual phaseout. In view of this dilemma, environmentally acceptable alternative cooling methods have become important. This report, therefore, is aimed mainly at the study of alternative automotive cooling methodologies, although it briefly discusses the current status of alternative refrigerants. The alternative MACs can be divided into work-actuated and heat-actuated systems. Work-actuated systems include conventional MAC, reversed Brayton air cycle, rotary vane compressor air cycle, Stirling cycle, thermoelectric (TE) cooling, etc. Heat-actuated MACs include metal hydride cooling, adsorption cooling, ejector cooling, absorption cycle, etc. While we are better experienced with some work-actuated cycle systems, heat-actuated cycle systems have a high potential for energy savings with possible waste heat applications. In this study, each altemative cooling method is discussed for its advantages and its limits.

  18. CFC elimination and replacement in China; Elimination et remplacement des CFC en Chine

    Energy Technology Data Exchange (ETDEWEB)

    Bingfeng, Y.; Yezheng, W.; Zhigang, W. [School of Energy and Power Engineering, Xi' an Jiaotong University (China)

    2002-07-01

    This paper describes the position, policy and goals of the Chinese government with respect to the protection of the ozone layer and to the suppression of ozone-damaging compounds. It presents the implementation of the programs and the realizations relative to the elimination of CFCs and other ozone-damaging substances in domestic refrigerating appliances, in air conditioners for cars and in the solvent cleaning industry. It suggests some measures to answer the challenge of CFC replacement. (J.S.)

  19. CFC and HFC recycling equipments: Test performances

    International Nuclear Information System (INIS)

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid

  20. Multimedia campaign.

    Science.gov (United States)

    2007-01-01

    Research Medical Center is part of one of the nation's largest health systems, Health Corporation of America, with hospitals across the South and Midwest. Research Medical Center recently launched a multimedia campaign featuring real doctors and touting the tagline, "These are the doctors you want." Following the October 2006 launch of the campaign, the hospital embarked on a regional publicity effort to promote the local doctors featured in the campaign. PMID:17361792

  1. Dicty_cDB: CFC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC263 (Link to dictyBase) - - - Contig-U16068-1 CFC263P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365137 |BD365137.1 Newly fou ...

  2. Dicty_cDB: CFC364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC364 (Link to dictyBase) - - - Contig-U16068-1 CFC364P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365137 |BD365137.1 Newly fou ...

  3. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  4. CFC environmental problems and cooling technology

    International Nuclear Information System (INIS)

    The aim of the report is to provide a broad survey of the technological problems imposed on the production of cooling systems by the demands for reduction in the use of chlorofluorocarbons as refrigerants. With regard to industrial research in this area the present situation is clarified and possible future developments are discussed. The influence of CFC gasses on the global environment and international and national legislation within this field are explained. Alternative refrigerants and cooling processes, and ways of reducing refrigerant leakage, are described. It is concluded that currently the use of alternative refrigerants is the policy which is generally accepted, and intensive research is being carried out in this field. R134a should substitute R12 in the cases of household refrigerators and air conditioning, and will soon be commercially available. The use of R22 and ammonia will be extended. This is a practical policy to follow up commercially, whereas the policy of alternative processes presents more problems because they are not so developed and there is less available know-how in this area. The possibilities for hermetic sealing of cooling systems are unrealistic and should anyway be regarded only as a supplement to alternative refrigerants. Within the European Community it is intended to provide standards and regulations in relation to air pollution from refrigerants. (AB) (58 refs.)

  5. Envisat MIPAS measurements of CFC-11: retrieval, validation, and climatology

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2008-03-01

    Full Text Available From July 2002 to March 2004 the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS aboard the European Space Agency's Environmental Satellite (Envisat measured nearly continuously mid infrared limb radiance spectra. These measurements are utilised to retrieve the global distribution of the chlorofluorocarbon CFC-11 by applying a new fast forward model for Envisat MIPAS and an accompanying optimal estimation retrieval processor. A detailed analysis shows that the total retrieval errors of the individual CFC-11 volume mixing ratios are typically below 10% and that the systematic components are dominating. Contribution of a priori information to the retrieval results are less than 5 to 10%. The vertical resolution of the observations is about 3 to 4 km. The data are successfully validated by comparison with several other space experiments, an air-borne in-situ instrument, measurements from ground-based networks, and independent Envisat MIPAS analyses. The retrieval results from 425 000 Envisat MIPAS limb scans are compiled to provide a new climatological data set of CFC-11. The climatology shows significantly lower CFC-11 abundances in the lower stratosphere compared with the Reference Atmospheres for MIPAS (RAMstan V3.1 climatology. Depending on the atmospheric conditions the differences between the climatologies are up to 30 to 110 ppt (45 to 150% at 19 to 27 km altitude. Additionally, time series of CFC-11 mean abundance and variability for five latitudinal bands are presented. The observed CFC-11 distributions can be explained by the residual mean circulation and large-scale eddy-transports in the upper troposphere and lower stratosphere. The new CFC-11 data set is well suited for further scientific studies.

  6. Envisat MIPAS measurements of CFC-11: retrieval, validation, and climatology

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2008-07-01

    Full Text Available From July 2002 to March 2004 the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS aboard the European Space Agency's Environmental Satellite (Envisat measured nearly continuously mid infrared limb radiance spectra. These measurements are utilised to retrieve the global distribution of the chlorofluorocarbon CFC-11 by applying a new fast forward model for Envisat MIPAS and an accompanying optimal estimation retrieval processor. A detailed analysis shows that the total retrieval errors of the individual CFC-11 volume mixing ratios are typically below 10% in the altitude range 10 to 25 km and that the systematic components dominate. Contribution of a priori information to the retrieval results are less than 5 to 10% and the vertical resolution of the observations is about 3 to 4 km in the same vertical range. The data are successfully validated by comparison with several other space experiments, an air-borne in-situ instrument, measurements from ground-based networks, and independent Envisat MIPAS analyses. The retrieval results from 425 000 Envisat MIPAS limb scans are compiled to provide a new climatological data set of CFC-11. The climatology shows significantly lower CFC-11 abundances in the lower stratosphere compared with the Reference Atmospheres for MIPAS (RAMstan V3.1 climatology. Depending on the atmospheric conditions the differences between the climatologies are up to 30 to 110 ppt (45 to 150% at 19 to 27 km altitude. Additionally, time series of CFC-11 mean abundance and variability for five latitudinal bands are presented. The observed CFC-11 distributions can be explained by the residual mean circulation and large-scale eddy-transports in the upper troposphere and lower stratosphere. The new CFC-11 data set is well suited for further scientific studies.

  7. Validation of ACE-FTS measurements of CFC-11, CFC-12, and HCFC-22 using ground-based FTIR spectrometers

    Science.gov (United States)

    Kolonjari, F.; Walker, K. A.; Mahieu, E.; Batchelor, R. L.; Bernath, P. F.; Boone, C.; Conway, S. A.; Dan, L.; Griffin, D.; Harrett, A.; Kasai, Y.; Kagawa, A.; Lindenmaier, R.; Strong, K.; Whaley, C.

    2013-12-01

    Satellite datasets can be an effective global monitoring tool for long-lived compounds in the atmosphere. The Atmospheric Chemistry Experiment (ACE) is a mission on-board the Canadian satellite SCISAT-1. The primary instrument on SCISAT-1 is a high-resolution infrared Fourier transform spectrometer (ACE-FTS) which is capable of measuring a range of gases including key chlorofluorocarbon (CFC) and hydrochlorofluorocarbon (HCFC) species. These families of species are of interest because of their significant contribution to anthropogenic ozone depletion and to global warming. To assess the quality of data derived from satellite measurements, validation using other data sources is essential. Ground-based Fourier transform infrared (FTIR) spectrometers are particularly useful for this purpose. In this study, five FTIR spectrometers located at four sites around the world are used to validate the CFC-11 (CCl3F), CFC-12 (CCl2F2), and HCFC-22 (CHClF2) retrieved profiles from ACE-FTS measurements. These species are related because HCFC-22 was the primary replacement for CFC-11 and CFC-12 in refrigerant and propellant applications. The FTIR spectrometers used in this study record solar absorption spectra at Eureka (Canada), Jungfraujoch (Switzerland), Poker Flat (USA), and Toronto (Canada). The retrieval of CFC-11, CFC-12, and HCFC-22 are not standard products for many of these instruments, and as such, a harmonization of retrieval parameters between the sites has been conducted. The retrievals of these species from the FTIR spectra are sensitive from the surface to approximately 20 km, while the ACE-FTS profiles extend from approximately 6 to 30 km. For each site, partial column comparisons between coincident measurements of the three species and a validation of the observed trends will be discussed.

  8. CONTROL TECHNOLOGY OVERVIEW REPORT: CFC-11 EMISSIONS FROM FLEXIBLE POLYURETHANE FOAM MANUFACTURING

    Science.gov (United States)

    The report gives results of an engineering evaluation of technical options to reduce chlorofluorocarbon (CFC) emissions from flexible slabstock and molded polyurethane foam manufacturing plants. Among the technical options studied were recovery and recycle of CFC-11, alternative ...

  9. ORGANIZATIONAL CAMPAIGNING

    DEFF Research Database (Denmark)

    Hertel, Frederik

    2015-01-01

    approach will in be named: organizational campaigning and means (e.g. Kotter, 2012, p. 9 and Clegg, Kornberger & Pitsis, 2009) that the manager takes control with communication and communication cannels in order to ensure successful organizational changes. Since the changes were not succeeding the approach...

  10. Campaigns Matter

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Pedersen, Rasmus Tue

    2014-01-01

    Election campaigns are more than simple competitions for votes; they also represent an opportunity for voters to become politically knowledgeable and engaged. Using a large-scale web panel (n≈5,000), we track the development of political knowledge, internal efficacy and external efficacy among vo...

  11. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    OpenAIRE

    S. Tegtmeier; Hegglin, M. I.; Anderson, J; Funke, B.; Gille, J.; Jones, A; Smith, L; von Clarmann, T.; K. A. Walker

    2016-01-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991–2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal stru...

  12. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION

    Science.gov (United States)

    The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...

  13. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2010-02-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters have been retrieved from a large number of cruises and collected into a new database called CARINA (CARbon IN the Atlantic. These data have been merged into three sets of files, one for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The first part of the CARINA database consists of three files, one for each CARINA region, containing the original, non-adjusted cruise data sets, including data quality flags for each measurement. These data have then been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the second part of the CARINA data product. This consists of three files, one for each CARINA region, which contain adjustments to the original data values based on recommendations from the CARINA QC procedures, along with calculated and interpolated values for some missing parameters.

    Here we present an overview of the QC of the CFC data for the AMS region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of data from some cruises, while other data were flagged to be of questionable quality, which excluded them from the final data product.

  14. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  15. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  16. Characterisation of Churn Flow Coalescers (CFC) in vertical pipes

    OpenAIRE

    Kanu, Aimé Uzochukwu

    2013-01-01

    The Gas-Liquid Cylindrical Cyclone (GLCC) separator is commonly used for the separation of oil and gas mixtures flowing from the well head. Similar to the design used by other separators, it has an inlet and two outlets for gas and liquid respectively. However, the inlet to the separator can either be single or dual type. The pipeline connection from the upstream preconditioning equipment (CFC) is inclined downwards and has a tangential inlet slot. The essence of having a downward inclination...

  17. Overview of CFC replacement issues for household refrigeration

    Science.gov (United States)

    Vineyard, E. A.; Roke, L.; Hallett, F.

    In 1974, the famous ozone depletion theory of Rowland and Molina claimed that chlorofluorocarbons (CFCs) diffuse into the stratosphere where they are broken down by photolysis to release chlorine atoms that catalytically destroy ozone. Although the understanding of the science is still imperfect, there is little doubt that CFCs play a major role in the Antarctic ozone hole phenomenon and the decline in ozone observed in the rest of the world. Another issue that has become increasingly important is the potential of CFCs to change the earth's temperature and to modify the climate. While the main impact in global warming is made by increased concentrations of carbon dioxide, CFCs and other trace gases also contribute to this effect. In an effort to respond to the global environmental threat, a CFC protocol was adopted during a diplomatic conference in Montreal. This document, known as the Montreal Protocol, was ratified in 1988 and put into effect on January 1, 1989. In accordance with Article 6 of the Montreal Protocol, the countries that signed the agreement shall periodically assess the control measures provided for in the Protocol. As part of that assessment process, household refrigeration was investigated to determine the status of CFC-12 replacements. The conclusion was that much progress has been made towards finding a suitable replacement. Compressors designed for HFC-134a have efficiencies comparable to those for CFC-12 and acceptable reliability tests have been obtained with ester lubricants. In addition, other replacements such as R-152a and refrigerant mixtures exist, but will require more study. Cycle options, such as the Stirling cycle, may be viable, but are further out in the future. The impact of new refrigerants is expected to result in elimination of CFC-12 consumption in developed countries by 1997 and in developing countries by 2005.

  18. Stratospheric ozone in the post-CFC era

    Directory of Open Access Journals (Sweden)

    F. Li

    2009-03-01

    Full Text Available Vertical and latitudinal changes in the stratospheric ozone in the post-chlorofluorocarbon (CFC era are investigated using simulations of the recent past and the 21st century with a coupled chemistry-climate model. Model results reveal that, in the 2060s when the stratospheric halogen loading is projected to return to its 1980 values, the extratropical column ozone is significantly higher than that in 1975–1984, but the tropical column ozone does not recover to 1980 values. Upper and lower stratospheric ozone changes in the post-CFC era have very different patterns. Above 15 hPa ozone increases almost latitudinally uniformly by 6 Dobson Unit (DU, whereas below 15 hPa ozone decreases in the tropics by 8 DU and increases in the extratropics by up to 16 DU. The upper stratospheric ozone increase is a photochemical response to greenhouse gas induced strong cooling, and the lower stratospheric ozone changes are consistent with enhanced mean advective transport due to a stronger Brewer-Dobson circulation. The model results suggest that the strengthening of the Brewer-Dobson circulation plays a crucial role in ozone recovery and ozone distributions in the post-CFC era.

  19. Stratospheric ozone in the post-CFC era

    Directory of Open Access Journals (Sweden)

    F. Li

    2008-12-01

    Full Text Available Vertical and latitudinal changes in the stratospheric ozone in the post-chlorofluorocarbon (CFC era are investigated using simulations of the recent past and the 21st century with a coupled chemistry-climate model. Model results reveal that, in the 2060s when the stratospheric halogen loading is projected to return to its 1980 values, the extratropical column ozone is significantly higher than that in 1975–1984, but the tropical column ozone does not recover to 1980 values. Upper and lower stratospheric ozone changes in the post-CFC era have very different patterns. Above 15 hPa ozone increases almost latitudinally uniformly by 6 Dobson Unit (DU, whereas below 15 hPa ozone decreases in the tropics by 8 DU and increases in the extratropics by up to 16 DU. The upper stratospheric ozone increase is a photochemical response to greenhouse gas induced strong cooling, and the lower stratospheric ozone changes are consistent with enhanced mean advective transport due to a stronger Brewer-Dobson circulation. The model results suggest that the strengthening of the Brewer-Dobson circulation plays a crucial role in ozone recovery and ozone distributions in the post-CFC era.

  20. Non-CFC air conditioning for transit buses

    Energy Technology Data Exchange (ETDEWEB)

    Pesaran, A.A.; Parent, Y.O.; Bharathan, D.

    1992-11-01

    In the United Sates, more than 80% of transit city buses are air conditioned. Vapor compression refrigeration systems are standard for air conditioning buses and account for up to 25% of fuel consumption in the cooling season. Vapor compression devices use chlorofluorocarbons (CFCs), chemicals that contributes to Earths`s ozone depletion and to global warming. Currently, evaporative cooling is an economical alternative to CFC vapor compression refrigeration for air conditioning buses. It does not use CFCs but is restricted in use to arid climates. This limitation can be eliminated by dehumidifying the supply air using desiccants. We studied desiccant systems for cooling transit buses and found that the use of a desiccant-assisted evaporative cooling system is feasible and can deliver the required cooling. The weight and the size of the desiccant system though larger than vapor compression systems, can be easily accommodated within a bus. Fuel consumption for naming desiccant systems was about 70% less than CFC refrigeration system, resulting in payback periods of less than 2.5 years under most circumstances. This preliminary study indicated that desiccant systems combined with evaporative cooling is a CFC-free option to vapor compression refrigeration for air conditioning of transit buses. The concept is ready to be tested in a fun prototype scale in a commercial bus.

  1. Non-CFC air conditioning for transit buses

    Energy Technology Data Exchange (ETDEWEB)

    Pesaran, A.A.; Parent, Y.O.; Bharathan, D.

    1992-11-01

    In the United Sates, more than 80% of transit city buses are air conditioned. Vapor compression refrigeration systems are standard for air conditioning buses and account for up to 25% of fuel consumption in the cooling season. Vapor compression devices use chlorofluorocarbons (CFCs), chemicals that contributes to Earths's ozone depletion and to global warming. Currently, evaporative cooling is an economical alternative to CFC vapor compression refrigeration for air conditioning buses. It does not use CFCs but is restricted in use to arid climates. This limitation can be eliminated by dehumidifying the supply air using desiccants. We studied desiccant systems for cooling transit buses and found that the use of a desiccant-assisted evaporative cooling system is feasible and can deliver the required cooling. The weight and the size of the desiccant system though larger than vapor compression systems, can be easily accommodated within a bus. Fuel consumption for naming desiccant systems was about 70% less than CFC refrigeration system, resulting in payback periods of less than 2.5 years under most circumstances. This preliminary study indicated that desiccant systems combined with evaporative cooling is a CFC-free option to vapor compression refrigeration for air conditioning of transit buses. The concept is ready to be tested in a fun prototype scale in a commercial bus.

  2. Organizational Campaigning

    DEFF Research Database (Denmark)

    Hertel, Frederik

    2015-01-01

    This conference paper will explore the difference between communicating changes and changing communication. Based on a case study in which a manager applies two quite different approaches to organizational communication in order to change the organization he is leading. The first and failing...... approach will in be named: organizational campaigning and means (e.g. Kotter, 2012, p. 9 and Clegg, Kornberger & Pitsis, 2009) that the manager takes control with communication and communication cannels in order to ensure successful organizational changes. Since the changes were not succeeding the approach...... is replaced with a new approach which will be named organizing communication. During the case analysis we will see that this change in approach not only change the managers perception of communication but also his perception of the organization he is leading....

  3. Interannual variability of CFC-11 absorption by the ocean: an offline model study

    Energy Technology Data Exchange (ETDEWEB)

    Valsala, Vinu; Maksyutov, Shamil [CGER, National Institute for Environmental Studies, Tsukuba (Japan); Alsibai, Hayyan M. [Tsukuba University, Graduate School of System and Information Engineering, Tsukuba (Japan); Ikeda, Motoyoshi [Hokkaido University, Graduate School of Earth System Sciences, Sapporo (Japan)

    2011-04-15

    The global ocean Chlorofluorocarbon (CFC-11) was simulated in an offline model driven by re-analysis ocean currents in order to identify the mechanisms of interannual to interdecadal variability of air-sea CFC fluxes. The model was forced with the observed anthropogenic perturbations of atmospheric CFC-11 from the post industrial period (1938) following the OCMIP-II flux protocols along with the observed winds from 1960 to 1999 in the formulation of surface gas exchanges. The model ocean CFC-11 inventories, at the end of 1990s, accounted approximately 1% of the total atmospheric CFC-11, which is consistent with the corresponding observations. The mid-to-high latitude oceans were venue for strong (weak) oceanic sinks (sources) of CFC-11 during the winter (summer) months. The Southern Ocean (south of 40 S) and the North Atlantic (north of 35 N) provided two largest sinks of CFC-11, through which 31.4 and 14.6% of the global ocean CFC-11 entered, respectively. The eastern tropical Pacific Ocean exhibited large interannual variability of CFC-11 flux with a strong (weak) sink during La Nina (El Nino) years and represented 36% of the global CFC-11 flux variability. The North Atlantic and Southern Ocean were found as regions of large sink efficiency: a capacity to sink more CFC than outsource, although it reduced by 80 and 70%, respectively, in the last 40 years compared to 1960. The sink to source ratio of global ocean CFC-11 fluxes were reduced from 90 to 50% in the last 40 years. This indicates a saturation of CFC in the above-thermocline subsurface that makes the upper ocean less efficient in absorbing CFC in recent decades. A positive trend in CFC sink is now limited to the Southern Ocean, central tropical Pacific and western boundary current regions which possess active upwelling of old water with long time since last atmospheric contact. However, a globally averaged trend was a reduced CFC-11 sink, by emitting 30% of the total ocean CFC-11 that was absorbed during

  4. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Ronald H. Brown Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Section A16S_2005 (11 January - 24 February, 2005)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-08-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb 14C system parameters performed during the A16S_2005 cruise, which took place from January 11 to February 24, 2005, aboard research vessel (R/V) Ronald H. Brown under the auspices of the National Oceanic and Atmospheric Administration (NOAA). The R/V Ronald H. Brown departed Punta Arenas, Chile, on January 11, 2005, and ended its cruise in Fortaleza, Brazil, on February 24, 2005. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and the National Science Foundation as part of the CLIVAR/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 121 stations. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), fugacity of CO2 (fCO2), total alkalinity (TALK), pH, dissolved organic carbon (DOC), CFC, 14C, hydrographic, and other chemical measurements. The R/V Ronald H. Brown A16S_2005 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  5. Thermal response for divertor mock-up using surface-modified CFC tile

    International Nuclear Information System (INIS)

    It is necessary for the divertor plate to be actively cooled in order to remove the extremely high heat load from the fusion plasma. CFC material has been considered as one of the candidate plasma-facing materials because of its high thermal shock resistance. However, CFC causes several problems, such as the enhancement of hydrogen recycling, large erosion due to oxygen and radiation enhanced sublimation where the temperature exceeds about 1000 C. In this study the surface of CFC, CX-3002U, was converted to B4C and SiC by using a chemical vapor reaction, CVR. The thermal response properties of divertor mock-ups made by these materials and CFC were examined. These mock-ups were irradiated by electron beams with heat flux up to 15 MW/m2. The surface temperature rise of B4C-converted CFC tile was the highest and that of CFC the lowest. This difference was consistent with the value of the thermal conductivity e.g. B4C-converted CFC has the lowest thermal conductivity, 200 W/m K and CFC has the highest one, 450 W/m K. The heat flux that increases the surface temperature to 1000 C was approximately 8, 10 or 11 MW/m2 for B4C-converted CFC, SiC-converted CFC or CFC, respectively. Thermal cycling tests with more than 2000 shots were also conducted for these mock-ups. No deterioration in the heat transfer for each mock-up was found for the heat flux which increased the surface temperature to 1000 C. (orig.)

  6. EPA proposes CFC alternatives policy, ozone levels drop

    International Nuclear Information System (INIS)

    The Environmental Protection Agency has proposed its Significant New Alternatives Policy (SNAP), under which EPA will manage use of chlorofluorocarbon (CFC) substitutes. EPA also proposed a preliminary list of acceptable and unacceptable uses of CFC substitutes. Under SNAP, manufacturers or importers must notify EPA of the intent to sell, use, or distribute substitutes 90 days before introducing them into interstate commerce, and provide EPA with health and safety studies. EPA will determine eligibility for specific uses based on flammability, chemical toxicity, costs, global warming potential, and environmental and occupational exposures. Hydrochlorofluorocarbon (HCFC)-141b was targeted by EPA for restrictions in some applications involving polyurethane foams and solvent systems. Acceptable HCFC-141b uses include foams for insulation and flotation rigid polyurethane. HCFC-141b makers say the rule making does not come as a surprise. Elf Atochem says it has been working with EPA on the alternatives policy for the past two years and has steered away from unacceptable uses. Allied-Signal also says it has considered the limitations. Even while EPA plotted the management of CFC substitutes, there was further bad news on the stratospheric ozone layer. Government scientists at the National Aeronautics and Space Administrations's (NASA) Goddard Space Flight Center (Greenbelt, MD) say global ozone levels were 2%-3% lower in the second half of 1992 than at any previous time and that mid-latitudes Northern Hemisphere levels dropped 13%-14% below normal in January. Separately, NASA and Jet Propulsion Laboratory researchers report satellite measurements finding chlorine monoxide-a key villain in ozone destruction-in alarmingly high levels in the Arctic stratosphere. The NSA/JPL measurements-which had not been done before-are open-quote very soberingclose quotes, says Joe Waters, a JPL scientist

  7. Materials compatibility and lubricants research on CFC-refrigerant substitutes

    Science.gov (United States)

    Szymurski, S. R.; Hawley, M.; Hourahan, G. C.; Godwin, D. S.

    1994-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  8. High heat flux testing of CFC composites for the tokamak physics experiment

    Science.gov (United States)

    Valentine, P. G.; Nygren, R. E.; Burns, R. W.; Rocket, P. D.; Colleraine, A. P.; Lederich, R. J.; Bradley, J. T.

    1996-10-01

    High heat flux (HHF) testing of carbon fiber reinforced carbon composites (CFC's) was conducted under the General Atomics program to develop plasma-facing components (PFC's) for Princeton Plasma Physics Laboratory's tokamak physics experiment (TPX). As part of the process of selecting TPX CFC materials, a series of HHF tests were conducted with the 30 kW electron beam test system (EBTS) facility at Sandia National Laboratories, and with the plasma disruption simulator I (PLADIS-I) facility at the University of New Mexico. The purpose of the tests was to make assessments of the thermal performance and erosion behavior of CFC materials. Tests were conducted with 42 different CFC materials. In general, the CFC materials withstood the rapid thermal pulse environments without fracturing, delaminating, or degrading in a non-uniform manner; significant differences in thermal performance, erosion behavior, vapor evolution, etc. were observed and preliminary findings are presented below. The CFC's exposed to the hydrogen plasma pulses in PLADIS-I exhibited greater erosion rates than the CFC materials exposed to the electron-beam pulses in EBTS. The results obtained support the continued consideration of a variety of CFC composites for TPX PFC components.

  9. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11

    Science.gov (United States)

    The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...

  10. Prediction of future disposal of end-of-life refrigerators containing CFC-11.

    Science.gov (United States)

    Yazici, Burcu; Can, Zehra S; Calli, Baris

    2014-01-01

    The objective of this study was to predict the number of refrigerators containing CFC-11 blown isolation foam and the amount of CFC-11 banked in these refrigerators. By using a Weibull-based survival function, the number of CFC-11 containing and still-functioning refrigerators was estimated to be approximately 1.6 million in 2013 in Turkey. In order to determine the amount of CFC-11 in the isolation foam of these refrigerators, polyurethane (PU) foam samples were taken from a refrigerator manufactured in 1993 and the quantity of CFC-11 was analyzed by a GC-MS. It was determined that 113-195 mg CFC-11/g PU remains in the PU foam depending on the location such as door, sides, top and bottom. Knowing that a mid-sized refrigerator contains 4 kg PU on average, the total amount of PU foam to be disposed of is 6344 tons when the CFC-11 containing refrigerators in Turkey become obsolete in the near future. Furthermore, 717-1237 tons of CFC-11 are expected to be banked in the PU foam of these refrigerators which will exert an equivalent amount of ozone depleting potential (ODP). In addition, the global warming potential will vary between 3.4 and 5.9 million tons of CO2. PMID:24112854

  11. Field Campaign Guidelines

    Energy Technology Data Exchange (ETDEWEB)

    Voyles, J. W. [DOE ARM Climate Research Facility, Washington, DC (United States); Chapman, L. A. [DOE ARM Climate Research Facility, Washington, DC (United States)

    2015-12-01

    This document establishes a common set of guidelines for the Atmospheric Radiation Measurement (ARM) Climate Research Facility for planning, executing, and closing out field campaigns. The steps that guide individual field campaigns are described in the Field Campaign Tracking System and are specifically tailored to meet the scope of each field campaign.

  12. Energy and global warming impacts of CFC alternative technologies

    International Nuclear Information System (INIS)

    The primary objective of this study is to develop representative indications of the relative energy use, associated CO2 emissions, and total equivalent warming impact (TEWI) of viable options to replace CFCs in their major energy-related application areas. It was motivated, in part, by a concern that most attention to date has focused on the DIRECT global warming effect of CFC's and their alternatives, with adequate attention being paid to the INDIRECT effect of the CO2 emissions arising from the differences in energy consumption by systems using different alternatives. The DIRECT and INDIRECT contributions are combined in this analysis to determine the TEWI of the various technical options. The study is international in scope and takes into account significant differences in present CFC end-use practices, sources of energy, and other societal factors between Europe, Japan, and North America. This study should be considered an overview of key issues. The analysis addressed CFCs as well as alternative chemicals and technology alternatives in uses such as refrigeration, foam insulation, and metal and electronic cleaning and drying processes

  13. Global CFC-11 (CCl3F and CFC-12 (CCl2F2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-12-01

    Full Text Available Vertical profiles of CFC-11 (CCl3F and CFC-12 (CCl2F2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  14. Assessing the applicability of global CFC and SF6 input functions to groundwater dating in Britain

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) and sulphur hexafluoride (SF6) are increasingly being used to date groundwaters. While these trace gases are generally well-mixed in the atmosphere, local atmospheric excesses (LAEs) have been found in some parts of the world, thereby affecting the interpretation of data from groundwater studies. To investigate the possibility of LAEs in Britain, mixing ratios of CFC-11, CFC-12 and SF6 were measured in soil gases from two large conurbations (London and Birmingham) and a smaller urban area, Bristol. Most mixing ratios for CFC-12 and SF6 were 6 input functions based on the NH-AMR curves appears justified for Britain. (author)

  15. Campaign Consultants - Client Payments

    Data.gov (United States)

    City of San Francisco — Campaign Consultants are required to report ���economic consideration�۝ promised by or received from clients in exchange for campaign consulting services during the...

  16. The "Know Stroke" Campaign

    Science.gov (United States)

    ... Current Issue Past Issues Special Section The "Know Stroke" Campaign Past Issues / Summer 2007 Table of Contents ... campaign for the U.S. Hispanic community. 1 Know Stroke A stroke occurs when the blood supply to ...

  17. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2015-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) abord the European satellite Envisat have been retrieved from versions MIPAS/4.61-MIPAS/4.62 and MIPAS/5.02-MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon borne Cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS stratospheric aircraft (MIPAS-STR), the satellite borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS) as well as the ground based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS Envisat. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (FR: July 2002-March 2004) and were used to validate MIPAS Envisat CFC-11 and CFC-12 products during that time, as well as ILAS-II profiles. In general, we find that MIPAS Envisat shows slightly higher values for CFC-11 at the lower end of the profiles (below ~ 15 km) and in a comparison of HATS ground-based data and MIPAS Envisat measurements at 3 km below the tropopause. Differences range from approximately 10-50 pptv (~ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high-bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11, so that differences at the lower end of the profile (below ~ 15 km) and in the comparison of HATS and MIPAS Envisat measurements taken at 3 km below the tropopause mainly stay within 10-50 pptv (~ 2-10 %) for the RR and

  18. PERBANDINGAN IMPLEMENTASI ADVERTISING CAMPAIGN

    OpenAIRE

    Francisca Hanna , Febrianti

    2013-01-01

    Advertising campaign merupakan serangkaian bentuk iklan melalui berbagai media dan berpusat pada satu tema dalam satu waktu. Tujuan utama advertising campaign adalah menyampaikan pesan dalam suatu tema yang diluncurkan kepada masyarakat sehingga tema tersebut menjadi ciri khas produk. Peluncuran tema campaign oleh Coca Cola dan Pepsi yang merupakan rival dalam kategori beverage merupakan obyek dari penelitian ini. Kesuksesan sebuah tema advertising campaign dilihat dengan menggunakan paramet...

  19. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  20. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  1. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  2. Metered Dose Inhalation Formulations of Salbutamol Sulphate Using Non-CFC Propellant Tetrafluoroethane

    Directory of Open Access Journals (Sweden)

    S. S. Shrikhande

    2011-10-01

    Full Text Available Salbutamol sulphate metered dose inhaler formulations were developed with chlorine free, non-CFC propellant Tetrafluoroethane. Suspension formulations were prepared with 4 mg of oleic acid as the surfactant and varying proportions of ethanol as the co-solvent. Developed formulations were subjected to various qualitative and quantitative tests to ensure proper stability of the final package. In-vitro drug deposition studies using Twin impinger and Anderson cascade impactor indicated a net respirable fraction of 34-36.7% for the optimized formulation. Stability studies showed that the formulation was stable for a period of three months under all storage conditions. Effects of different adaptors and metering valve designs on the performance of the formulation were also checked. Comparison of optimized formulation with commercial CFC and non-CFC formulations exhibited equivalent performance characteristics. Thus, Tetrafluoroethane proved to be an environment friendly substitute for CFC propellants in metered dose inhalation formulations.

  3. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  4. Dating groundwater with trifluoromethyl sulfurpentafluoride (SF 5CF3), sulfur hexafluoride (SF6), CF 3Cl (CFC-13), and CF2Cl2 (CFC-12)

    Science.gov (United States)

    Busenberg, E.; Plummer, L.N.

    2008-01-01

    [1] A new groundwater dating procedure using the transient atmospheric signal of the environmental tracers SF5CF3, CFC-13, SF6, and CFC-12 was developed. The analytical procedure determines concentrations of the four tracers in air and water samples. SF 5CF3 and CFC-13 can be used to date groundwaters in some environments where the CFCs and SF6 have previously failed because these new tracers have increasing atmospheric input functions, no known terrigenic source, and are believed to be stable under reducing conditions. SF5CF3 has a dating range from 1970 to modern; the mixing ratio (mole fraction) in North American air has increased from the detection limit of 0.005 parts per trillion (ppt) to the 2006 mole fraction of about 0.16 ppt. No evidence was found for degradation of SF5CF3 in laboratory anaerobic systems. The solubility of SF5CF3 was measured in water from 1 to 35??C. Groundwater samples that contained large amounts of terrigenic SF6 did not contain terrigenic SF 5CF3. CFC-13 is a trace atmospheric gas with a dating range in groundwater of about 1965 to modem. CFC-13 has been used primarily in very low-temperature refrigeration; thus groundwater environments are less likely to be contaminated with nonatmospheric sources as compared to other widely used CFCs. Because of the low solubility of SF5CF3 and CFC-13 in water, an excess air correction must be applied to the apparent ages. The new dating procedure was tested in water samples from wells and springs from Maryland, Virginia, and West Virginia.

  5. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    OpenAIRE

    S. Tegtmeier; Hegglin, M. I.; Anderson, J; Funke, B.; Gille, J.; Jones, A; Smith, L; T. von Clarmann; K. A. Walker

    2015-01-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed inter-comparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991–2010. The inter-comparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudina...

  6. Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate

    Directory of Open Access Journals (Sweden)

    Gopala Krishna Murthy Talasila

    2013-06-01

    Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.

  7. Measurements of the Surface Tension for CFC Alternatives

    Science.gov (United States)

    Higashi, Yukihiro; Ikeda, Tadamitsu; Kuwana, Takeaki; Okada, Masaaki

    Measurements of the surface tension for two kinds of CFC alternatives, i.e., HCFC-123 (2,2-dichloro-1,1,1-trifluoroethane), and HFC-134a (1,1,1,2-tetrafluoroethane), have been made by the differential capillary rise method (DCRM) and the vertical plate method (VPM). For HCFC-123, 15 data have been obtained by DCRM in the temperature range between 273 and 333 K within the uncertainty of ±0.1mN/m, and 21 data have been obtained by VPM in the temperature range between 273 and 290 K within the uncertainty of ±0.2mN/m. For HFC-134a, 17 data have been obtained by DCRM in the temperature range between 276 and 329 K within the uncertainty of ±0.1mN/m. The uncertainty of temperature measurement by DCRM is estimated within ±20mK, whereas that by VPM within ±30mK. New correlations of the surface tension for HCFC-123 and HFC-134a have been also proposed.

  8. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 2. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte 2

    Energy Technology Data Exchange (ETDEWEB)

    Relevant to the development of a plan for the recovery, recycling and reclamation of chlorofluorocarbons (CFC's), this paper tables a list of operating task activities and recommendations. They include: the creation of incentives for CFC recovery and recycling; the setting up of a recovered materials monitoring system; the drafting up of emission limits; information dissemination for greater public awareness; collaboration with owners and builders of plants using CFC's; development of suitable waste management and disposal procedures for CFC residuals.

  9. The Eurosprite 2005 campaign

    DEFF Research Database (Denmark)

    Arnone, Enrico; Berg, Peter; Boberg, Fredrik; Bór, József; Chanrion, Olivier Arnaud; Enell, Carl-Fredrik; Ignaccolo, Massimiliano; Mika, Ágnes; Odzimek, Anna; van der Velde, Oscar; Farges, Thomas; Laursen, Steen; Neubert, Torsten; Sátori, Gabriella

    2008-01-01

    In this report we give an overview of the Eurosprite observation programme and present the results of the Eurosprite 2005 campaign. These campaigns search for occurrences of transient luminous events, such as red sprites, above thunderstorms in France, Spain, northern Italy, Switzerland and south...... optical and non-optical means of sprite detection. The campaigns will be extended into a global sprite-watch partnership and in addition space-borne instruments will be deployed....

  10. CFC1 Mutations in Patients with Transposition of the Great Arteries and Double-Outlet Right Ventricle

    OpenAIRE

    Goldmuntz, Elizabeth; Bamford, Richard; Karkera, Jayaprakash D.; dela Cruz, June; Roessler, Erich; Muenke, Maximilian

    2002-01-01

    Recent investigations identified heterozygous CFC1 mutations in subjects with heterotaxy syndrome, all of whom had congenital cardiac malformations, including malposition of the great arteries. We hypothesized that a subset of patients with similar types of congenital heart disease—namely, transposition of the great arteries and double-outlet right ventricle, in the absence of laterality defects—would also have CFC1 mutations. Our analysis of the CFC1 gene in patients with these cardiac disor...

  11. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  12. High-temperature resistant, thermally sprayed diffusion barrier coatings on CFC lightweight materials; Hochtemperaturbestaendige, thermisch gespritzte Diffusionsbarriereschichten auf CFC-Leichtbauchargiergestellen

    Energy Technology Data Exchange (ETDEWEB)

    Drehmann, Rico; Rupprecht, Christian; Wielage, Bernhard; Lampke, Thomas [Technische Univ. Chemnitz (Germany). Inst. fuer Werkstoffwissenschaft und Werkstofftechnik (IWW); Gilbert, Maria; Uhlig, Volker; Trimis, Dimosthenis [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Waermetechnik und Thermodynamik (IWTT); Heuer, Volker [ALD Vacuum Technologies GmbH, Hanau (Germany)

    2013-03-15

    In heat treating processes as well as in high temperature brazing processes, charge carriers enable the positioning and transport of work pieces. Recently, charge carriers consisting of graphite or carbon fibre reinforced carbon (CFC) are used. The main disadvantage of charge carriers based on CFC is the undesirable carburization of the overlying components due to diffusion processes. Under this aspect, thermally sprayed coatings are applied on CFC and tested with respect to their suitability as a high-temperature diffusion barrier. The ceramic powders aluminium oxide, aluminium oxide/chromium oxide, aluminium oxide/titanium oxide and zirconium oxide/yttrium oxide are used as a coating material which is processed by means of the powder flame spraying as well as atmospheric plasma spraying. Molybdenum and silicon carbide are used as an adhesive layer. The coating materials aluminium oxide and aluminium oxide/chromium oxide on siliconized CFC presented excellent results. This supplies a large potential of application for thermally sprayed ceramic coatings on carbon-based lightweight materials.

  13. SIMULATION OF PERFORMANCE OF CHLORINE-FREE FLURORINATED ETHERS AND FLUORINATED HYDROCARBONS TO REPLACE CFC-11 AND CFC-114 IN CHILLERS

    Science.gov (United States)

    The paper discusses simulation of the performance of chlorine-free fluorinated ethers and fluorinated hydrocarbons as potential long-term replacements for CFC-11 and -114. Modeling has been done with in-house refrigeration models based on the Carnahan-Starling-DeSantis Equation o...

  14. Upwelling velocity and ventilation in the Mauritanian upwelling system estimated by CFC-12 and SF6 observations

    Science.gov (United States)

    Tanhua, Toste; Liu, Mian

    2015-11-01

    Transient tracer data (CFC-12 and SF6) from three oceanographic field campaigns to the Mauritanian Upwelling area conducted during winter, spring and summer from 2005 to 2007 is presented. The transient tracers are used to constrain a possible solution to the transient time distribution (TTD) along 18°N and to quantify the mean ages in vertical sections perpendicular to the coast. We found that an Inverse Gaussian distribution where the ratio of the moments Δ and Γ equals 1.2 is a possible solution (Δ/Γ = 1.2) of the TTD. The transient tracers further show considerable under-saturation in the mixed layer during the winter and spring cruises that can only be maintained by mixing or upwelling by tracer-poor water from below the mixed layer. We use dissipation data from microstructure measurements and the tracer depth distribution to quantify the flux of tracers to the mixed layer by vertical diffusivity and wind data from the ship to quantify the air-sea flux. We then use the magnitude of the under-saturation in the mixed layer to estimate the advective upwelling velocity which is the balance the first two processes, in a steady state assumption. We find that the upwelling velocities range from less than 1 to 5.6 × 10- 5 m s- 1 (SF6 transient tracer data for calculating upwelling velocity, and found an overall uncertainty of roughly ± 50%.

  15. The Sprite 2003 Campaign

    DEFF Research Database (Denmark)

    Neubert, T.; Laursen, S.; Rasmussen, I. L.;

    2003-01-01

    During the northern hemisphere summer of 2003, from July 18 to September 18, a sprite observation campaign was conducted with measurements from Southern Europe, coordinated with measurements from the magnetically conjugate region in South Africa. The goal of the campaign was to investigate the el...

  16. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  17. Behaviour of Molten Beryllium with ITER Reference CFC NB31 (SNECMA) Under Moisture

    International Nuclear Information System (INIS)

    A dramatic exothermic reaction with aluminium, a carbide forming metal, has been observed in Tore Supra. A small rod of 30 mm3, acting as a temperature proof, was enclosed in a blind hole of a thermally loaded low density PAN fiber CFC 1001Z block (SGL), which reached a temperature of about 1300 oC during plasma operation. The molten aluminium had penetrated the carbon matrix through to the block's front surface. After component removal and roughly 2 months of exposure to air in the laboratory, the CFC in front of the blind hole was found to have been locally destroyed over a crater-shaped structure of 2 cm diameter. This was due to an enhanced decomposition of aluminium carbide to aluminium hydroxide. Beryllium (Be), also a carbide forming metal, is used on the ITER first wall. Carbon reinforced carbon (CFC) of type NB31 (Snecma) covers the vertical divertor targets. It is expected that beryllium material will be transported during normal and/or off normal plasma operation to the carbon based divertor targets to form beryllium carbide. During air venting or a supposed accidental in-vessel water leak event, it will react exothermically under moisture to beryllium oxide. In order to investigate to which extent the CFC structure could be modified or eventually destroyed, this reaction process has been simulated with a CFC block NB31 of size 16 x 32 x 20 mm3, where about 40 mm3 of Be S65 C (Brush Wellmann) has been placed in a previously drilled blind hole of 4 mm diameter oriented parallel to the high conductivity pitch fibers. When melted, by heating the CFC block, the Be penetrated in the carbon matrix through to the block's front surface. The front surface of the CFC was then exposed to humidity (tap water) for about 2 weeks and then stored for a further 2 months in a closed vinyl bag under atmospheric pressure after which the sample was analysed. After the exposure of the CFC to humidity, reaction products have been detected at the surface of the carbon fibre

  18. Proposal and realization advertising campaign

    OpenAIRE

    RYCHLÁ, Marie

    2008-01-01

    The Bachelor Paper contains proposal and realization advertising campaign, including make charge for cost amount. The advertising campaign is made for chosen product of firm. Advertising campaign is planning by the medium of broadsheet and advertising on the Internet.

  19. Surface damage characteristics of CFC and tungsten with repetitive ELM-like pulsed plasma irradiation

    Science.gov (United States)

    Kikuchi, Y.; Nishijima, D.; Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M.; Kawai, T.; Ueda, Y.; Fukumoto, N.; Doerner, R. P.

    2011-08-01

    Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of ˜0.5 ms, incident ion energy of ˜30 eV, and surface absorbed energy density of ˜0.3-0.7 MJ/m2. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of ˜0.7 MJ/m2, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.

  20. Interaction of deuterated hydrocarbon ions and Ar+ with CFC surfaces at room temperature

    International Nuclear Information System (INIS)

    Full text: Carbon-fibre-composite (CFC) is a suitable material for covering walls facing plasma, such as walls of fusion reactors, and therefore the interactions of different projectile ions (deuterated hydrocarbons and Ar+) with hydrocarbon- covered CFC surfaces at room temperature were investigated. The incident energies ranged from a few eV up to 100 eV. Mass spectra of the product ions and their dependence on the incident energy of the projectiles were measured and compared. The results were similar to highly oriented pyrolytic graphite (HOPG) surfaces. This indicates, that the hydrocarbons covering the surface determine the fragmentation and chemical reactivity of the surface. Additionally, K+ and Na+ ions were observed, which originate from contamination of the CFC material. (author)

  1. High RF power test of a CFC antenna module for lower hybrid current drive

    International Nuclear Information System (INIS)

    A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m2 were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m2, could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10-2 Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)

  2. Catalytic hydrolysis of CFC-12 over solid acid Ti(SO4)2

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The catalytic hydrolysis of dichlorodifluoromethane (CFC-12) was investigated over solid acid Ti(SO4)2. The catalytic activity decreased with the calcination temperature. When space velocity was 6 l h-1 g-cat-1, the CFC-12 conversion at 310oC over Ti(SO4)2 calcined at 350oC remained about 98.5% during 360 h on stream, and the selectivity to by-products remained zero. The findings enlarged the scope of traditional catalyst systems for the CFCs decomposition.

  3. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  4. Campaigning on radiation standards

    International Nuclear Information System (INIS)

    The author outlines the controversy surrounding ICRP recommendations of dose limits for workers and members of the public and the ALARA concept and sketches suggestions for campaigning for radiation standards. (U.K.)

  5. Model in simuliranje delovanja odprtega hladilnega postopka brez uporabe CFC: Design and simulation of a CFC-free open air-conditioning system:

    OpenAIRE

    Stritih, Uroš; Novak, Peter; Može, Mitja

    2001-01-01

    In this paper a model is presented and its operation of a cooling process that uses air-as the cooling medium. In the introduction, conventional refrigerants are compared with an alternative refrigerant - air. The system construction and the thermodynamic model are presented. The model is used to study the performance of a CFC-free air-conditioning system, in which some parameters of the individual components are variable while the others are constant for the referenced data. The characterist...

  6. On the accuracy of the IWM-CFC approximation in differentially rotating relativistic stars

    CERN Document Server

    Iosif, Panagiotis

    2014-01-01

    We determine the accuracy of the conformal flatness (IWM-CFC) approximation for the case of single, but strongly differentially rotating relativistic stars. We find that for the fastest rotating and most relativistic polytropic models, the deviation from full general relativity is below 5% for integrated quantities and below 10% for local quantities, such as the angular velocity. Furthermore, we study the deviation of the IWM-CFC approximation from full general relativity by evaluating and comparing different error indicators. We find that for the models that are not near the maximum mass, a simple error indicator constructed from local values of the metric potentials is more indicative of the accuracy of the IWM-CFC approximation than an error indicator that is based on the Cotton-York tensor. Furthermore, we construct a simple, linear empirical relation that allows for the estimation of the error made by the IWM-CFC approximation and which only involves the flattening of the star due to rotation and the min...

  7. Tensile fracture characterization of braze joined copper-to-CFC coupon assemblies

    Science.gov (United States)

    Trester, P. W.; Valentine, P. G.; Johnson, W. R.; Chin, E.; Reis, E. E.; Colleraine, A. P.

    1996-10-01

    A vacuum brazing process was used to join a broad spectrum of carbon-fiber reinforced carbon matrix composite (CFC) materials, machined into cylindrical coupons, between coupons of oxygen-free copper, the braze alloy was a copper-base alloy which contained only low activation elements (Al, Si, and Ti) relative to a titanium baseline specification. This demonstration was of particular importance for plasma facing components (PFCs) under design for use in the Tokamak Physics Experiment (TPX); the braze investigation was conducted by General Atomics for the Princeton Plasma Physics Laboratory. A tensile test of each brazed assembly was conducted. The results from the braze processing, testing, and fracture characterization studies of this reporting support the use of CFC's of varied fiber architecture and matrix processing in PFC designs for TPX. Further, the copper braze alloy investigated is now considered to be a viable candidate for a low-activation bond design. The prediction of plasma disruption-induced loads on the PFCs in TPX requires that joint strength between CFC tiles and their copper substrate be considered in design analysis and CFC selection.

  8. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  9. Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components

    Science.gov (United States)

    Chevet, G.; Martin, E.; Boscary, J.; Camus, G.; Herb, V.; Schlosser, J.; Escourbiac, F.; Missirlian, M.

    2011-10-01

    The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.

  10. Global warming impacts of CFC alternative technologies: Combining fluorocarbon and CO2 effects

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) are on their way out, due to their role in stratospheric ozone depletion and the related international Montreal Protocol agreement and various national phaseout timetables. As the research, engineering development, and manufacturing investment decisions have ensued to prepare for this transition away from CFCs, the climate change issue has emerged and there has recently been increased attention on the direct global warming potential (GWP) of the fluorocarbon alternatives as greenhouse gases. However, there has been less focus on the indirect global warming effect arising from end-use energy changes and associated CO2 emissions. A study was undertaken to address these combined global warming effects. A concept of Total Equivalent Warming Impact (TEWI) was developed for combining the direct and indirect effects and was used for evaluating CFC-replacement options available in the required CFC transition time frame. Analyses of industry technology surveys indicate that CFC-user industries have made substantial progress toward near-equal energy efficiency with many HCFC/HFC alternatives. The findings also bring into question the relative importance of the direct effect in many applications and stress energy efficiency when searching for suitable CFC alternatives. For chillers, household refrigerators, and unitary air-conditioning or heat pump equipment, changes in efficiency of only 2--5% would have a greater effect on future TEWI than completely eliminating the direct effect

  11. The Effect of Diapycnal Mixing on the Ventilation and CFC-11 Uptake in the Southern Ocean

    Institute of Scientific and Technical Information of China (English)

    Yongqi GAO; Helge DRANGE

    2004-01-01

    The Miami Isopycnic Coordinate Ocean Model (MICOM) is used to investigate the effect of diapycnal mixing on the oceanic uptake of CFC-11 and the ventilation of the surface waters in the Southern Ocean (south of 45°S). Three model experiments are performed: one with a diapycnal mixing coefficient Kd (m2 s-1) of 2 × 10-7/N (Expt. 1), one with Kd = 0 (Expt. 2), and one with Kd = 5 × 10-8/N (Expt. 3), N (s-1) is the Brunt-Vaisala frequency. The model simulations indicate that the observed vertical distribution of CFC-11 along 88°W (prime meridian at 0°E) in the Southern Ocean is caused by local ventilation of the surface waters and westward-directed (eastward-directed) isopycnic transport and mixing from deeply ventilated waters in the Weddell Sea region. It is found that at the end of 1997, the simulated net ocean uptake of CFC-11 in Expt. 2 is 25% below that of Expt. 1. The decreased uptake of CFC-11 in the Southern Ocean accounts for 80% of this difference. Furthermore, Expts. 2 and 3 yield far more realistic vertical distributions of the ventilated CFC-waters than Expt. 1. The experiments clearly highlight the sensitivity of the Southern Ocean surface water ventilation to the distribution and thickness of the simulated mixed layer. It is argued that inclusion of CFCs in coupled climate models could be used as a test-bed for evaluating the decadal-scale ocean uptake of heat and CO2.

  12. Missing Halocarbon Source? Data from a Recent New England Landfill Field Campaign

    Science.gov (United States)

    Hodson, E. L.; Prinn, R.

    2005-12-01

    Anthropogenic emissions of long-lived halocarbons, namely chlorofluorocarbons (CFCs), hydrofluorocarbons (HCFCs), methyl chloroform (CH3CCl3), and carbon tetrachloride (CCl4) represent the largest source of atmospheric chlorine. All of these gases with the exception of the HCFCs are banned under the Montreal Protocol from being produced within the US or imported into the US. Several recent studies indicate that lingering emissions of these compounds are occurring around urban areas in the US. One possible source for these emissions is leakage from landfills. Landfill emissions are not currently considered explicitly in the published industry based global estimations of emissions for these gases. Previous studies have been done in the UK and suggested that this leakage may be significant (on the order of 1 Gg/year in the UK) in comparison with industry emissions estimates, but no measurement based estimates of Montreal Protocol gas emissions from US landfills have been previously reported. To further investigate this idea, flask samples were taken during the winter of 2004 at two Eastern Massachusetts landfills and during the summer of 2004 at four landfills in southwestern Britain. These studies showed more data was needed to create clear regression relationships between the landfill parameters (waste composition, landfill age, and total trash volume) and halocarbon gas emissions of CFC-12, CFC-11, CFC-113, and CH3CCl3. In a movement towards creating the necessary database of measurements, an intensive Fall 2005 landfill measurement campaign was conducted in New England. The results from this campaign will be presented, analyzed and compared to our results from the above two 2004 investigations.

  13. INTEGRATED ADVERTISING CAMPAIGN

    Directory of Open Access Journals (Sweden)

    Adina Claudia NEAMŢU

    2010-06-01

    Full Text Available Campaign and especially advertising campaign represents one of the variables of the marketing mix, an important one, being difficult to separate its contribution from the one of the other elements. Irrespective of the specific object that is behind an advertising company, the investment will be retrieved only if the right information is transmitted to the right persons in the right way. This is difficult to accomplish if the advertising responsible in that firm do not understand appropriately: the market nature; the product nature; the distribution channels nature; the communication channels nature – available advertising supports and their features

  14. Results of the JET real-time disruption predictor in the ITER-like wall campaigns

    International Nuclear Information System (INIS)

    Highlights: •JET real-time disruption predictor with metallic wall 991 discharges analyzed. •Predictor training has been carried out with JET C wall data. •Success, false alarm and missed alarm rates are 98.4%, 0.9% and 1.6%, respectively. •Alarms are triggered in average 426 ms before the disruption. -- Abstract: The impact of disruptions in JET became even more important with the replacement of the previous Carbon Fiber Composite (CFC) wall with a more fragile full metal ITER-like wall (ILW). The development of robust disruption mitigation systems is crucial for JET (and also for ITER). Moreover, a reliable real-time (RT) disruption predictor is a pre-requisite to any mitigation method. The Advance Predictor Of DISruptions (APODIS) has been installed in the JET Real-Time Data Network (RTDN) for the RT recognition of disruptions. The predictor operates with the new ILW but it has been trained only with discharges belonging to campaigns with the CFC wall. 7 real-time signals are used to characterize the plasma status (disruptive or non-disruptive) at regular intervals of 32 ms. After the first 3 JET ILW campaigns (991 discharges), the success rate of the predictor is 98.36% (alarms are triggered in average 426 ms before the disruptions). The false alarm and missed alarm rates are 0.92% and 1.64%

  15. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2002-01-01

    Wednesday 13 November 2002 in restaurant nr 2, from 8.30 to 16.30 hrs will be held a blood donors campaign, organized by the Etablissement de Transfusion de Haute-Savoie If you already have a card giving your blood group, please bring this with you.

  16. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion d'Annemasse will be held at CERN on Tuesday 14 November 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  17. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2002-01-01

    Tuesday 19 March 2002 in restaurant nr 2, from 9.00 to 16.30 hrs A blood donors campaign, organized by the Centre de Transfusion sanguine of Geneva If you already have a card giving your blood group, please bring this with you.

  18. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2000-01-01

    A blood donors campaign, organized by the Établissement de Transfusion de Rhône-Alpes will be held at CERN on Tuesday 14 November 2000 in restaurant nr 2, from 8.30 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  19. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion Sanguine of Geneva will be held at CERN on Tuesday 13 March 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  20. Campaign Finance: Reporter Guide

    Science.gov (United States)

    Wieder, Ben

    2014-01-01

    Campaign finance might seem like the exclusive province of political reporters, but there are many good reasons why authors should be paying attention--both in races for education positions and in other key races at the local, state, and federal levels with implications for education. Basic math is a necessary skill and familiarity with a…

  1. The Eurosprite 2005 campaign

    DEFF Research Database (Denmark)

    Arnone, Enrico; Berg, Peter; Boberg, Fredrik;

    2008-01-01

    and southwestern Germany. Low-light video cameras are used to register the events. Simultaneously, meteorological observations and continuous recordings of electromagnetic emissions in the VLF-ELF-ULF range and of infrasound are carried out. During the Eurosprite 2005 campaign, two camera systems were operated...

  2. Antipiracy Campaign Exasperates Colleges

    Science.gov (United States)

    Rampell, Catherine

    2008-01-01

    This article reports on the withdrawal of some universities' support of a music industry's campaign against music piracy on their campuses. Talk to the chief information officer at just about any American university, and he will probably say that his institution has bent over backward to help the Recording Industry Association of America curb…

  3. New computer security campaign

    CERN Multimedia

    Alizée Dauvergne

    2010-01-01

    A new campaign is taking shape to promote computer security. The slogan “SEC_RITY is not complete without U!” reminds users of the importance of their contribution. The campaign kicks off on 10 June with a public awareness day in the Council Chamber.   The new campaign, organised by CERN’s computer security team, will focus on prevention and involving the user. “This is an education and awareness-raising campaign for all users at CERN,” explains Stefan Lueders, in charge of computer security. “Every day, we register thousands of computer attacks against CERN: there are attempts to tamper with web pages, hack into user accounts, take over servers, and much more. A successful attack could mean confidential user information being divulged, services being interrupted or data being lost. It could even affect operations at CERN. Another factor is the damage that a successful attack could inflict on the Organization’s reputation. &...

  4. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V John V. Vickers Cruise in the Pacific Ocean (WOCE Section P13, NOAA CGC92 Cruise, August 4 - October 21, 1992)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, A.

    2001-01-11

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO{sub 2}) and total alkalinity (TALK) at hydrographic stations during the R/V John V. Vickers oceanographic cruise in the Pacific Ocean (Section P13). Conducted as part of the World Ocean Circulation Experiment (WOCE) and the National Oceanic and Atmospheric Administration's Climate and Global Change Program, the cruise began in Los Angeles, California, on August 4, 1992, with a transit line (Leg 0) to Dutch Harbor, Alaska. On August 16, the ship departed Dutch Harbor on Leg 1 of WOCE section P13. On September 15, the R/V John V. Vickers arrived in Kwajalein, Marshall Islands, for emergency repairs, and after 11 days in port departed for Leg 2 of Section P13 on September 26. The cruise ended on October 21 in Noumea, New Caledonia. Measurements made along WOCE Section P13 included pressure, temperature, salinity [measured by a conductivity, temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO{sub 2} , and TALK. The TCO{sub 2} was measured by coulometry using a Single-Operator Multiparameter Metabolic Analyzer (SOMMA). The overall precision and accuracy of the analyses was {+-}2 {micro}mol/kg. Samples collected for TALK were measured by potentiometric titration; precision was {+-}2 {micro}mol/kg. The CO{sub 2} -related measurements aboard the R/V John V. Vickers were supported by the U.S. Department of Energy. The WOCE Section P13 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center. The NDP consists of two oceanographic data files, two FORTRAN 90 data-retrieval routine files, a documentation file, and this printed report, which describes the contents and format of all files as well as the procedures and methods used to obtain the data. Instructions on how to access the data are provided.

  5. CFC1 Mutations in Patients with Transposition of the Great Arteries and Double-Outlet Right Ventricle

    Science.gov (United States)

    Goldmuntz, Elizabeth; Bamford, Richard; Karkera, Jayaprakash D.; dela Cruz, June; Roessler, Erich; Muenke, Maximilian

    2002-01-01

    Recent investigations identified heterozygous CFC1 mutations in subjects with heterotaxy syndrome, all of whom had congenital cardiac malformations, including malposition of the great arteries. We hypothesized that a subset of patients with similar types of congenital heart disease—namely, transposition of the great arteries and double-outlet right ventricle, in the absence of laterality defects—would also have CFC1 mutations. Our analysis of the CFC1 gene in patients with these cardiac disorders identified two disease-related mutations in 86 patients. The present study identifies the first autosomal single-gene defect for these cardiac malformations and indicates that some cases of transposition of the great arteries and double-outlet right ventricle can share a common genetic etiology with heterotaxy syndrome. In addition, these results demonstrate that the molecular pathway involving CFC1 plays a critical role in normal and abnormal cardiovascular development. PMID:11799476

  6. Relative abundance estimations of chengal tree in a tropical rainforest by using modified Canopy Fractional Cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study challenged estimates of relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of trees species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying trees species composition

  7. Relative abundance estimations of Chengal trees in a tropical rainforest by using modified canopy fractional cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study estimates relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of tree species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying tree species composition

  8. Inoculation in Political Campaign Communication.

    Science.gov (United States)

    Pfau, Michael; Burgoon, Michael

    1988-01-01

    Posits a strategy of resistance to the influence of attack messages in political campaigns. Finds that political campaign messages can be designed to inoculate supporters of candidates against subsequent attack messages of opposing candidates. (MS)

  9. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  10. Leak monitoring for CFC's, HCFC's, HFC's and oxygen depletion: Recent developments

    International Nuclear Information System (INIS)

    The implementation of the Montreal Protocol and Title VI of the Clean Air Act of 1990 are having significant effects on the supply and cost of halocarbon refrigerants. In the US, there will be no new CFC's produced after 1995. Conservation measures which include recovery and recycling are enhanced by continuous monitoring for leaks in refrigeration systems. Some of the non-ozone depleting substitutes for CFC's have toxicity and flammability properties which require continuous monitoring for health and safety. Both economic and safety considerations have led to an increased use of monitoring instruments for halocarbon refrigerant emissions. Halocarbon refrigerants are colorless, odorless and, in general, boil at or below room temperature. In addition, they are high molecular weight compounds with vapor densities three to five times that of air. When refrigerants escape from closed systems, they can be expected to settle into low lying areas (in the absence of air movement)

  11. Tungsten coatings electro-deposited on CFC substrates from oxide molten salt

    International Nuclear Information System (INIS)

    Tungsten is considered as plasma facing material in fusion devices because of its high melting point, its good thermal conductivity, its low erosion rate and its benign neutron activation properties. On the other hand, carbon based materials like C/C fiber composites (CFC) have been used for plasma facing materials (PFMs) due to their high thermal shock resistance, light weight and high strength. Tungsten coatings on CFC substrates are used in the JET divertor in the frame of the JET ITER-like wall project, and have been prepared by plasma spray (PS) and other techniques. In this study, tungsten coatings were electro-deposited on CFC from Na2WO4–WO3 molten salt under various deposition parameters at 900 °C in air. In order to obtain tungsten coatings with excellent performance, the effects of pulse duration ratio and pulse current density on microstructures and crystal structures of tungsten coatings were investigated by X-ray diffraction (XRD, Rigaku Industrial Co., Ltd., D/MAX-RB) and a scanning electron microscope (SEM, JSM 6480LV). It is found that the pulsed duration ratio and pulse current density had a significant influence on tungsten nucleation and electro-crystallization phenomena. SEM observation revealed that intact, uniform and dense tungsten coatings formed on the CFC substrates. Both the average grain size and thickness of the coating increased with the pulsed current density. The XRD results showed that the coatings consisted of a single phase of tungsten with the body centered cubic (BCC) structure. The oxygen content of electro-deposited tungsten coatings was lower than 0.05%, and the micro-hardness was about 400 HV

  12. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  13. A SUCCESSFUL ADVERTISING CAMPAIGN

    OpenAIRE

    Gabriela VÂLCEANU

    2011-01-01

    ”TO ADVERTISE OR NOT TO ADVERTISE?” is the question which continually confronts the business man. The importance of advertising has long been recognized by the more enlightened members of the business and industrial world. Strategies for a successful advertising business campaign are an important factor for every company and business. As many of you know advertising and promotion are all around us. Whether you watch television, listen to driving on the highway, flipping through a magazine or ...

  14. Drunk Driving Campaign

    OpenAIRE

    Christoffersen, Mette Buhl; Vogel, Klara Elisa Pingel

    2014-01-01

    This project evaluates a communication product, consisting of three flush-ad posters against drunk driving. The target group of this campaign is young men in the ages 18-22 in the outskirts of Denmark. The project's scientific theoretical approach is phenomenology which will give insight in the target groups life situation, furthermore the social constructivist perspective is used to understand the target group's opinions in relation to product and subject drunk driving because of the interac...

  15. Safety Campaign Continues

    CERN Multimedia

    2002-01-01

    If you see this poster, stop and read it! This is the third poster produced by TIS Division as part of its information campaign on health and safety in the workplace. It provides statistics on occupational accidents at CERN. You will see that, as in the rest of Europe, falls, slips and trips continue to be the main cause of accident. So, eyes open and take care! For more information : http://safety.cern.ch/

  16. Issues and recommendations related to replacement of CFC-114 at the uranium enrichment gaseous diffusion plant

    International Nuclear Information System (INIS)

    The operating uranium enrichment gaseous diffusion plants (GDPs) in Portsmouth, Ohio and Paducah, Kentucky, which are operated for the United States Department for Energy by Martin Marietta Energy Systems (MMES), currently use a chlorofluorocarbon (CFC-114) as the primary process stream coolant. Due to recent legislation embodied in the Clean Air Act, the production of this and other related chlorofluorocarbons (CFCS) are to be phased out with no production occurring after 1995. Since the plants lose approximately 500,000 pounds per year of this process stream coolant through various leaks, the GDPs are faced with the challenge of identifying a replacement coolant that will allow continued operation of the plants. MMES formed the CFC Task Team to identify and solve the various problems associated with identifying and implementing a replacement coolant. This report includes a review of the work performed by the CFC Task Team, and recommendations that were formulated based on this review and upon original work. The topics covered include; identifying a replacement coolant, coolant leak detection and repair efforts, coolant safety concerns, coolant level sensors, regulatory issues, and an analytical decision analysis

  17. Manufacturing and testing of a copper/CFC divertor mock-up for JET

    International Nuclear Information System (INIS)

    An actively cooled divertor is a possible option for future developments at The Joint European Torus (JET). A proof of principle actively cooled tile has been produced in order to qualify the relevant manufacturing technologies and the non destructive control processes. In this frame Ansaldo Ricerche (ARI) has been involved in the construction of a mock-up comprising 6 OFHC copper tubes for water cooling that are brazed to a plate made out of carbon fibre composite (CFC). The final objective was the high heat flux testing of the mock-up at JET in order to evaluate the general behaviour of the component under relevant operating conditions. The key point of the work was the realisation of a sound joint by adapting the expertise gained in ARI in previous R and D activities on brazing heterogeneous materials. Reliable methods for ultrasonic examinations of the pieces were also set up. For successful application to the JET pumped divertor a water-cooled CFC target plate must show surface temperatures of 2. Furthermore, global hydraulic considerations specific to JET limit the system pressure to 0.7 MPa. In such a design, critical heat flux is not the key limit, rather the reliability of the CFC-copper joint in terms of extent of wetting. First tests in the neutral beam test bed at JET show an adequate response for fluxes up to 15 MW/m2. (orig.)

  18. CFC-11 destruction by microwave torch generated atmospheric-pressure nitrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Jasinski, Mariusz; Mizeraczyk, Jerzy; Zakrzewski, Zenon [Centre for Plasma and Laser Engineering, Institute of Fluid Flow Machinery, Polish Academy of Sciences, Gdansk (Poland); Ohkubo, Toshikazu [Department of Electrical and Electronic Engineering, Oita University, Oita (Japan); Chang Jenshih [Department of Engineering Physics, McMaster University, Hamilton, ON (Canada)

    2002-09-21

    A novel plasma method and its application for destruction of Freons using a moderate-power (several hundred watts) microwave torch discharge (MTD) in atmospheric-pressure flowing nitrogen are presented. The capability of the MTD to decompose Freons is demonstrated using a chlorofluorocarbon CCl{sub 3}F (Freon CFC-11) as an example. The gas flow rate and microwave power (2.45 GHz) delivered to the MTD were 1-3 litre min{sup -1} and 200-400 W, respectively. Concentration of the CFC-11 in the nitrogen was up to 50%. The results show that the decomposition efficiency of CFC-11 is up to 100% with the removal rate of several hundred g h{sup -1} and energy efficiency of about 1 kg kWh{sup -1}. This impressive performance, superior to that of other methods, is achieved without generating any significant unwanted by-products. As a result of this investigation, a relatively low-cost prototype system for Freon destruction based on a moderate-power MTD and a scrubber is proposed. (author)

  19. The Movember campaign

    DEFF Research Database (Denmark)

    Thomsen, Frederik B; Mikkelsen, Marta K; Hansen, Rikke B; Brasso, Klaus

    2016-01-01

    AIMS: The aims of the present study were to investigate referral patterns and the diagnosis of prostate cancer (PCa) before and after the Movember campaign was initiated in Denmark. METHODS: All men (n=2817) referred to the Department of Urology at Frederiksberg Hospital with suspicion of having....../100.000 in the Movember period (RR 1.25 [95% CI 1.16-1.35]). In contrast to what we anticipated, there was no increase in referral in the months following the campaign. The incidence rates of men diagnosed with PCa and low-risk PCa were similar in the Movember period and the pre-Movember period (PCa: RR 1.......08 [0.97-1.21]; low-risk PCa: RR 1.29 [0.98-1.73]). CONCLUSIONS: After the initiation of the Movember campaign a significant decline in the PSA level at referral and an increase in the number of patients referred under suspicion of PCa was observed; however, only minor differences in referral patterns...

  20. Framatome's 1997 advertisement campaign

    International Nuclear Information System (INIS)

    As many other companies involved in the nuclear business, Framatome was initially concentrating on corporate advertisements in business newspapers and magazines. The first goal was to concentrate on our traditional nuclear core business, while selecting the protection of the environment at large, and particularly the greenhouse effect, one of the most sensible issues of the moment. The 1997 campaign was shaped around the need to motivate European decision makers, while maintaining a domestic consensus towards nuclear power for the future resumption of constructions. The brief elaborated for Ad agencies was roughly threefold: elaborate simple messages, unquestionable, and explained with serenity; put emphasis on the benefits of nuclear power for the environment; establish a balanced comparison between nuclear and fossil fuels. A pre-test was conducted with about 100 people, half of which from the energy sector, and politicians, mainly members of the French and European Parliaments, the other half from the general public. Being accustomed to a usually discrete, if not 'ashamed' nuclear communication, people were generally surprised by such an optimistic tone about nuclear power, but agreed, on average. The campaign lasted one month (spread over June-July 97), and the three selected ads appeared successively in the form of a colour double page. Beyond nuclear magazines, the media plan included French daily newspapers le Figaro, le Monde, les Echos, Liberation, and weekly magazines: le Point, le Nouvel Observateur, I'Express, etc. All of them are intended for middle to high social class readers. In addition, some advertisements were inserted in The European Voice, a weekly publication reaching Brussels Commission and European parliament members. As an average, the campaign was perceived as dynamic (69%), and original (61%). But credibility and conviction were poor (resp 33%, 26%), probably because it was coincident with La Hague being on the carpet. On the other hand

  1. Cyber-campaigning in Denmark

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2014-01-01

    We set out to analyze the application and effect of cyber-campaigning among candidates at the 2011 Danish general election campaign in order to provide hard evidence on whether new technologies are electorally decisive, or whether traditional off-line campaigning still makes sense. First, both web...... candidates are not significantly more likely to use cyber-campaigning tools and activities. Third, the analysis of the effect of cyber-campaigning shows that the online score has an effect on the inter-party competition for personal votes, but it does not have a significant effect when controlling for other...

  2. Strategic campaigns and redistributive politics

    DEFF Research Database (Denmark)

    Schultz, Christian

    2007-01-01

    The article investigates strategic, informative campaigning by two parties when politics concern redistribution. Voters are uncertain about whether parties favour special groups. Parties will target campaigns on groups where most votes are gained by informing about policies. In equilibrium......, campaigning will be most intensive in groups where the uncertainty is largest and where voters are most mobile, most likely to vote, most receptive to campaigns and relatively uninformed initially. These groups will become more informed about policy. Parties will therefore gain more votes by treating these...... groups well so these groups will gain from strategic campaigning. Welfare effects are assessed...

  3. The Effect of Political Campaigns

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller

    Abstract There are many somewhat competing models for measuring political campaign effects. This paper discusses six types of campaign effects. 1) The civic engagement effect that argues people will learn and become more political engaged due to the campaign. 2) The priming studies argue that...... campaigns affect what issues the voters evaluate the parties and leaders on and sequentially their vote. 3) The minimal effect models argue that campaigns only mobilize existing prepositions and voters only seek to confirm their intermediated vote choice. 4) The memory based models argue that the vote...... measure campaign effect during the next national election for the Danish parliament. The project began in January 2008. This paper presents the general idea of the project and operationalized various classic models of campaign effects. The draft questionnaire is also included. The online-web-panel will...

  4. The Sprite 2005 Observation Campaign

    DEFF Research Database (Denmark)

    Chanrion, Olivier Arnaud; Crosby, Norma; Armone, Enrico;

    2007-01-01

    -month duration of this campaign, all of them took turns in operating the system and making their own night observations. The ongoing campaign activities were constantly advertised and communicated via an Internet blog. In summary the campaign required all the CAL young scientists to embark on experimental work...... outreach programmes for the young scientists hired. Educational activities were based on the following elements: national PhD programmes, activities at CAL and other meetings, a dedicated summer school, and two European sprite observational campaigns. The young scientists were strongly involved in the...... latter and, as an example, the "EuroSprite2005" observational campaign is presented in detail. Some of the young scientists participated in the instrument set-up, others in the campaign logistics, some coordinated the observations, and others gathered the results to build a catalogue. During the four...

  5. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system. PMID:24965005

  6. How campaigns polarize the electorate

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2015-01-01

    increase in their preference for their most preferred party and a decrease for their least liked party as the campaign progresses. These trends show that the political campaign polarizes the electorate by increasing the affective distance between in-group party and out-group party preferences, thereby...... resulting in stronger political polarization after the campaign than before the campaign. The data utilized in this study is a large six-wave panel-study of Danish voters’ party preferences during the Danish parliamentary election of 2011. Thus, the analysis provides evidence of the minimal effect theory...... and of political polarization within a multi-party context....

  7. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 1. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte prima

    Energy Technology Data Exchange (ETDEWEB)

    1993-02-01

    This report develops a plan for the recovery recycling, and reclamation of chlorofluorocarbons (CFC's) for reuse in Canada to ensure that the large consumer and marketplace inventory of these compounds does not enter the atmosphere. Reuse is further necessary for future operation of equipment when the production and importation of CFC's becomes severely restricted or is eliminated. The report also deals with the need to recover hydrochlorofluorocarbons (HCFC's) for reuse. A harmonized national action plan containing a set of agreed-upon objectives and tasks is developed to provide a basis for federal and provincial programs, regulatory action, and data development.

  8. Chapter 11. Comparison of the CFC technique with other techniques (3H, 3H/3He, 85Kr)

    International Nuclear Information System (INIS)

    The applications of CFC technique to solve specific hydrological problems are discussed in other Chapters. It should be pointed out that very often interpretations of CFC data need to rely extensively on additional data. Measurements of concentrations of dissolved gases, such as dissolved oxygen, to determine if there is potential for microbial degradation, can be extremely useful. Noble gas measurements are useful in defining recharge temperature and excess air. Measurements of dissolved nitrogen and argon can also be used to determine recharge temperature and excess air and recognize environments undergoing denitrification. Measurements of dissolved methane are useful in recognizing environments in which all three CFCs can be degraded. Isotope techniques are also useful tools. Tritium measurements have proven particularly useful in helping to validate CFC apparent ages

  9. Pre-Brazed Casting and Hot Radial Pressing: A Reliable Process for the Manufacturing of CFC and W Monoblock Mockups

    International Nuclear Information System (INIS)

    ENEA association is involved in the European International Thermonuclear Experimental Reactor (ITER) R-and-D activities and in particular for the manufacturing of high heat flux plasma-facing components (HHFC), such as the divertor targets, the baffles and the limiters: During the last years ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and hot isostatic pressing (HIPping). A new manufacturing process has been set up and tested. It was successfully applied for the manufacturing of W armoured monoblock mockups. This technique is the HRP (Hot Radial Pressing) based on performing a radial diffusion bonding between the cooling tube and the armour tile by pressurizing only the internal tube and by keeping the joining zone in vacuum and at the required bonding temperature. The heating is obtained by a standard air furnace. The next step was to apply the HRP technique for the manufacturing of CFC armoured monoblock components. For this purpose some issues have to be solved like as the low CFC tensile strength, the pure copper interlayer between the heat sink and the armour necessary to mitigate the stress at the joint interface and the low wettability of the pure copper on the CFC matrix. This paper reports the research path followed to manufacture a medium scale vertical target CFC and W armoured mockup by HRP. An ad hoc rig able to maintain the CFC in a compressive constant condition was also designed and tested. The casting of a soft copper interlayer between the tube and the tile was performed by a new technique: the Pre-Brazed Casting (PBC, ENEA patent). Some mock-ups with three NB31 CFC tiles were successfully manufactured and tested to thermal fatigue using electron beam facilities. They all reached at least 1000 cycles at 20 MW/m2 without suffering any damage. The manufactured medium scale vertical target mock-up is now under testing at the FE2000 (France) facility. (author)

  10. 75 FR 43395 - Campaign Travel

    Science.gov (United States)

    2010-07-26

    ... of 2007. See Final Rules on Campaign Travel, 74 FR 63951 (Dec. 7, 2009) (the ``Travel Rules... 11 CFR 9004.7 at a later date. Travel Rules, 74 FR at 63951. Through this Notice, the Commission... Campaign Travel AGENCY: Federal Election Commission. ACTION: Announcement of effective date. SUMMARY:...

  11. Complex Contagion of Campaign Donations

    CERN Document Server

    Traag, V A

    2016-01-01

    Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50 000 elites and examine how connectivity among previous donors reinforces contagion. We find the diffusion of donations to be driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the via...

  12. Multistage Campaigning in Social Networks

    CERN Document Server

    Farajtabar, Mehrdad; Harati, Sahar; Song, Le; Zha, Hongyuan

    2016-01-01

    We consider the problem of how to optimize multi-stage campaigning over social networks. The dynamic programming framework is employed to balance the high present reward and large penalty on low future outcome in the presence of extensive uncertainties. In particular, we establish theoretical foundations of optimal campaigning over social networks where the user activities are modeled as a multivariate Hawkes process, and we derive a time dependent linear relation between the intensity of exogenous events and several commonly used objective functions of campaigning. We further develop a convex dynamic programming framework for determining the optimal intervention policy that prescribes the required level of external drive at each stage for the desired campaigning result. Experiments on both synthetic data and the real-world MemeTracker dataset show that our algorithm can steer the user activities for optimal campaigning much more accurately than baselines.

  13. Solar Energy Campaign. 2008 Norwegian student-based web campaign

    Energy Technology Data Exchange (ETDEWEB)

    Randall, Scott

    2009-07-01

    Student research campaigns (forskningskampanjer) have been an annual event in connection to Research Days (Forskningsdagene) since 2003 in Norway. The campaigns invite students from all over the country to participate in a common scientific research event, always connected to a special environmentally related theme - for example Air Quality in the Classroom (2003), Pollution along Roads (2004), Bacteria in Drinking Water (2005), and The Rain Check (2006). The year 2008, as with previous years, was overshadowed by the topic of climate change, and the specific role of humans. The research campaign theme for 2008 fit well into this focus: the potential benefits of solar energy as an alternative energy source. The campaign also was aligned with the Research Days theme of alternative energy sources and technologies. The campaign included the hands-on activity of assembling a solar panel and taking measurements with the device to determine efficiency, as well as a questionnaire to record the results and ask deeper questions regarding alternative energy and climate change. The results gained from data analysis of the campaign show that students were able to gain maximum efficient solar power from the devices they constructed, which gave them a solid understanding of solar power technology. Analysis of the campaign questionnaire in regards to the activity shows that students believe that solar energy should be better utilized as an energy source in Norway. (Also in Norwegian OR 24/2009). (Author)

  14. Fluorinated ethers: A new series of CFC substitutes. Rept. for Aug 88-Oct 91

    International Nuclear Information System (INIS)

    The paper discusses fluorinated ethers, a new series of chlorofluorocarbon (CFC) substitutes. Compounds synthesized to produce substances with suitable refrigerant properties have generally left out sulfur, nitrogen, and oxygen. The general result is that all currently proposed substitutes for CFC and halon replacements have been alkanes. Because of the limited number of compounds of these elements having suitable properties and the current decision to phase out CFCs and (eventually) hydrochlorofluorocarbons (HCFCs), restricting the search to alkanes only is no longer tenable. Consideration of fluorinated ethers effectively doubles the potential list of contenders. The fact that divalent oxygen in a fluorocarbon chain has only a modest effect on vapor pressure, compared to the alkane of similar carbon number and substitution, should be a strong incentive to investigate these compounds. Several new fluorinated compounds have been synthesized and characterized. Additionally, several compounds for which data were not available were synthesized. These compounds, both new and two 'revisited' ones, could function as replacement working fluids in many applications requiring similar properties. Without chlorine, all have zero ozone depletion potential

  15. PERFORMANCE TESTING OF A SEMI-HERMETIC COMPRESSOR WITH HFC-236EA AND CFC-114 AT CHILLER CONDITIONS

    Science.gov (United States)

    The paper gives results of tests of both HFC-236ea and CFC-114 at a range of temperatures covering surface craft and submarine chiller conditions. vaporating temperatures ranged from 1.7 to 12.8 C, and condensing temperatures from 40.6 to 65.6 C, in order to develop a nine-point ...

  16. CFC (Comment-First-Coding)--A Simple yet Effective Method for Teaching Programming to Information Systems Students

    Science.gov (United States)

    Sengupta, Arijit

    2009-01-01

    Programming courses have always been a difficult part of an Information Systems curriculum. While we do not train Information Systems students to be developers, understanding how to build a system always gives students an added perspective to improve their system design and analysis skills. This teaching tip presents CFC (Comment-First-Coding)--a…

  17. What influences crowdfunding campaign success.

    OpenAIRE

    Drabløs, Christian

    2015-01-01

    Crowdfunding is a recently emerged market for entrepreneurs; it represents a new and growing source of potential capital. The potential crowdfunding is starting to reach it potential, and has beginning to go mainstream. There is a gap in the research on crowdfunding and within the field of what separates a successful campaign from a failed one. To explore the variables influencing crowdfunding campaign this paper looks into academic articles, the crowdfunding platforms, general...

  18. Complex Contagion of Campaign Donations

    Science.gov (United States)

    2016-01-01

    Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50000 elites and examine how connectivity among previous donors reinforces contagion. We find that the diffusion of donations is driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the viability of candidates, possibly opposing candidates in response to local support. Our findings suggest that theories of complex contagions need refinement and that political campaigns should target multiple communities. PMID:27077742

  19. Complex Contagion of Campaign Donations.

    Science.gov (United States)

    Traag, Vincent A

    2016-01-01

    Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50000 elites and examine how connectivity among previous donors reinforces contagion. We find that the diffusion of donations is driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the viability of candidates, possibly opposing candidates in response to local support. Our findings suggest that theories of complex contagions need refinement and that political campaigns should target multiple communities. PMID:27077742

  20. Radium diagnosis campaign - 59327

    International Nuclear Information System (INIS)

    In line with the approaches already adopted in France during the 90's on various sites where research and/or radium-extraction activities were mostly conducted in the past, the French public authorities wish from now on to pursue their prevention and site-rehabilitation approach inherited from the French craftsman and medical sectors that used that radioelement. As a matter of fact, radium has been in use in several medical activities, notably in the initial methods of cancer therapy. Similarly, it was also used in some craftsman activities, such as the clock industry, for its radioluminescent properties, the fabrication of lightning conductors or cosmetics until the 60's. Those activities have generated various traces of pollution that have remained today. On the basis of the different inventories of industrial sites where radium may have been held or used, and notably the inventory updated by the French Institute for Radiation Protection and Nuclear Safety (Institut de radioprotection et de surete nucleaire - IRSN) in 2007 at the request of the French Nuclear Safety Authority (Autorite de surete nucleaire - ASN), French State services have potentially identified 134 sites that hosted radium-related activities in France. The radiological status of those sites is either unknown or very partially known by State services. Sites include both dwellings or commercial premises and derelict lands. The 'Radium Diagnosis Campaign' (Operation Diagnostic Radium), consists of a radiological survey carried out by the IRSN. In cases where traces of radium are detected, plans call for the implementation of precautionary measures and of a medical follow-up of the relevant populations. Lastly, radium-contaminated sites are rehabilitated by the French National Radioactive Waste Management Agency (Agence nationale pour la gestion des dechets radioactifs - Andra). That voluntary and positive approach on the part of public authorities is fully financed by public funds, and consequently

  1. Partitioning sources of recharge in environments with groundwater recirculation using carbon-14 and CFC-12

    Science.gov (United States)

    Bourke, Sarah A.; Cook, Peter G.; Dogramaci, Shawan; Kipfer, Rolf

    2015-06-01

    Groundwater recirculation occurs when groundwater is pumped from an aquifer onto the land surface, and a portion of that water subsequently infiltrates back to the aquifer. In environments where groundwater is recirculated, differentiation between various sources of recharge (e.g. natural rainfall recharge vs. recirculated water) can be difficult. Groundwater age indicators, in particular transient trace gases, are likely to be more sensitive tracers of recharge than stable isotopes or chloride in this setting. This is because, unlike stable isotopes or chloride, they undergo a process of equilibration with the atmosphere, and historical atmospheric concentrations are known. In this paper, groundwater age indicators (14C and CFC-12) were used as tracers of recharge by surplus mine water that is discharged to streams. Ternary mixing ratios were calculated based on 14C and CFC-12 concentrations measured along three transects of piezometers and monitoring wells perpendicular to the creeks, and from dewatering wells. Uncertainty in calculated mixing ratios was estimated using a Monte Carlo approach. Ternary mixing ratios in dewatering wells suggest that recharge by mine water accounted for between 10% and 87% of water currently abstracted by dewatering wells. The calculated mixing ratios suggest that recharge by mine water extends to a distance of more than 550 m from the creeks. These results are supported by seepage flux estimates based on the water and chloride balance along the creeks, which suggest that 85-90% of mine water discharged to the creeks recharges the aquifer and recharge by mine water extends between 110 and 730 m from the creeks. Mixing calculations based on gaseous groundwater age indicators could also be used to partition recharge associated with agricultural irrigation or artificial wetland supplementation.

  2. Impact of French advertising campaign

    International Nuclear Information System (INIS)

    'Today, some 75 % of France's electricity is generated by nuclear plants'. This was the theme of the advertising campaign launched for the second time in May 1992 by Electricite de France in national daily newspapers and magazines, in regional publications, on cinema and on TV. Compared to 1991 the second campaign was a new step in communication: first, was the wish to inform better the public. A Minitel program '3614 EDF' was created and connected by general public including a lot of information about nuclear energy and the way to visit a nuclear plant; secondly, was the use of TV media to target a larger population. The TV spot, 'the nuclear drill', uses humor to get more impact on the public. The campaign received an encouraging reception from the press, which admired its boldness and originality. As far as the general public is concerned, the campaign achieved its goals, as illustrated by the results of post-campaign surveys carried out to measure its effect. The segment of population targeted by campaign was mainly the so called 'pragmatics'. 'Pragmatics', who account for 25 % of the French population, are young, have a good education and are well informed. This category was selected as it shows a subtle attitude towards nuclear power, with more doubts than certainties. Moreover, this segment of the population has proven to be open to information issued by EDF and also plays a key role in influencing social trends. 63% of the segment targeted by the campaign (pragmatics) and 56% of the whole french population saw the ads

  3. Radon campaigns. Status report 2008

    International Nuclear Information System (INIS)

    Radon campaigns aim at activating citizens to make indoor radon measurements and remediation as well as increasing the common awareness of indoor radon questions. Indoor radon increases the risk of lung cancer. Through radon campaigns Radiation and Nuclear Safety Authority (STUK) also promotes the attainment of those goals that the Ministry of Social Affairs and Health has set for municipal authorities in Finland for prevention of the harmful effects of radon. The Ministry of Social Affairs and Health supports this campaign. Radon campaigns were started in autumn 2003. By autumn 2008 the campaigns have been organised already in 64 regions altogether in 160 municipalities. In some municipalities they have already arranged two campaigns. Altogether 14 100 houses have been measured and in 2 100 of these the action limit of radon remediation 400 Bq / m3 has been exceeded. When participating in radon campaigns the house owners receive a special offer on radon detectors with a reduced price. In 2008 a new practice was introduced where the campaign advertisements were distributed by mail to low-rise residential houses in a certain region. The advertisement includes an order / deposit slip with postage paid that the house owner can send directly to STUK to easily make an order for radon measurement. In the previous radon campaigns in 2003 - 2007 the municipal authorities collected the orders from house owners and distributed later the radon detectors. The radon concentrations measured in the campaign regions have exceeded the action limit of 400 Bq / m3 in 0 - 39% of houses, depending on the region. The total of 15% of all measurements made exceeded this limit. The remediation activities have been followed by sending a special questionnaire on remedies performed to the house owners. In 2006 - 2007 a questionnaire was sent to those households where the radon concentration of 400 Bq / m3 was exceeded during the two first campaign seasons. Among the households that replied

  4. Safety campaigns. TIS Launches New Safety Information Campaign

    CERN Multimedia

    2001-01-01

    Need to start a new installation and worried about safety aspects? Or are you newly responsible for safety matters in a CERN building? Perhaps you're simply interested in how to make the working environment safer for yourself and your colleagues. Whatever the case, a new information campaign launched by TIS this week can help. The most visible aspects of the new campaign will be posters distributed around the Laboratory treating a different subject each month. The Web site - http://safety.cern.ch/ - which provides all safety related information. But these are not the only aspects of the new campaign. Members of the TIS/GS group, whose contact details can be found on the safety web site, are available to give information and advice on a one-to-one basis at any time. The campaign's launch has been timed to coincide with European Safety Week, organized by the European Agency for Safety and Health at Work and the subject treated in the first posters is safety inspection. This particular topic only concerns thos...

  5. CFCI3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime and Uncertainty

    Science.gov (United States)

    Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2014-01-01

    CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations

  6. High heat load test of CFC divertor target plate with screw tube for JT-60 superconducting modification

    International Nuclear Information System (INIS)

    A flat carbon fiber composite (CFC) tile mock-up with screw tubes, which have helical fins like a nut, was fabricated aiming at further improvement of the heat removal performance of the cost-effectively manufactured divert or target for JT-60SC (modified JT-60 as a superconducting coil tokamak). The heat removal performance of the mock-up was successfully demonstrated on the JAERI Electron Beam Irradiation Stand. The estimated heat transfer coefficient of the screw tube at the non-boiling region was roughly three times higher than that of the smooth tube. This corresponds to 1.5 times that of the swirl tube. A heat cycle test of 10 MW/m2 showed that the mock-up with the screw tubes could withstand for 1400-cycles. These results indicate that the divertor target plate with the flat CFC tile and the screw tube can be a promising candidate for the JT-60SC divertor target

  7. Advanced Fuels Campaign 2012 Accomplishments

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2012-11-01

    The Advanced Fuels Campaign (AFC) under the Fuel Cycle Research and Development (FCRD) program is responsible for developing fuels technologies to support the various fuel cycle options defined in the DOE Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. The fiscal year 2012 (FY 2012) accomplishments are highlighted below. Kemal Pasamehmetoglu is the National Technical Director for AFC.

  8. The articulation of transnational campaigns

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2011-01-01

    , as developed by Laclau and Mouffe, the article is able to move beyond the search for a ‘Global Civil Society' or ‘Transnational Advocacy Network', and instead focus on the articulatory process in which the relations central to transnational campaigning are produced. This empowers an analysis that is able...

  9. Reprieve for Thailand's AIDS campaign.

    Science.gov (United States)

    Clements, A

    1992-07-25

    A promilitary coalition began to govern Thailand in March 1992. It reduced the budget for the original proposed national AIDS awareness campaign from 30 million British pounds to almost 15 million British pounds. The Ministry of Health professed that the campaign had exaggerated the problem of AIDS in Thailand and had damaged tourism. Yet prodemocracy demonstrations in Bangkok in which troops killed many protesters restored the politicians who started the AIDS campaign to power in May 1992. There were to remain in power until new elections in September 1992. In July, the Minister of Health, Mechai Viravaidya, said he would step down if the government did not completely restore the 30 million British pounds for the AIDS campaign. It then increased the budget to almost that amount. Mr. Viravaidya initiated Thailand's open policy on the AIDS crisis and was known as Mr. Condom. He claimed that at the present HIV prevalence rate, Thailand may have between 2-4 million HIV infected people by 2000. If the country would take on anti-AIDS efforts now, however, they could cut the spread of HIV by 75%. As of mid-1992, about 400,000 people living in Thailand were HIV positive. The AIDS campaign planned to sue the mass media to inform people about AIDS especially those in universities and schools and high risk occupational groups. The increasing number of construction workers in Bangkok and existing sex workers were a high risk occupational group. At the 2nd national seminar of AIDS, the Minister of Health reproached tourists who come to Thailand for its sex industry. He said that Thailand does not need the 1 billion British pounds they bring to Thailand annually, and Thais do not want their homeland to be referred to as the sex capital. PMID:1392821

  10. Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)

    Science.gov (United States)

    Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian

    2013-01-01

    NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.

  11. Tritiated thymidine and deoxycytidine suicide of mouse hemopoietic colony forming cells (CFC)

    International Nuclear Information System (INIS)

    Significant enhancement of tritiated dCyd suicide occurred when unlabelled dThd was added to cultures of mouse monocytic colony-forming cells. Incorporation experiments supported the suicide experiments in that incorporation of tritiated dCyd into DNA was significantly increased. One hundred micromolar dCyd significantly reduced the radiotoxicity of 0.3 μCi of tritiated dThd; incorporation experiments indicated a dose-related reduction in the incorporation of tritiated dThd into DNA with the addition of 1-100 μM unlabelled dCyd. The addition of 1 μM aminopterin reversed the effect of 100 μM deoxycytidine; viz., incorporation of dThd into DNA was 90% of controls. Aminopterin had a similar effect on deoxyuridine reversal of tritiated dThd incorporation into DNA. Aminopterin had no effect on the reduction of tritiated dThd incorporation into DNA due to the addition of 100 μM unlabelled thymidine. Unlabelled ribonucleosides, Urd and Cyd, did not significantly affect the suicide pattern of tritiated dThd or dCyd when they were added to CFC cultures. Unlabelled deoxyribonucleosides, dThd or dCyd, did not significantly affect the suicide pattern of either tritiated Cyd or Urd when they were added to cultures containing tritiated ribonucleosides. Unlabelled Urd or Cyd was effective in reversing the suicide due to tritiated Urd or Cyd. (author)

  12. News Media Framing of Negative Campaigning

    DEFF Research Database (Denmark)

    Pedersen, Rasmus Tue

    2014-01-01

    News media coverage of election campaigns is often characterized by use of the strategic game frame and a focus on politicians’ use of negative campaigning. However, the exact relationship between these two characteristics of news coverage is largely unexplored. This article theorizes that consumer...... demand and norms of journalistic independence might induce the news media outlets to cover negative campaigning with a strategic game frame. A comprehensive content analysis based on several newspaper types, several election campaigns, and several different measurements of media framing confirms...... that news coverage of negative campaigning does apply the strategic game frame to a significantly larger degree than articles covering positive campaigning. This finding has significant implications for campaigning politicians and for scholars studying campaign and media effects....

  13. FDA Launches Ad Campaign Against Chewing Tobacco

    Science.gov (United States)

    ... while others appear on local radio and through social media. The new campaign will also collaborate with select ... Cost" campaign, which since 2014 has been warning teenagers about the health effects of smoking. SOURCE: April 19, 2016, news conference ...

  14. Heart Health: The Heart Truth Campaign 2009

    Science.gov (United States)

    ... Bar Home Current Issue Past Issues Cover Story Heart Health The Heart Truth Campaign 2009 Past Issues / Winter 2009 Table ... one of the celebrities supporting this year's The Heart Truth campaign. Both R&B singer Ashanti (center) ...

  15. Campaign Spending Limits and Political Advertising

    OpenAIRE

    David Soberman; Loïc Sadoulet

    2007-01-01

    Traditionally, research on political campaigns has focused on the positioning of parties and not on how parties communicate with the electorate. We construct a model where two parties fund both the "creative" and "media" elements of political advertising and examine how campaign budgets affect advertising strategies in the context of a political campaign. Our key finding is that tight campaign limits stimulate aggressive advertising on the part of competing parties, while generous budgets oft...

  16. Evaluation of an Std Education Media Campaign

    OpenAIRE

    Jack McKillip; Kimm Baldwin

    1990-01-01

    A multimedia sexually transmitted disease (STD) education campaign was evaluated on a college campus. Media coverage and telephone interviews concerning the health topics of condom use, moderate alcohol use, and regular exercise were examined for four weeks prior to the campaign, during the campaign week, and for three weeks after the campaign. Compared to the other health topics, the condom use topic received more media coverage and more audience exposure, was discussed more, and showed an i...

  17. Planning a responsibility campaign for Alko Inc.

    OpenAIRE

    Wäck, Ada-Maria

    2016-01-01

    This thesis is a study into marketing and more specifically into marketing planning. The purpose of the thesis is to create a campaign in order to raise the responsibility image of Alko Inc. within the target group of young adults. The objective of this thesis is to create a campaign concept for Alko Inc. The background of the campaign is a marketing competition called Adprofit Junior, where young marketing professionals compete against one another by creating a coherent campaign plan for...

  18. Global distribution of halogenated tracers in the UTLS region during the TACTS/ESMVal campaigns using the HALO aircraft

    Science.gov (United States)

    Keber, Timo; Engel, Andreas; Boenisch, Harald; Sala, Stephan

    2013-04-01

    The Upper Troposphere / Lower Stratosphere (UTLS) represents an important region for the exchange of air between the stratosphere and the troposphere. Tropospheric gaseous compounds such as greenhouse gases and ozone depleting substances (ODS) are transported into the lower stratosphere on different pathways. Especially the two-way horizontal transport across the subtropical jet was further investigated during the "TACTS - Transport and Composition in the UT/LMS" campaign. We will present in-situ measurements of long-lived and very short-lived (VSLS) halocarbons and Sulfurhexafluoride (SF6) in the UTLS region. The measurements were performed with a sophisticated two channel in-situ instrument on board of the new German research aircraft for atmospheric science HALO (The High Altitude and LOng Range Research Aircraft) during the two campaigns TACTS and "ESMVal - Earth System Modell Validation". The first channel is a gas chromatography (GC) system coupled with mass spectrometer (MS) which operates in negative chemical ionization mode. This GC/MS channel is able to measure halocarbons in ambient air with a time resolution of four minutes. For the measurement of SF6 and CFC-12 the second channel provides its own GC system with an electron capture detector (ECD). With the GC/ECD we achieve a time resolution of 60 seconds. The dataset includes 13 flights with a total of 120 flight hours and a coverage from 80° N to 65° S with a maximum altitude of 15 km. The measurements include halogenated hydrocarbons with a wide span of chemical lifetimes reaching from 100 years for CFC-12 to 26 days for CHBr3. On the basis of this distribution we can improve our understanding of transport timescales, compositions and pathways in the UTLS region. Furthermore we discuss the distribution in respect of atmospheric transport and lifetimes.

  19. CX Lyrae 2008 Observing Campaign

    CERN Document Server

    de Ponthiere, Pierre; Hambsch, Franz-Josef

    2012-01-01

    The Blazhko effect in CX Lyr has been reported for the first time by Le Borgne et al. (2007). The authors have pointed out that the Blazhko period was not evaluated accurately due to dataset scarcity. The possible period values announced were 128 or 227 days. A newly conducted four-month observing campaign in 2008 (fifty-nine observation nights) has provided fourteen times of maximum. From a period analysis of measured times of maximum, a Blazhko period of 62 +/- 2 days can be suggested. However, the present dataset is still not densely sampled enough to exclude that the measured period is still a modulation of the real Blazhko period. Indeed the shape of the (O-C) curve does not repeat itself exactly during the campaign duration.

  20. An AIDS campaign in Brazil.

    Science.gov (United States)

    Janoff, D

    1987-01-01

    The Acquired Immune Deficiency Syndrome (AIDS) distribution program in Brazil, spearheaded by the National Division of Sanitary Surveillance in Ports, Airports, and Borders, was part of the government's massive education campaign to prevent the transmission of HIV-AIDS in Brazil. Beginning in February 1987, the climate was sufficiently favorable to operate a coordinated information campaign during the Carnival celebration, and tourists arriving in the cities of Brazil for the annual Carnival celebration were handed an educational brochure in Portugese, Spanish, English, and French. Yet, beyond reaching the tourist populations, it is particularly important to reach large portions of the Brazilian population. Planners of the national AIDS campaign intend to use television, radio, and all major newspapers in their effort to cover the country. Initial television coverage is comprised of short informational messages directed at high-risk groups. There also are plans to use radio and the print media in order to reach a wider audience. It is estimated that US $6 million will be needed to adequately meet the costs of AIDS prevention and medical care, but due to extreme budget constraints, only $45,000 has been earmarked for ongoing AIDS activities at this time. PMID:12281284

  1. Do social marketing campaigns in health work? A critical analysis of four UK campaigns

    OpenAIRE

    Coope, David

    2007-01-01

    This management project looks at four recent social marketing campaigns in the field of health in the UK to determine whether such campaigns work. The project critically analyses the marketing campaigns used, and aims to determine the range of factors that create a successful social marketing campaign in health. There is analysis of four case studies undertaken after secondary research into social marketing campaigns run by a range of different organisations. The case studies are the ...

  2. Trust us Trust Thorp Campaign

    International Nuclear Information System (INIS)

    The history of the nuclear industry in the UK has been dominated by Sellafield reprocessing site in west Cumbria. The site, formerly owned by the United Kingdom Atomic Energy Authority was transferred to the newly-formed British Nuclear Fuels plc in 1971. Although trade union representation existed at Sellafield before the emergence of BNFL, it is only after this date that collective trade union activity began to emerge. In 1977, after a long running dispute with management about the issue of radiation dose uptake, the workforce went on strike, forcing the management to question their previous 'need to know' attitude and to improve industrial relations. In 1984, it was recognised that the lobbying influence of trade unions within politics, and especially the Labour party could be used to greater effect to challenge potentially -damaging influence of anti-nuclear campaigners. The National Campaign for the Nuclear Industry (NCNI) was born, combining nine industrial and non-industrial trade unions within the nuclear industry. Its task during the last ten years has been to put forward the interests of its members collectively and to secure the, role of nuclear power. within a balanced energy policy in the political arena. In dome so, it has gained a credible voice within both the trade union movement and the Labour party. The new Thermal Oxide Reprocessing Plant (THORP) received strong support from the NCNI during its construction and commissioning phases. When it became clear that the anti-nuclear lobby had gained the upper hand and were beginning to seriously delay the necessary legal instruments required to start the plant, the power of collective action was once again recognised, and the TRUST US campaign was born. The campaign was run and organised by a clerks committee and fronted by the Trade Unions at Sellafield., and turned out to be one of the most successful] trade union campaigns in recent history. The first task involved getting, the entire workforce on

  3. Shifting the CFC/W transition point on the first ITER divertor target plates: equilibrium considerations

    Science.gov (United States)

    Kolesnikov, R. A.; Bulmer, R. H.; Lodestro, L. L.; Casper, T. A.; Pitts, R. A.

    2012-03-01

    In the 2007 ITER Design Review, the CFC/W transition point on the first divertor target plates was lowered by 10 cm to allow some experience to be gained in the non-active phases of vertical target operation with strike points on W surfaces, in preparation for a full W divertor in the nuclear phase. For operation on W just above the transition point, we use the CORSICA code to investigate the range of possible H- and L-mode equilibria, with emphasis on the maximum plasma current, achievable shapes, etc. We then investigate the operational space as the transition is lowered still further (both L- and H-mode), while still ensuring sufficient carbon vertical target extent to fulfill the requirements of the non-active phase program. The primary aim of this study is to determine if the current transition point, which can still be modified within some range if required, is optimized with respect to gaining early operational experience on an all-metal target before the nuclear phases begin. In our previous work [1], we investigated the size of feasible βp--li space for both reference and elevated strikes for operation at 14 MA (both L- and H-mode) as well as 12 MA (H-mode) currents. In this paper we present new results on the maximum achievable plasma current as a function of strikes locations. Also, we study plasma self-inductance, volt-second consumption and the vertical instability over the range of the new equilibria. [1] R.A. Kolesnikov, et al., 53^rd APS/DPP, Salt Lake City (2011)

  4. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools. PMID:26788794

  5. Comparison of stratospheric nitrogen and chlorine compounds observed during the MANTRA 1998 balloon campaign with the Canadian Middle Atmosphere Model

    Science.gov (United States)

    Melo, S. M.; McLandress, C.; Strong, K.; Shepherd, T.; McElroy, C. T.; Davies, J.; Quine, B.; Fogal, P.; Blatherwick, R.; Bassford, M.

    2003-04-01

    Observations of nitrogen and chlorine species are of primary importance in studies of ozone chemistry and climate change. Stratospheric circulation and the distribution of O3 control the transport of long-lived greenhouse gases to regions of photochemical loss as well as the penetration of solar UV into the atmosphere. At the same time, many of these gases (e.g., N2O and CFCs) supply ozone-depleting radicals (e.g., NO and Cl) to the stratosphere, providing a feedback between the gas and its loss rate. Middle Atmospheric Nitrogen TRend Assessment (MANTRA) is a set of balloon campaigns aimed at investigating the changing chemical balance of the mid-latitude stratosphere. This paper deals with results from the campaign conducted in 1998, which involved the launch of an 11.6 million cubic feet balloon from Vanscoy, Saskatchewan, Canada (52 N, 107 W) on August 24th. Vertical distributions of O3, NO2, N2O, HNO3, HCl, CFC-11, CFC-12 and CH4 were measured by the combination of a Fourier transform infra-red spectrometer, infrared radiometers, and a UV-visible grating spectrometer. In addition, ozone profiles were obtained from 12 ozonesondes launched between August 6 and 24. As part of the campaign, a ground-based UV-visible spectrometer was operated from August 18 to 25, measuring scattered sunlight in a zenith-sky configuration. O3 and NO2 slant column densities were extracted from those measurements as a function of solar zenith angle, and NO2 vertical profiles were retrieved from the NO2 slant column values. In this paper we compare the constituents measured during the 1998 MANTRA campaign with the output of the Canadian Middle Atmosphere Model (CMAM), a fully interactive chemistry-climate model. Late summer is an ideal time to make such a comparison because of low dynamical variability. It is shown that by comparing both the profiles of individual species as well as the correlations between long-lived species, model biases in transport and in chemistry can be

  6. Raman study of CFC tiles extracted from the toroidal pump limiter of Tore Supra

    OpenAIRE

    Pardanaud, C.; Giacometti, G.; Martin, C; Ruffe, R.; Angot, T.; Areou, E.; Pegourie, B.; Tsitrone, E.; Dittmar, T.; Hopf, C.; Jacob, W.; Schwarz-Selinger, T.; Roubin, P.

    2011-01-01

    The structure of six tiles extracted from the erosion and deposition zones (thin and thick deposition) of the Tore Supra toroidal pump limiter (TPL) have been analysed in the framework of the DITS campaign using micro-Raman spectroscopy. This post-mortem analysis gives information on both carbon structure and D content. We have found that the carbon structure is most often similar to that of plasma-deposited hard amorphous carbon layers. The role of the surface temperature during the discharg...

  7. GOCE Re-Entry Campaign

    Science.gov (United States)

    Bastida, B.; Flohrer, T.; Lemmens, S.; Krag, H.

    2015-03-01

    Every year ESA, through the Space Debris Office, participates to an Inter-Agency Space Debris Coordination Committee (IADC) Re-entry Test Campaign.. For the campaign of 2013, ESA’s proposal to select GOCE's re-entry was accepted. The campaign opened on the 21st October 2013 after fuel depletion of the drag-compensating ion propulsion. GOCE was expected to enter into a phase of attitude-controlled fine-pointing mode (FPM) until the attitude controllers would be unable to cope with the atmospheric torques and then the satellite would enter in a phase of fully uncontrolled flight. In this paper, we present the evolution of ESA’s daily predictions on the re-entry epoch using different sources of orbital information. The uncertainties on the spacecraft operability (i.e. the physical limits of the attitude controller) led to a non-standard re-entry scenario were different attitudes had to be considered (instead of the commonly assumed random tumbling mode case that is used whenever no information on the physical properties of a re-entering object is available). A daily assessment of the status, in coordination with the flight control team, was required and implied a continuous update on the predicted failure point of the attitude controller. This in turn imposed the need for considering an asymmetric re-entry window. These operation-bound uncertainties were simulated to predict the attitude evolution after failure at different altitudes and their effects evaluated to be taken into account for the re-entry predictions. We present ESA’s re-entry prediction activities for GOCE, internally, and within the IADC, and address specific technical aspects and challenges for re-entry predictions, which are related to the expected and occurred attitude of GOCE during the final re-entry phase.

  8. Sludge Stabilization Campaign blend plan

    International Nuclear Information System (INIS)

    This sludge stabilization blend plan documents the material to be processed and the order of processing for the FY95 Sludge Stabilization Campaign. The primary mission of this process is to reduce the inventory of unstable plutonium bearing sludge. The source of the sludge is residual and glovebox floor sweepings from the production of material at the Plutonium Finishing Plant (PFP). The reactive sludge is currently being stored in various gloveboxes at PFP. There are two types of the plutonium bearing material that will be thermally stabilized in the muffle furnace: Plutonium Reclamation Facility (PRF) sludge and Remote Mechanical C (RMC) Line material

  9. Sludge Stabilization Campaign blend plan

    Energy Technology Data Exchange (ETDEWEB)

    De Vries, M.L.

    1994-10-04

    This sludge stabilization blend plan documents the material to be processed and the order of processing for the FY95 Sludge Stabilization Campaign. The primary mission of this process is to reduce the inventory of unstable plutonium bearing sludge. The source of the sludge is residual and glovebox floor sweepings from the production of material at the Plutonium Finishing Plant (PFP). The reactive sludge is currently being stored in various gloveboxes at PFP. There are two types of the plutonium bearing material that will be thermally stabilized in the muffle furnace: Plutonium Reclamation Facility (PRF) sludge and Remote Mechanical C (RMC) Line material.

  10. Environmental campaigns against forest companies: What are the campaigns trying to achieve?

    Energy Technology Data Exchange (ETDEWEB)

    Gritten, D.; Gonzalez Olabarria, J. R.; Mola-Yudego, B.; Dominguez, G.

    2012-11-01

    Campaigns by environmental non-governmental organisations (ENGOs) can have far reaching consequences in determining the policies of governments and corporations. This paper examines campaigns targeting forestry companies to determine what makes a successful campaign. Over forty ENGOs completed a questionnaire defining what they perceive to constitute a successful campaign. The responses were analysed using Analytical Hierarchy Process. The results showed that campaigns by ENGOs have two main targets: changes in laws and the target group implementing the campaigns recommendation(s). Achieving these targets, for most, constitute a successful campaign. Subsequently, representatives of seven ENGOs were questioned to attain their perspectives of the results in comparison to campaigns they are conducting against forest enterprises. They supported the results of the questionnaire, but also felt that there are various other factors that need to be considered (e.g. the campaigns time frame and the possibility of having hidden targets) that increase the issues complexity. (Author) 49 refs.

  11. Potential groundwater age tracer found: Halon-1301 (CF3Br), as previously identified as CFC-13 (CF3Cl)

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2014-09-01

    Groundwater dating using anthropogenic and natural tracer substances is a powerful tool for understanding groundwater dynamics for improved management of groundwater resources. Due to limitations in individual dating methods, often multiple tracers are used to reduce ambiguities. It is commonly accepted that there is a need for further complementary age tracers, in addition to current ones (e.g., tritium, SF6, and CFCs). We propose a potential new groundwater age tracer, Halon-1301 (CF3Br), which can easily be determined using gas chromatography with an attached electron capture detector (GC/ECD) developed by Busenberg and Plummer (2008). Its peak was noted by Busenberg and Plummer (2008), but they believed it to be CFC-13 (CF3Cl) at that time. We performed rigorous tests on gases containing or excluding Halon-1301 and CFC-13 and modern water samples and concluded that the two compounds have extremely similar retention times. Additionally, we found that the ECD response of CFC-13 is far too low to be detected in groundwater or air using standard volumes and sampling techniques. However, the peak areas and concentrations Busenberg and Plummer (2008) reported are in line with what would be expected for Halon-1301. Thus, we are confident that the peak formerly identified as CFC-13 is actually Halon-1301. Busenberg agrees with our findings. We further suggest that Halon-1301 has potential as a (complementary) age tracer, due to its established atmospheric history, and could hypothetically be used to date groundwater recharged in the 1970s or onward. We discuss known relevant properties, such as solubility and stability of Halon-1301 in the context of how these effect its potential application as a groundwater age tracer. Some open questions remain concerning how conservative Halon-1301 is—is it subject to degradation, retardation, and/or local contamination in groundwater. We are confident that Halon-1301 possesses important tracer relevant properties, but further

  12. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Technical progress report, 1 April 1995--30 June 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.; Amrane, K.

    1995-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The AirConditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  13. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  14. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  15. INCREASING COMPLIANCE THROUGH EFFICIENT PUBLIC CAMPAIGNS

    Directory of Open Access Journals (Sweden)

    Ilie BANU

    2013-06-01

    Full Text Available This paper starts from the assumption that the degree of compliance of the taxpayer increases in direct proportion to the effectiveness of public campaigns carried out by the tax device. Information campaigns with a view to increase voluntary compliance can be carried out in various ways. They can emphasize either the potential benefits that taxpayers would receive if the compliance were full, or the potential losses when the degree of compliance is reduced. In theory, these campaigns are effective when intersecting with the promotion or warning of taxpayers about certain fiscal aspects. Following the presentation of campaigns carried out in other states, we propose the initiation of a campaign in Romania as well. Corporate taxpayers will choose out of several campaigns and in the end we will present the results of the research based on the methods of the questionnaire and of the interview.

  16. Consistent sets of atmospheric lifetimes and radiative forcings on climate for CFC replacements: HCFCs and HFCs

    Science.gov (United States)

    Naik, Vaishali; Jain, Atul K.; Patten, Kenneth O.; Wuebbles, Donald J.

    2000-03-01

    Recognition of deleterious effects of chlorine and bromine on ozone and climate over the last several decades has resulted in international accords to halt the production of chlorine-containing chlorofluorocarbons (CFCs) and bromine-containing halons. It is well recognized, however, that these chemicals have had important uses to society, particularly as refrigerants, as solvents, as plastic blowing agents, as fire retardants and as aerosol propellants. This has led to an extensive search for substitute chemicals with appropriate properties to be used in place of the CFCs and halons. The purpose of this study is to evaluate in a consistent manner the atmospheric lifetime and radiative forcing on climate for a number of replacement compounds. The unique aspect of this study is its attempt to resolve inconsistencies in previous evaluations of atmospheric lifetimes and radiative forcings for these compounds by adopting a uniform approach. Using the latest version of our two-dimensional chemical-radiative-transport model of the global atmosphere, we have determined the atmospheric lifetimes of 28 hydrohalocarbons (HCFCs and HFCs). Through the comparison of the model-calculated lifetimes with lifetimes derived using a simple scaling method, our study adds to earlier findings that consideration of stratospheric losses is important in determining the lifetimes of gases. Discrepancies were found in the reported lifetimes of several replacement compounds reported in the international assessment of stratospheric ozone published by the World Meteorological Organization [Granier et al., 1999] and have been resolved. We have also derived the adjusted and instantaneous radiative forcings for CFC-11 and 20 other halocarbons using our radiative transfer model. The sensitivity of radiative forcings to the vertical distribution of these gases is investigated in this study and is shown to be significant. The difference in the global radiative forcing arising from the assumption of a

  17. An Economic Analysis of Campaign Finance

    OpenAIRE

    Andrea Prat

    2000-01-01

    Electoral campaign finance is an important, and much debated, phenomenon in democracies throughout the world. This article discusses a possible economic model of campaign finance, which could be used for policy evaluation. At the core of the model lies an asymmetry of information between lobbies and voters. Lobbies know more than voters about the quality of candidates. Campaign contributions constitute an indirect way to reveal lobbies’ information to voters. However, this informational ben...

  18. International viral marketing campaign planning and evaluation

    OpenAIRE

    Sormunen, Vilja

    2009-01-01

    Objective of the Study The objective of this study was to explore international viral marketing campaign (IVMC) planning and evaluation in order to help marketers develop better campaigns. The motivation for the study came primarily from a research gap in existing literature. This thesis set out to answer three research questions that deal with campaign planning, localization and evaluation. Research Method This thesis represents a qualitative single-case study. Semi-structured th...

  19. Economic Ground of Efficiency of Publicity Campaign

    OpenAIRE

    Agarkova Anna A.

    2012-01-01

    The methods of measuring of efficiency of publicity campaign of enterprise are examined in the article, and also problems are related to the legal adjusting of publicity activity in Ukraine. Basic difficulties are selected in connection with the use each of methods of determination of efficiency of publicity campaign. Basic indexes which characterize efficiency of publicity campaign are exposed in the article. Incentive reasons, which compel a potential buyer with kindness to react on what an...

  20. Campaign rhetoric: A model of reputation

    OpenAIRE

    Aragon??s, Enriqueta; Postlewaite, Andrew

    2000-01-01

    We analyze conditions under which a candidate's campaign rhetoric may affect the beliefs of the voters over what policy the candidate will implement in case he wins the election. We develop a model of repeated elections with complete information in which candidates are purely ideological. Voter's strategies involve a credible threat to punish candidates that renege of their campaign promises, and in equilibrium all campaign promises are believed by voters, and honore...

  1. Tritium retention measurements by accelerator mass spectrometry and full combustion of W-coated and uncoated CFC tiles from the JET divertor

    Science.gov (United States)

    Stan-Sion, C.; Bekris, N.; Kizane, G.; Enachescu, M.; Likonen, J.; Halitovs, M.; Petre, A.; contributors, JET

    2016-04-01

    Accelerator mass spectrometry (AMS) and the full combustion method (FCM) followed by liquid scintillation counting were applied to quantitatively determine the tritium retention in the tungsten-coated carbon fibre composites (CFC), in comparison to uncoated CFC tiles from the JET divertor. The tiles were adjacent and exposed to plasma operations between 2007 and 2009. The tritium depth profiles are showing that the tritium retention on the W-coated tile was reduced by a factor of 13.5 in comparison to the uncoated tile whereas the bulk tritium concentration is approximately the same for both tiles.

  2. The damage of ozone layer from the influence of CFC fluids and their contribution on the greenhouse effect

    International Nuclear Information System (INIS)

    The first vapor compression refrigeration systems and the problems with the used refrigerants are discussed. A result of the research were CFC fluids which are nontoxic, nonflammable, stable and inert. The excellent characteristics of CFC were a good reason for an enlarged expanding use in other applications, such as aerosols, polyurethane foam, solvent etc. After the discovery that CFCs damage the protective ozone layer in the stratosphere, Montreal protocol is signed (1987), which foresees a cutback in the production and use of CFCs. The phase out in the production of aerosols, foams and solvents is very effective and fast, but in the refrigeration systems is very slow because of their complex requirements and conflict of interests. The newest regulations from UNEAP are: the ban in the production and use of CFCs from 01 January, 1996. The long life of CFCs in the atmosphere contributes to the greenhouse effect and increase the average temperature on earth. The effect is mainly caused by carbon dioxide emissions (50%), while the contribution of CFCs is about 20 to 25%. The well known companies offer on the market new alternative fluids for refrigeration systems, mainly HFC fluids, but their influence upon the environment is still not proved. We already have the lesson of history. (author)

  3. New high O2 carrying perfluorochemical emulsions: toxicity, radiosensitivity of GM-CFC and development of metastases in mice

    International Nuclear Information System (INIS)

    The effects of two new concentrated perfluorochemical emulsions based on F-66E and PFOB, which carry significantly more oxygen than Fluosol-DA 20%, were tested on normal tissues (toxicity and radiation response) and on the development of metastases from Lewis Lung Carcinoma (3LL) in female C57 BL/6 mice. Twenty one days after injection of F-66E or PFOB emulsions (15 ml/kg body weight), the spleen and liver weights were significantly increased but had returned to normal after 2-3 months. Splenomegaly already observed in 3LL bearing mice was significantly increased by F-66E emulsion injection. The radiosensitivity of GM-CFC was not altered when unanesthetized GM-CFC was not altered when unanesthetized mice were pretreated with F-66E emulsions and/or carbogen 1 hr prior to and during irradiation. The rate of tumor take and the period before detection of tumors were not modified when an emulsion of F-66E was injected simultaneously or 10 days after 3LL cells. Mean survival of mice, and the number of metastases on lung surfaces were similar in F-66E injected mice and control mice

  4. WO3/ZrO2 Strong Acid as a Catalyst for the Decomposition of Chlorofluorocarbon (CFC-12)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction Chlorofluorocarbons (CFCs) diffusing to the stratosphere is a major reason for ozone depletion[1]. Also CFCs has been claimed to be notorious for its greenhouse effect[2]. So, recently it has become very important to eliminate CFCs as far as protecting the ozone layer surrounding the earth is concerned. Among various kinds of approaches to do destruction to CFCs, the catalytic decomposition seems to be the most practical and energetically favorable one, especially for treating small amounts of CFCs[3,4]. Recently, Fu et al.[3] reported that TiO2 modified with H2SO4 was much more active than TiO2 for the decomposition of CFC-12 in the presence of water vapor, and they attributed this tremendous enhancement in activity to the superacidic property of the sulfated catalyst. Their research results substantially stimulate us to investigate the catalytic decomposition of CFC-12 in the presence of water vapor over WO3/ZrO2 strong acid, which is more thermally stable than the sulfated oxides superacids[5].

  5. Refrigerating and air conditioning systems in the Republic of Macedonia regarding to the use of CFC fluids

    International Nuclear Information System (INIS)

    Classification of refrigerating systems and their condition in the Republic of Macedonia, by the capacity and application. Review of the subjects involved in refrigeration in the Republic of Macedonia: manufactures of refrigerating systems, distributors of refrigerating equipment, distributors of (CFC) refrigerants, maintenance and servicing of refrigerating systems regarding to the quality and the weak points. Measures and projects in the Republic of Macedonia in the field of the protection of the ozone layer. Regulations by the Montreal protocol. Regulations in the Republic of macedonia concerning refrigerating systems and CFC fluids in them. Country programme of the Republic of Macedonia and institutional activities. Projects in 'Frinko; and 'Sileks' where the manufacturing technologies are changed. Project 'Refrigerant management plan' in which are included: forming of training centers, training of service technicians and engineers involved in refrigeration and air conditioning, equipping of services and companies with on equipment for good practice in refrigeration and refrigerant's recovery, forming of recycling centers for purification of used refrigerants, training of custom officers. (Author)

  6. The CHUVA Lightning Mapping Campaign

    Science.gov (United States)

    Goodman, Steven J.; Blakeslee, Richard J.; Bailey, Jeffrey C.; Carey, Lawrence D.; Hoeller, Hartmut; Albrecht, Rachel I.; Morales, Carlos; Pinto, Osmar; Saba, Marcelo M.; Naccarato, Kleber; Hembury, Nikki; Nag, Amitabh; Heckman, Stan; Holzworth, Robert H.; Rudlosky, Scott D.; Betz, Hans-Dieter; Said, Ryan; Rauenzahn, Kim

    2011-01-01

    The primary science objective for the CHUVA lightning mapping campaign is to combine measurements of total lightning activity, lightning channel mapping, and detailed information on the locations of cloud charge regions of thunderstorms with the planned observations of the CHUVA (Cloud processes of tHe main precipitation systems in Brazil: A contribUtion to cloud resolVing modeling and to the GPM (GlobAl Precipitation Measurement) field campaign. The lightning campaign takes place during the CHUVA intensive observation period October-December 2011 in the vicinity of S o Luiz do Paraitinga with Brazilian, US, and European government, university and industry participants. Total lightning measurements that can be provided by ground-based regional 2-D and 3-D total lightning mapping networks coincident with overpasses of the Tropical Rainfall Measuring Mission Lightning Imaging Sensor (LIS) and the SEVIRI (Spinning Enhanced Visible and Infrared Imager) on the Meteosat Second Generation satellite in geostationary earth orbit will be used to generate proxy data sets for the next generation US and European geostationary satellites. Proxy data, which play an important role in the pre-launch mission development and in user readiness preparation, are used to develop and validate algorithms so that they will be ready for operational use quickly following the planned launch of the GOES-R Geostationary Lightning Mapper (GLM) in 2015 and the Meteosat Third Generation Lightning Imager (LI) in 2017. To date there is no well-characterized total lightning data set coincident with the imagers. Therefore, to take the greatest advantage of this opportunity to collect detailed and comprehensive total lightning data sets, test and validate multi-sensor nowcasting applications for the monitoring, tracking, warning, and prediction of severe and high impact weather, and to advance our knowledge of thunderstorm physics, extensive measurements from lightning mapping networks will be collected

  7. Contextual Influences and Campaign Awareness Among Young Adults: Evidence from the National truth® Campaign.

    Science.gov (United States)

    Vallone, Donna M; Ilakkuvan, Vinu; Xiao, Haijun; Cantrell, Jennifer; Rath, Jessica; Hair, Elizabeth

    2015-01-01

    Mass media campaigns have been found to shape the public's knowledge, attitudes, beliefs, and behavior around tobacco. This study examines the influence of contextual factors with respect to awareness of the national truth® campaign, a mass media, branded tobacco use prevention campaign, among a sample of young adults (n = 2,804) aged 24-34 years old; these respondents were within the age range for both the primary and secondary targets of the campaign during the period (2000-2007) when the campaign was airing television advertising at consistently high levels. Mulitvariable models reveal lower educational attainment and Hispanic ethnicity as significant contextual factors predictive of lower campaign awareness, controlling for media use. In contrast, gender, state tobacco control policy, sensation-seeking, current smoking status, and community-level SES variables were not significantly associated with campaign awareness. Further research is needed to identify the mechanisms through which public education campaigns operate, particularly among disadvantaged communities. PMID:26332933

  8. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2011-09-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the 'Grand Challenge' for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  9. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2010-10-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the “Grand Challenge” for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  10. Temperature, salinity, dissolved oxygen, fluorometer, and other data collected with CTD casts during six ECOHAB cruises in the Northeast Pacific and Puget Sound, 6/2/2003 - 10/4/2006 (NODC Accession 0049079)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is the final processed data for the following cruises in the northeastern Pacific Ocean, Strait of Juan De Fuca, and Puget Sound from 20030602 to 20061004: 1....

  11. Energy efficiency public service advertising campaign

    Energy Technology Data Exchange (ETDEWEB)

    Gibson-Grant, Amanda [Advertising Council, New York, NY (United States)

    2015-06-12

    The Advertising Council (“the Ad Council”) and The United States Department of Energy (DOE) created and launched a national public service advertising campaign designed to promote energy efficiency. The objective of the Energy Efficiency campaign was to redefine how consumers approach energy efficiency by showing that saving energy can save homeowners money.

  12. Designing an effective counteradvertising campaign--Arizona.

    Science.gov (United States)

    Riester, T; Linton, M

    1998-12-15

    In this report, the authors describe an innovative antitobacco advertising campaign in Arizona that was aimed at youth. The campaign utilizes traditional as well as non-traditional methods of research to determine the attitudes, behavior and values of today's adolescents. These creative methodologies led to rigorously tested and well-received media strategies. PMID:9874390

  13. AAU-DLR 2010 Indoor Measurement Campaign

    DEFF Research Database (Denmark)

    Steinböck, Gerhard; Pedersen, Troels; Wang, Wei

    2011-01-01

    A measurement campaign, not part of the WHERE2 project, with the focus on indoor multilink and reverberant in-room channels was conducted by DLR and AAU. The measurement data is used from both parties within the WHERE2 project and can be shared upon request. The measurement campaign has two main...

  14. Political Campaigns Get Personal with Students

    Science.gov (United States)

    Hermes, J. J.

    2007-01-01

    On Election Day in 2006, some students at the University of Texas at Austin were prodded by startlingly personal calls from Democratic Party supporters. As political campaigns look to corral young voters, those calls could be a harbinger of things to come in 2008: campaigns going after students through contact information that public colleges are…

  15. Measurement campaigns for holdup estimation

    International Nuclear Information System (INIS)

    The derivation of technically defensible holdup estimates is described. Considerations important in the planning of measurement campaigns to provide necessary data are reviewed and the role of statistical sampling is discussed. By design, the presentation is nonmathematical and intended for a general audience. Though clearly important, use of sampling principles in the planning of holdup-related activities is sometimes viewed with apprehension. Holdup is often poorly understood to begin with, and the incorporation of the esoteric matters only adds to an image problem. Unfortunately, there are no painless options. In many operating facilities, surface areas on which holdup has accumulated amount to many square miles. It is not practical to pursue 100% measurement of all such surface areas. Thus, some portion is measured - constituting a ''sample,'' whether obtained by a formal procedure or not. Understanding the principles behind sampling is important in planning and in developing legitimate holdup estimates. Although derivation of legitimate, facility-wide holdup estimates is not currently mandated by Department of Energy regulatory requirements, the related activities would greatly advance the present state of knowledge

  16. The replanting campaign has begun

    CERN Multimedia

    GS-SEM Group - General Infrastructure and Services Department

    2010-01-01

    The poplars on the border of CERN's Prévessin site were felled, according to plan, on Friday, 26 February. The work was essential as the trees were showing signs of serious ageing problems (broken and dead branches, weakened trunks and root systems, etc.) and needed to be felled to ensure the safety of drivers on the D35 The trees that have been cut will be transformed into renewable energy wood chips and used to heat local schools and crèches. They will be replaced by a hedge of hornbeams, a native fast-growing tree, which will be planted in the spring.     The felling operation was entrusted to the French national forestry authorities, with the support of the Bellegarde-Pays de Gex Agence Routière et Technique. It marks the start of a vast poplar-felling and replanting campaign, which will be extended to CERN's Meyrin site.  The work is part of CERN's general renovation and site planning scheme for the future.    

  17. ADVANCED FUELS CAMPAIGN 2013 ACCOMPLISHMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2013-10-01

    The mission of the Advanced Fuels Campaign (AFC) is to perform Research, Development, and Demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This includes development of a state-of-the art Research and Development (R&D) infrastructure to support the use of “goal-oriented science-based approach.” In support of the Fuel Cycle Research and Development (FCRD) program, AFC is responsible for developing advanced fuels technologies to support the various fuel cycle options defined in the Department of Energy (DOE) Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. Accomplishments made during fiscal year (FY) 2013 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section.

  18. Micro-chemical analysis of high heat loaded CFC-Cu interfaces from Tore Supra and Wendelstein 7-X

    International Nuclear Information System (INIS)

    A comparison of high-heat-flux tested carbon-fiber reinforced carbon (CFC)/Cu materials of Tore Supra and Wendelstein 7-X plasma-facing components is made in order to understand the different fatigue behavior of the bonding interfaces, in particular for the Tore Supra materials. The elemental distribution around the bonding layer and the chemical composition of the active element titanium are characterized by secondary ion mass spectrometry and x-ray photoelectron spectroscopy. The results show that the improved bonding of the Wendelstein 7-X target elements compared to the Tore Supra pump limiter elements is due to a modified silicon and titanium distribution at the bonding interface. However, the difference in fatigue behavior between the two Tore Supra components cannot be attributed to the bonding interface, since the elemental distribution and chemistry of these components are identical and no degradation is observed after an extended heat flux exposure.

  19. Challenges and opportunities for dietary campaigns

    DEFF Research Database (Denmark)

    Bech-Larsen, Tino; Aschemann-Witzel, Jessica; Verbeke, Wim;

    2013-01-01

    The objective of our research was to explore and discuss the challenges and opportunities inherent to the management of public healthy eating campaigns. The discussion is based on a study of campaign managers’ perceptions of nine successfully implemented European healthy eating campaigns. Based on...... these interviews, we suggest that social marketing compared to commercial food marketing is not necessarily at a disadvantage; rather, social marketers working to promote healthy eating can benefit from the formation of alliances with public and private partners, the empowerment of their targets and of...

  20. Evaluation of a brief anti-stigma campaign in Cambridge: do short-term campaigns work?

    Directory of Open Access Journals (Sweden)

    Henderson Claire

    2010-06-01

    Full Text Available Abstract Background In view of the high costs of mass-media campaigns, it is important to understand whether it is possible for a media campaign to have significant population effects over a short period of time. This paper explores this question specifically in reference to stigma and discrimination against people with mental health problems using the Time to Change Cambridge anti-stigma campaign as an example. Methods 410 face-to-face interviews were performed pre, during and post campaign activity to assess campaign awareness and mental health-related knowledge, attitudes and behaviours. Results Although campaign awareness was not sustained following campaign activity, significant and sustained shifts occurred for mental health-related knowledge items. Specifically, there was a 24% (p If a friend had a mental health problem, I know what advice to give them to get professional help, following the campaign. Additionally, for the statement: Medication can be an effective treatment for people with mental health problems, there was a 10% rise (p = 0.05 in the proportion of interviewees responding 'agree' or 'strongly agree' following the campaign. These changes, however, were not evident for attitudinal or behaviour related questions. Conclusions Although these results only reflect the impact of one small scale campaign, these preliminary findings suggest several considerations for mass-media campaign development and evaluation strategies such as: (1 Aiming to influence outcomes pertaining to knowledge in the short term; (2 Planning realistic and targeted outcomes over the short, medium and long term during sustained campaigns; and (3 Monitoring indirect campaign effects such as social discourse or other social networking/contact in the evaluation.

  1. Philippine campaign boosts child immunizations.

    Science.gov (United States)

    Manuel-santana, R

    1993-03-01

    In 1989, USAID awarded the Philippines a 5-year, US $50 million Child Survival Program targeting improvement in immunization coverage of children, prenatal care coverage for pregnant women, and contraceptive prevalence. Upon successful completion of performance benchmarks at the end of each year, USAID released monies to fund child survival activities for the following year. This program accomplished a major program goal, which was decentralization of health planning. The Philippine Department of Health soon incorporated provincial health planning. The Philippine Department of Health soon incorporated provincial health planning in its determination of allocation of resources. Social marketing activities contributed greatly to success in achieving the goal of boosting the immunization coverage rate for the 6 antigens listed under the Expanded Program for Immunization (51%-85% of infants, 1986-1991). In fact, rural health officers in Tarlac Province in Central Luzon went from household to household to talk to mothers about the benefits of immunizing a 1-year-old child, thereby contributing greatly to their achieving a 95% full immunization coverage rate by December 1991. Social marketing techniques included modern marketing strategies and multimedia channels. They first proved successful in metro Manila which, at the beginning of the campaign, had the lowest immunization rate of all 14 regions. Every Wednesday was designated immunization day and was when rural health centers vaccinated the children. Social marketing also successfully publicized oral rehydration therapy (ORT), breast feeding, and tuberculosis control. Another contributing factor to program success in child survival activities was private sector involvement. For example, the Philippine Pediatric Society helped to promote ORT as the preferred treatment for acute diarrhea. Further, the commercial sector distributed packets of oral rehydration salts and even advertised its own ORT product. At the end of 2

  2. Nuclear lobby group launches television ad campaign

    International Nuclear Information System (INIS)

    Nuclear power is the green wave of the future, according to a television advertising campaign launched by Canada's nuclear industry and designed to help counter the anti-nuclear messages delivered by groups such as Green peace and Energy Probe

  3. Media campaign educates public on ED overcrowding.

    Science.gov (United States)

    2004-04-01

    A Tennessee health care system is reducing overcrowding in its EDs with a media campaign that urges patients with nonurgent needs to seek other care options. The campaign has contributed to a 5% decrease in ED volume at one hospital in the first few months. Advertising spots urge patients to go to primary care physicians and urgent care clinics. ED staff help educate patients while treating them for nonurgent needs. PMID:15077530

  4. Brand experiences in engaging marketing campaigns

    OpenAIRE

    Reisegg, Kristin

    2012-01-01

    This research examines the effects from engaging marketing campaigns on brand experiences and the potential outcome on affective commitment and loyalty. In doing this, it also test the validity of the brand experience scale in a new setting during a short term marketing campaign. The research was conducted as a natural experiment during a marketing event arranged by Litago. Data were collected from participants and a control group, and the survey was sent out through the online survey tool...

  5. Campaign nostalgia in the Chinese countryside

    OpenAIRE

    O'Brien, KJ; Li, L.

    1999-01-01

    Campaign nostalgia is an indicator of frustration and unmet expectations. Its origins trace to an unwillingness on the part of the Party leadership to rely on mass mobilization to check cadre corruption. Under Mao, political campaigns at least occasionally afforded ordinary Chinese opportunities to hold grassroots leaders who transgressed regime norms accountable. Nowadays, some villagers chafe at the lack of such opportunities. They see electoral reforms, potentially beneficial policies (suc...

  6. SEPARATIONS AND WASTE FORMS CAMPAIGN IMPLEMENTATION PLAN

    Energy Technology Data Exchange (ETDEWEB)

    Vienna, John D.; Todd, Terry A.; Peterson, Mary E.

    2012-11-26

    This Separations and Waste Forms Campaign Implementation Plan provides summary level detail describing how the Campaign will achieve the objectives set-forth by the Fuel Cycle Reasearch and Development (FCRD) Program. This implementation plan will be maintained as a living document and will be updated as needed in response to changes or progress in separations and waste forms research and the FCRD Program priorities.

  7. Internet marketing campaign for railway hotel

    OpenAIRE

    Min LIU

    2012-01-01

    The purpose of this thesis was to recognize the significant influence of Internet application in the marketing area and explore the specific processes when planning a successful marketing campaign for medium-sized company, also to create a new Internet marketing campaign to improve the target company‟s brand recognition and its communications with customers. The theoretical part of the thesis was composed of Internet marketing development elements including definition, role and strategy. I...

  8. Influence of wind fields on the uptake of CFC-11 in the global ocean model%风场对全球海洋CFC-11吸收的影响

    Institute of Scientific and Technical Information of China (English)

    方怡; 徐永福; 李阳春; 覃军

    2014-01-01

    为了在中国科学院大气物理研究所的全球海洋模式(LASG/IAP Climate Ocean Model, LICOM)中研究不同的风场引起的海气传输速度对三氯一氟甲烷(CFC-11)在海洋中的分布和吸收产生的影响,同时选出更适用于 LICOM 模式模拟海洋对气体吸收的风场,本文做了4组对比实验,即传输速度为常数(实验-C)以及依赖3个不同风场(Esbensen and Kushnir观测风场(实验-EK)、National Centers for Environmental Prediction(NCEP)再分析风场(实验-NP)、QuikSCAT卫星风场(实验-QS))的实验。在对比分析中重点考察了CFC-11的海气通量、海表浓度、水柱总量、传输过程等。结果显示,不同风场带来的传输速度差异会造成模拟结果在局部海域存在显著差异,但在大部分海域的差异并不显著。而且随着积分时间的增加,从海气通量、存储量两方面可以看出,不同模拟结果之间的差异有着减小的趋势。如1955年1月北大西洋局部地区,不同的风场下的海气通量模拟结果间的差异达到20%左右,到了1995年1月这种差异下降到15%左右。此外,传输速度的选取依赖风场计算值的全球平均值(试验-C)会造成模拟结果相对偏小,而风速相对较大的QuikSCAT卫星风场资料在一定程度上使得模式模拟结果与观测资料更为接近。%Using a global ocean general circulation model (LICOM) developed by the Institute of Atmospheric Physics (IAP) of the Chinese Academy of Sciences, we conducted four numerical experiments to investigate the influence of different wind fields on the uptake and transport of CFC-11 in the global ocean. Three experiments were performed using the same formula of the air-sea gas transfer velocity that is dependent on wind speed, in which wind speeds were from Esbensen and Kushnir (Exp-EK), NCEP (Exp-NP) and QuickSCAT (Exp-QS). An-other experiment is called Exp-C, in which the transfer velocity is a space-independent constant of 14.5 cm

  9. Social media in advertising campaigns: examining the effects on perceived persuasive intent, campaign and brand responses

    OpenAIRE

    Voorveld, H.A.M.; Noort, van, F.R.

    2014-01-01

    Inspired by the increasing popularity of advertising on social media, and especially on social network sites (SNSs), the aim of this study is to give insight into the effectiveness of SNS advertising. The first experimental study compares consumer responses to advertising on SNSs and television (TV) and demonstrates that while TV campaigns are evaluated more positively, SNS campaigns result in more favourable cognitive responses. Moreover, the persuasive intent of SNS campaigns is less recogn...

  10. Schistosomiasis and the Philippine campaign

    Institute of Scientific and Technical Information of China (English)

    Cristóbal S.Berry-Cabá

    2008-01-01

    ,relapses were rare.It was a successful campaign against schistosomiasis in the army.

  11. 29 CFR 452.67 - Distribution of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Distribution of campaign literature. 452.67 Section 452.67... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.67 Distribution of campaign literature. The Act... distribute his campaign literature to the membership at his expense. When the organization or its...

  12. RULES OF ELECTION CAMPAIGN: EXAMPLES FROM THE PRACTICE

    Directory of Open Access Journals (Sweden)

    Nicolae LUPAȘCU

    2012-06-01

    Full Text Available This paper aims to address the issue of campaign strategy as an essential introductory aspect of any election campaign. It is known that all campaigns contain the same specific ingredients: candidates, polls, strategies, messages, advertising, organizing, fundraising, etc. But, on the other hand, every campaign has its own dissimilarities, and the approach and campaign strategy must be defined and adapted to comply with existing elements. The conclusion to be drawn is that no one can determine the appropriate strategy for any political or military campaign, without knowing the players, the political context, problems,trends and resources. These factors make each campaign unique.

  13. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    OpenAIRE

    I Made Rasta; I W. Kasa; I Gede Mahardika

    2015-01-01

    CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 co...

  14. Amateur astronomers in support of observing campaigns

    Science.gov (United States)

    Yanamandra-Fisher, P.

    2014-07-01

    The Pro-Am Collaborative Astronomy (PACA) project evolved from the observational campaign of C/2012 S1 or C/ISON. The success of the paradigm shift in scientific research is now implemented in other comet observing campaigns. While PACA identifies a consistent collaborative approach to pro-am collaborations, given the volume of data generated for each campaign, new ways of rapid data analysis, mining access, and storage are needed. Several interesting results emerged from the synergistic inclusion of both social media and amateur astronomers: - the establishment of a network of astronomers and related professionals that can be galvanized into action on short notice to support observing campaigns; - assist in various science investigations pertinent to the campaign; - provide an alert-sounding mechanism should the need arise; - immediate outreach and dissemination of results via our media/blogger members; - provide a forum for discussions between the imagers and modelers to help strategize the observing campaign for maximum benefit. In 2014, two new comet observing campaigns involving pro-am collaborations have been identified: (1) C/2013 A1 (C/Siding Spring) and (2) 67P/Churyumov-Gerasimenko (CG). The evolving need for individual customized observing campaigns has been incorporated into the evolution of PACA (Pro-Am Collaborative Astronomy) portal that currently is focused on comets: from supporting observing campaigns for current comets, legacy data, historical comets; interconnected with social media and a set of shareable documents addressing observational strategies; consistent standards for data; data access, use, and storage, to align with the needs of professional observers. The integration of science, observations by professional and amateur astronomers, and various social media provides a dynamic and evolving collaborative partnership between professional and amateur astronomers. The recent observation of comet 67P, at a magnitude of 21.2, from Siding

  15. Remembering the 100,000 lives campaign

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2016-06-01

    Full Text Available No abstract available. Article truncated after 150 words. Earlier this week the Institute for Healthcare Improvement (IHI emailed its weekly bulletin celebrating that it has been ten years since the end of the 100,000 Lives Campaign (Appendix 1. This was the campaign, according to the bulletin, that put IHI on the map. The Campaign started at the IHI National Forum in December 2004, when IHI's president, Don Berwick, announced that IHI would work together with nearly three-quarters of the US hospitals to reduce needless deaths by 100,000 over 18 months. A phrase borrowed from political campaigns became IHI's cri de coeur: “Some is not a number. Soon is not a time.” The Campaign relied on six key interventions: Rapid Response Teams; Improved Care for Acute Myocardial Infarction; Medication Reconciliation; Preventing Central Line Infections; Preventing Surgical Site Infections; Preventing Ventilator-Associated Pnemonia [sic]. According to the bulletin, the Campaign’s impact rippled across the organization and the world. IHI listed some ...

  16. Tainted Money? Contribution Limits and the Effectiveness of Campaign Spending

    OpenAIRE

    Stratmann, Thomas

    2003-01-01

    Campaign expenditures are not effective in increasing candidates’ vote shares if voters do not respond to the advertisement when they believe that campaign expenditures are financed with “tainted money.” In this situation, limiting contributions may reduce the number of policy favors that candidates promise to contributors, and thereby increase the effectiveness of campaign spending. Exploiting cross-state variation in campaign finance laws, this paper tests whether campaign expenditures by s...

  17. X-ray micro-laminography for the ex situ analysis of W-CFC samples retrieved from JET ITER-like wall

    Science.gov (United States)

    Tiseanu, I.; Craciunescu, T.; Lungu, M.; Dobrea, C.; Contributors, JET

    2016-02-01

    x-ray micro-laminography was qualified and implemented as a complementary solution for the 3D microstructural analysis of tungsten coated carbon-fibre reinforced carbon (W/CFC) samples retrieved from JET ITER-like wall. As expected, the W layers spatially correlate with the morphology of the CFC substrate. Three main cases were distinguished; (i) tungsten layers coated parallel to PAN fibre bundles tend to have a quasi-continuous, weakly waved surface (waves amplitude <100 μm) (ii) tungsten layers coated onto the relatively porous felt region appear to smoothly follow even the surface of the largest pores of around 250 μm and (iii) samples coated perpendicular to the PAN fibre bundles display frequently and strong crater-like discontinuities of the metal layer. The characteristics dimensions of these gaps range in the order of 300-400 μm both in the coating plane and perpendicular to it. On some craters the bottom W layer is broken and the generated debris can be found even deeper than one mm into the CFC substrate. These W particles, sized of 20-40 μm, are always found in the large gaps located between the fibre bundles perpendicular to the coated surface.

  18. Local Election Campaign in Social Media

    DEFF Research Database (Denmark)

    Bock Segaard, Signe; Agger Nielsen, Jeppe

    In this paper we focus on the usage of social media in political election campaigns. These new arenas have become increasingly important for democratic purposes, such as opinion sharing and discussions between candidates and voters. But there is a lack of research on how social media is used...... in local election campaigns. Therefore, the aim of this study is to investigate the use of social media as it was intended to be central arenas for local election campaigns in Norwegian municipalities. For that purpose we first develop a model of political communication in social media that conceptualise...... candidates, content registration of local blogs, and log file data of local blogs through Google Analytics). In contrast to the democratic vision for social media the analysis demonstrates that the election blogs primarily are used by those who are most politically active in advance. The analysis also shows...

  19. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Multimedia

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the Infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  20. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Multimedia

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  1. Road safety campaign is a great success

    CERN Multimedia

    2008-01-01

    Rolf Heuer, the next Director-General of CERN, and Sigurd Lettow, the Director of Finance and Human Resources (photo below), completed all the tests of the CERN road safety campaign under the supervision of TCS instructors. The road safety campaign, which took place in the Main Building during the week of 10 November, attracted large numbers of participants. More than 300 CERN personnel and users took part in, and in some cases were literally bowled over by, the activities set up by instructors from the TCS (Touring Club Suisse). The campaign’s aim was to raise driver awareness of several aspects of road safety, including speed, use of mobile phones at the wheel, pedestrian priority, unlawful parking and driving with a valid licence. The campaign was an unqualified success! Even CERN’s directors joined in, testing their own reactions as drivers on the various pieces of apparatus in place.

  2. The (n,γ campaigns at EXILL

    Directory of Open Access Journals (Sweden)

    Jolie J.

    2015-01-01

    Full Text Available At the PF1B cold neutron beam line at the Institut Laue Langevin, the EXILL array consisting of EXOGAM, GASP and ILL-Clover detectors was used to perform (n,γ measurements at very high coincidence rates. About ten different reactions were measured in autumn 2012 using a highly collimated cold neutron beam. In spring 2013, the EXOGAM array was combined with 16 LaBr3(Ce scintillators in the EXILL&FATIMA campaign for the measurement of lifetimes using the generalised centroid difference method. We report on the properties of the set-ups and present first results from both campaigns.

  3. Reporting for LHC hardware commissioning campaigns

    CERN Document Server

    Magerl, Wolfgang

    2014-01-01

    The LHC will be qualified for the restart of physics operation during a Hardware Commissioning Campaign, in which up to 10000 tests will have to be tracked and analysed on more than 1700 circuits. The AccTesting framework orchestrates this campaign according to a planning defined by LHC operators and system experts. Using a reporting tool like JasperReports will allow the AccTesting Framework to expose concise and accurate information to system experts and coordination committees about the executed tests and test plans.

  4. Development of a low temperature solid HIP process for joining CFC monoblocks onto CuCrZr tubes

    International Nuclear Information System (INIS)

    A low temperature solid HIP process is developed for ITER Divertor Baffle components in order to join AMC CFC monoblocks onto CuCrZr tubes without overaging. For the fabrication solution annealed cold worked CuCrZr-tubes age-hardened during the hot isostatic pressing (HIP) process are joined to the back-casted (AMC) WHC copper ring of the WC monoblock. The process relevant influence parameters (clearance between components, thickness of can, maximum HIP pressure, pressure and temperature history in time) and quality relevant parameters (contact pressure at HIP interface, stresses in the WC body) are determined in a brainstorming. By using the design of experiments (DoE) software a number of parameter sets are defined that act as input for the process simulation via finite element method (FEM) based models each of which representing an individual parameter set. The values for the quality relevant parameters calculated this way are then evaluated with the DoE software in order to detect the functional dependencies between them. An optimum set of parameters is detected and has been verified successfully in a manufacturing process of several prototype components as well as full-scale components for the ITER Divertor Baffle. (author)

  5. Simulation experimental investigation of plasma off-normal events on advanced silicon doped CFC-NS31

    International Nuclear Information System (INIS)

    Fusion devices high heat loading due to off-normal events (e.g., plasma disruption, slow transients and ELMs, which can occur during a transition from detached to attached divertor operation) requires high thermal conductivity materials. Therefore, carbon fiber composites (CFCs) with high thermal conductivity are favorable. In the framework of the European Fusion Technology program, a great effort has been made to develop Si doped CFCs. NS31 is a 3D CFC containing about 8-10 at.% of silicon. The previous results showed, that NS31 poses lower chemical erosion, lower tritium retention and higher resistivity to water/oxygen reaction in comparing with undoped CFCs. Off-normal simulation experiments were performed under two conditions: (a) 700 MW/m2, 10 ms and (b) slow transient 20 MW/m2, 2 and 4 s. NS31 behaved very stable even under these extremely severe conditions. In this paper, the detailed results of simulation experiment on high heat loading due to off-normal events are presented and consequences are discussed

  6. Microstructure and properties of SiC gradiently coated Cf/C composites prepared by a RCLD method

    Institute of Scientific and Technical Information of China (English)

    Jun-hua Chen; Cuang-li Chen; Hao-ran Geng; Yan Wang

    2009-01-01

    The SiC gradiently coated carbon fiber/carbon (Cf/C) composites were prepared by a two-step rapid chemical liquid depo-sition (RCLD) method. The microstructure and properties of the composites were investigated using X-ray diffraction, scanning elec-tron microscopy together with energy dispersive X-ray analysis, bending tests, and oxidation tests. The experimental results show that the surface layer of the composites is composed of SiC, pyrocarbon, and carbon fibers. Their inner area consists of pyrocarbon and carbon fibers. The SiC content gradiently decreases with increasing distance from the outer surface to the center of the compos-ites. Furthermore, the thickness of the SiC layer increases with increasing tetraethylorthosilicate content and deposition time. SiC coatings have no significant influence on the bending strength of the composites. However, the oxidation resistance of the compos-ites increases with increasing thickness of the SiC layer.

  7. Teen PACK: Population Awareness Campaign Kit.

    Science.gov (United States)

    Zero Population Growth, Inc., Washington, DC.

    This packet of instructional materials is designed to teach teenagers about the effects of overpopulation on the world and on the individual. Information is presented in three related booklets. The first of the three parts of the "Teen Population Awareness Campaign Kit," illustrates overpopulation through profiles of teens living in Shanghai,…

  8. Vehicle of Change: The PS 2013 Campaign

    Science.gov (United States)

    Guevara, Fiorella

    2014-01-01

    A change in political leadership typically signals a growth in organizing campaigns to find and endorse the candidate with ideas most similar to their own. However, what if instead of focusing on finding the best candidate, organizing groups decided to focus on the conversation? How would you then use an election to engage the members of the…

  9. Transmutation Fuels Campaign FY-09 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2009-09-01

    This report summarizes the fiscal year 2009 (FY-08) accomplishments for the Transmutation Fuels Campaign (TFC). The emphasis is on the accomplishments and relevance of the work. Detailed description of the methods used to achieve the highlighted results and the associated support tasks are not included in this report.

  10. Media Campaigns Promote Driver Safety for Farmworkers.

    Science.gov (United States)

    Grieshop, James I.; Grajales-Hall, Myriam; Ortiz, Lupe

    1998-01-01

    A Spanish-language program was developed to educate California migrant farmworker families about motor vehicle safety using a bingo-like game similar to one popular in Mexico. The game disseminated safe-driving information in weekly bilingual newspapers and on Spanish radio and television. Assessments suggest that the media campaigns favorably…

  11. Gender identity and breast cancer campaigns

    NARCIS (Netherlands)

    S. Puntoni (Stefano); S.T.L.R. Sweldens (Steven); N.T. Tavassoli (Nader)

    2011-01-01

    textabstractConcerning itself with understanding how marketing methods and tools can be of benefit to healthcare professionals, health marketing is an area of research that has grown substantially in recent years. Of much interest to the sector is whether awareness campaigns are effective in increas

  12. Gender identity and breast cancer campaigns

    OpenAIRE

    Puntoni, Stefano; Sweldens, Steven; Tavassoli, Nader

    2011-01-01

    textabstractConcerning itself with understanding how marketing methods and tools can be of benefit to healthcare professionals, health marketing is an area of research that has grown substantially in recent years. Of much interest to the sector is whether awareness campaigns are effective in increasing the public’s perceived vulnerability to any given disease.

  13. Microform Awareness through a Public Relations Campaign.

    Science.gov (United States)

    Pitch, Judi

    1986-01-01

    Realities of space limitations, microform availability, paper copy loss, and mutilation require that library patrons accept use of microforms. A public relations campaign, appropriately timed and involving staff training, displays, events, and publicity, can be used to inform and instruct patrons in availability and use of microform collections…

  14. Analyzing the Communication Dynamics of Political Campaigns

    Science.gov (United States)

    Tannenbaum, Sally

    2007-01-01

    It is widely agreed that college students do not fully participate in the political process. The most commonly cited reasons are apathy, indifference, and ignorance. This article presents an activity that aims to help students learn about communication dynamics in the context of political campaigns and develop an appreciation and confidence about…

  15. Japanese campaign to enthuse young scientists

    CERN Multimedia

    1999-01-01

    Japan's Science and Technology Agency has launched a 3-year campaign to promote the public understanding of science and revive the interest in science subjects in schools. Plans include a science-only television channel and a 'virtual science museum' on the Internet (2 paragraphs).

  16. White Paper on Televised Political Campaign Debates.

    Science.gov (United States)

    Argumentation and Advocacy, 2002

    2002-01-01

    Surveys existing research on televised campaign debates; indicates areas for future research; considers the resources needed to expand and improve current research efforts; and encourages more systematic and sustained inquiry. Notes two compelling needs in terms of resources: an archive containing comprehensive records of media coverage of the…

  17. The Political Scientist as Local Campaign Consultant

    Science.gov (United States)

    Crew, Robert E., Jr.

    2011-01-01

    During my 45 years as an academic, I have followed the admonition sometimes attributed to the legendary Jedi warrior Obi-Wan Kenobe that political scientists should "use [their] power for good and not for evil." In this spirit, I have devoted substantial portions of my career to public service by providing strategic advice and campaign management…

  18. Educative campaign about information on irradiated foods

    International Nuclear Information System (INIS)

    The irradiation of foods is accepted by international agencies (FAO, OMS) like a healthy and effective technology at the moment the irradiated foods are marketed easily in many countries, however in other countries exist several factors that affect the practical application of this process. In this work is planned about an educational campaign about the irradiation process directed to the consumers. (Author)

  19. The DAURE field campaign: meteorological overview

    Directory of Open Access Journals (Sweden)

    O. Jorba

    2011-02-01

    Full Text Available From end of February until March 2009 and July 2009 the experimental campaign named DAURE took place in northeastern Spain in both an urban and rural sites (Barcelona city and Montseny Natural Park with the main objective of studying the formation and transport processes of particulate matter in the region. Several groups collaborated in an extensive measurement campaign with aerosol monitoring, meteorological measurements, atmospheric vertical structure retrievals from LIDAR and supported by numerical simulations of the meteorological and air quality conditions over the region. In this article, we present a description of the main meteorological conditions that affected the Barcelona geographical area during the campaign. The main synoptic conditions are identified and discussed by means of meteorological observations and numerical weather prediction models. Furthermore, a detailed analysis of the local meteorological conditions during the campaign is also presented. The characteristic surface wind field and the vertical structure of the main flows affecting Barcelona and the Montseny rural site are discussed using high-resolution mesoscale meteorological simulations, vertical profiles of LIDAR measurements, radiosoundings, and analysis of backward dispersion simulations with a Lagrangian model. The analysis permits the identification of three main meteorological regimes for the winter campaign (February and March 2009: a first regime dominated by high-pressure conditions over Barcelona and western Mediterranean Basin, high insolation, and the development of thermally-driven wind flows. A second regime is characterized by a strong northwestern advection that produced a cleansing action over the atmosphere. And a third identified regime is dominated by strong stagnant conditions produced by thermal inversions that decouple the low troposphere of plain and coastal areas from mountainous terrains. On the other hand, the main meteorological regimes

  20. An overview of the AROMAT campaigns

    Science.gov (United States)

    Merlaud, Alexis; Dekemper, Emmanuel; Van Roozendael, Michel; Constantin, Daniel; Georgescu, Lucian; Meier, Andreas; Richter, Andreas; Den Hoed, Mirjam; Allaart, Marc; Boscornea, Andreea; Vajaiac, Sorin; Bellegante, Livio; Nemuc, Anca; Nicolae, Doina; Shaifangar, Reza; Dörner, Steffen; Wagner, Thomas; Stebel, Kerstin; Schuettemeyer, Dirk

    2016-04-01

    The Airborne ROmanian Measurements of Aerosols and Trace gases (AROMAT) campaign and its follow-up AROMAT-2 were held in September 2014 and August 2015, respectively. Both campaigns focused on two geophysical targets: the city of Bucharest and the large power plants of the Jiu Valley, which are located in a rural area 170 km West of Bucharest. These two areas are complementary in terms of emitted chemical species and their spatial distributions. The objectives of the AROMAT campaigns were (i) to test recently developed airborne observation systems dedicated to air quality satellite validation studies such as the AirMAP imaging DOAS system (University of Bremen), the NO2 sonde (KNMI), and the compact SWING whiskbroom imager (BIRA), and (ii) to prepare the validation programme of the future Atmospheric Sentinels, starting with Sentinel-5 Precursor (S5P) to be launched in early summer 2016. We present results from the different airborne instrumentations and from coincident ground-based measurements (lidar, in-situ, and mobile DOAS systems) performed during both campaigns. The AROMAT dataset addresses several of the mandatory products of TROPOMI/S5P, in particular NO2 and SO2 (horizontal distribution and profile from aircraft, plume image with ground-based SO2 and NO2 cameras, transects with mobile DOAS, in-situ), H2CO (mobile MAX-DOAS), and aerosols (lidar, airborne FUBISS-ASA2 sun-photometer, and aircraft in-situ). We investigate the information content of the AROMAT dataset for satellite validation studies based on co-located OMI and GOME-2 data, and simulations of TROPOMI measurements. The experience gained during AROMAT and AROMAT-2 will be used in support of a large-scale TROPOMI/S5P validation campaign in Romania scheduled for summer 2017.

  1. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Maurice Ewing Cruise in the Atlantic Ocean (WOCE Section A17, 4 January - 21 March 1994)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2005-06-30

    This documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and pH at hydrographic stations during the R/V Maurice Ewing cruise in the South Atlantic Ocean on the A17 WOCE section. Conducted as part of the World Ocean Circulation Experiment (WOCE), this cruise was also a part of the French WOCE program consisting of three expeditions (CITHER 1, 2, and 3) focused on the South Atlantic Ocean. The A17 section was occupied during the CITHER 2 expedition, which began in Montevideo, Uruguay, on January 4, 1994 and finished in Cayenne, French Guyana, on March 21, 1994. During this period the ship stopped in Salvador de Bahia and Recife, Brazil, to take on supplies and exchange personnel. Upon completion of the cruise the ship transited to Fort de France, Martinique. Instructions for accessing the data are provided.

  2. A Smoking Cessation Campaign on Twitter: Understanding the Use of Twitter and Identifying Major Players in a Health Campaign.

    Science.gov (United States)

    Chung, Jae Eun

    2016-05-01

    The current study examined the use of online social media for a health campaign. Collecting tweets (N = 1,790) about the recent smoking cessation campaign by the Centers for Disease Control and Prevention, the current study investigated the dissemination of health campaign messages on Twitter and answered questions from the process evaluation of health campaigns: who tweeted about the campaign, who played central roles in disseminating health campaign messages, and how various features of Twitter were used for sharing of campaign messages. Results showed that individuals and nonprofit organizations posted frequently about the campaign: Individuals and nonprofit organizations posted about 40% and 30% of campaign-related tweets, respectively. Although the campaign under investigation was steered by a government agency, nonprofit organizations played a vital role as mediators who disseminated campaign messages. The culture of retweeting demonstrated its particular usefulness for the dissemination of campaign messages. Despite the expectation that the use of social media would expand opportunities for engagement, actual two-way interactions were few or minimal. Drawn from the results, practical suggestions on how to strategize the use of Twitter for future health campaigns are discussed. PMID:27115179

  3. [Ethics and efficacy in sexual health campaigns].

    Science.gov (United States)

    Rascón, José Jara; Sandoica, Esmeralda Alonso

    2008-01-01

    The effectiveness of the diverse campaigns of sexual education carried out in Spain in the last 15 years scarcely has been analyzed. These campaigns have been directed fundamentally to adolescent people and its declared purpose has consisted of promoting the called "safe sex" being based only in the information on methods of barrier. Trying to clarify the efficacy of these campaigns, in the present work the epidemiological data contributed by the Department of Health and the National Institute of the Spanish Youth have been retrospectively investigated. As far as it can be measured, the evolution of the consequences of the sexual practices of the adolescents (abortions and unintended pregnancies) in the sanitary environment were also analyzed. Likewise, the data of the National Registry of Epidemiological Surveillance on the evolution of sexually transmitted diseases are collected. The results obtained of this analysis show that in teenages between 15 and 19 years, a progressive increase in the percentage of abortions regarding the total number of pregnancies has grown from 20% in 1990 to 44% in 2000 arriving at 46.6% in 2003. These data correspond with an progressive increase also related to the total number of abortions in Spain, reaching 13.7% in 2005. Likewise, the consumption of the postcoital pills for adolescents is analyzed. It has passed from 160.000 prescriptions in 2001 to nearly half a million units in 2005. This means the demand of this resource in the last 5 years has multiplied by three without achieving a stabilization in the number of new abortions per year. The evolution of the declared sexually transmitted diseases shows an increase of 79% in the infections by syphilis and a 45.8% in uncomplicated gonorrhoea. As conclusions, since an ethical perspective and since the perspective of sanitary efficiency, it can be affirmed that the validity of the campaigns of "safe sex" remains in doubt after analyzing the available data. The refusal to include in

  4. Post-coring entrapment of modern air in polar ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and shallow ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-01-01

    Full Text Available In this study, we report the first measurements of CFC-12 (CCl2F2 in air extracted from shallow ice cores along with firn air CFC-12 measurements from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for presence of modern air entrapped in shallow ice core samples. We propose that this is due to closure of open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our measurements reveal the presence of open porosity below the depth at which firn air samples can be collected and demonstrate how the composition of bubble air in shallow ice cores can be altered during the post-drilling period through purely physical processes. These results have implications for investigations involving trace gas composition of bubbles in shallow ice cores.

  5. Organ Donation Campaigns: Perspective of Dialysis Patient's Family Members.

    Directory of Open Access Journals (Sweden)

    Makmor Tumin

    2014-07-01

    Full Text Available Solving the dilemma of the organ shortage in Malaysia requires educating Malaysians about organ donation and transplantation. This paper aims at exploring the average Malaysian households ' preferred channels of campaigns and the preferred campaigners in a family setting, targeting at the dialysis family members.We analyzed the responses of 350 respondents regarding organ donation campaigns. The respondents are 2 family members of 175 dialysis patients from 3 different institutions. The information on respondents' willingness to donate and preferred method and channel of organ donation campaign were collected through questionnaire.Malaysian families have a good tendency to welcome campaigns in both the public and private (their homes spheres. We also found that campaigns facilitated by the electronic media (Television and Radio and executed by experienced doctors are expected to optimize the outcomes of organ donation, in general. Chi-square tests show that there are no significant differences in welcoming campaigns among ethnics. However, ethnics preferences over the campaign methods and campaigners are significantly different (P <0.05.Ethnic differences imply that necessary modifications on the campaign channels and campaigners should also be taken under consideration. By identifying the preferred channel and campaigners, this study hopes to shed some light on the ways to overcome the problem of organ shortage in Malaysia.

  6. 29 CFR 452.69 - Expenses of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Expenses of campaign literature. 452.69 Section 452.69... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.69 Expenses of campaign literature. Each... is no requirement that the union distribute the literature of the candidate free of charge. In...

  7. Marketing Social Service Programs Using Political Campaign Technology.

    Science.gov (United States)

    Bynum, Peter

    1991-01-01

    Discusses how human services agencies can use strategies and information technologies similar to those used in political campaigns to identify needs and attitudes for social services campaigns. Marketing for social services programs is described, and the use of computers for a political campaign and for a teenage pregnancy program is compared.…

  8. Are "drink responsibly" alcohol campaigns strategically ambiguous?

    Science.gov (United States)

    Smith, Sandi W; Atkin, Charles K; Roznowski, JoAnn

    2006-01-01

    This article applies the concept of strategic ambiguity in examining viewer responses to brewer-sponsored "responsible drinking" television advertising campaigns. Strategically ambiguous messages are designed to engender diverse interpretations between varied audience segments, and these different selective perceptions should translate into relatively uniform positive corporate images. In this study, teenage and young adult respondents were shown a series of television spots from two leading alcohol companies. As predicted, there was a high degree of diversity in meanings of message content and campaign purpose derived by viewers, particularly among less sophisticated teenagers. Moreover, evaluative ratings of messages and sponsors were generally favorable and more uniform than interpretive responses. The research demonstrates how seemingly prohealth messages can serve to subtly advance both industry sales and public relations interests. PMID:16813484

  9. Results of a workplace health campaign

    DEFF Research Database (Denmark)

    Leyk, Dieter; Rohde, Ulrich; Hartmann, Nadine D;

    2014-01-01

    BACKGROUND: Effective health promotion in the workplace is now essential because of the rising health-related costs for businesses, the increasing pressure arising from international competition, prolonged working lives, and the aging of the work force. The basic problem of prevention campaigns is...... and sustained personnel participation. This finding suggests that the currently available prevention instruments are insufficient for the effective and cost-efficient promotion of health and fitness in the workplace....... that the target groups are too rarely reached and sustainable benefits too rarely achieved. In 2011, we carried out a broad-based health and fitness campaign to assess how many personnel could be motivated to participate in a model study under nearly ideal conditions. METHOD: 1010 personnel were given...

  10. Marketing campaigns and politics – British experience

    OpenAIRE

    Halida Sarajlić

    2007-01-01

    By gaining political power, individuals and political par¬ties at the same time gain the power to shape not only political but also public life. An accelerated growth of mass media communication has led to the development of various means and techniques of political marketing. This in turn requires certain adjustments to political campaigns and programs, out of which only those adapted to the new communication environment may succeed. Marketing in terms of politics and especially negative com...

  11. The Z CamPaign: Year Five

    CERN Document Server

    Simonsen, Mike

    2014-01-01

    Entering into the fifth year of the Z CamPaign, the author has developed a website summarizing our findings which will also act as a living catalog of bona fide Z Cam stars, suspected Z Cams and Z Cam impostors. In this paper we summarize the findings of the first four years of research, introduce the website and its contents to the public and discuss the way forward into year five and beyond.

  12. Ignition tuning for the National Ignition Campaign

    OpenAIRE

    Landen O.; Edwards J; Haan S. W.; Lindl J.D.; Boehly T.R.; Bradley D.K.; Callahan D.A.; Celliers P.M.; Dewald E.L.; Dixit S.; Doeppner T.; Eggert J.; Farley D.; Frenje J.A.; Glenn S.

    2013-01-01

    The overall goal of the indirect-drive inertial confinement fusion [1] tuning campaigns [2] is to maximize the probability of ignition by experimentally correcting for likely residual uncertainties in the implosion and hohlraum physics [3] used in our radiation-hydrodynamic computational models, and by checking for and resolving unexpected shot-to-shot variability in performance [4]. This has been started successfully using a variety of surrogate capsules that set key laser, hohlraum and caps...

  13. The FORMAT campaign in summer 2002

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez, C.; Steinbacher, M.; Dommen, J.; Prevot, A.S.H.

    2003-03-01

    Within the framework of the EC project FORMAT (Formaldehyde as a Tracer of Photooxidation in the Troposphere) the Laboratory of Atmospheric Chemistry participated in a field campaign in the Milan area dur-ing summer 2002. Ground and airborne based measurements of formaldehyde and other trace gases were performed in order to enhance the knowledge of the tropospheric distribution of formaldehyde and its influence in photochemical processes. (author)

  14. Strategies for reward-based crowdfunding campaigns

    OpenAIRE

    Kraus, Sascha; Richter, Christian; Brem, Alexander; Chang, M.-L.; Cheng, C. -F.

    2016-01-01

    Crowdfunding represents an alternative way of funding entrepreneurial ventures – and is attracting a high amount of interest in research as well as practice. Against this back- ground, this paper analyzes reward-based crowdfunding campaign strategies and their communication tools. To do this, 446 crowdfunding projects were gathered and empirically analyzed. Three different paths of successful crowdfunding projects could be identified and are described in detail. Practical implications of crow...

  15. Cost Effective Campaigning in Social Networks

    OpenAIRE

    Kotnis, Bhushan; Kuri, Joy

    2016-01-01

    Campaigners are increasingly using online social networking platforms for promoting products, ideas and information. A popular method of promoting a product or even an idea is incentivizing individuals to evangelize the idea vigorously by providing them with referral rewards in the form of discounts, cash backs, or social recognition. Due to budget constraints on scarce resources such as money and manpower, it may not be possible to provide incentives for the entire population, and hence ince...

  16. The Demeter micro satellite launch campaign

    Science.gov (United States)

    Dubourg, V.; Kainov, V.; Thoby, M.; Silkin, O.; Solovey, V.

    The CNES Micro satellite DEMETER is planned for launch by the end of June 2004 on a DNEPR launcher, from the Baíkonur cosmodrome. DEMETER will be the main payload among nine co-passengers. DEMETER, initiated by CNES in 1998, is the first model of the MYRIADE micro satellites line of product; at the time when this abstract is issued, the satellite is going through the final integration tests, as well as the last system validation phase. The space head module of the launcher has been developed by the Ukrainian YSDO company, and a successful fit check test campaign has been performed in December 2003 and January 2004 that allowed confirming the compatibility of the payloads with their launcher interface. The launch campaign is in process of preparation, implying a close partnership between the satellite team at CNES and Russian and Ukrainian launcher authorities: DEMETER is a pioneer not only for the satellite concept itself, but also for being the first satellite of this range (3 axis stabilized, including an hydrazine propulsion system and developed by a national space agency) being launched on a Russian space adapted intercontinental ballistic missile SS18. The launch service is contracted and managed by ISC Kosmotras, and it will also be the first sun synchronous orbit launch for DNEPR. Thus the launch preparation proved to be a very challenging endeavour providing all the actors with very rich human experience, as well as technical exchanges, in the fields of launcher technology and interfaces, facilities adaptation, logistics and project coordination. In the coming paper, a short presentation of the DEMETER satellite and of the DNEPR launcher will be made, but the main purpose is to present: the launch campaign preparation milestones, the launch campaign itself and related preliminary results and the lessons learnt from this first CNES/DNEPR experience to open the way to the future MYRIADE launches. A common CNES/KOSMOTRAS presentation is proposed at the

  17. Using Theory to Design Evaluations of Communication Campaigns: The Case of the National Youth Anti-Drug Media Campaign

    OpenAIRE

    Hornik, Robert C; Yanovitzky, Itzhak

    2003-01-01

    We present a general theory about how campaigns can have effects and suggest that the evaluation of communication campaigns must be driven by a theory of effects. The National Youth Anti-Drug Media Campaign illustrates both the theory of campaign effects and implications that theory has for the evaluation design. Often models of effect assume that individual exposure affects cognitions that continue to affect behavior over a short term. Contrarily, effects may operate through social or instit...

  18. Broadening Participation in Citizen Science Campaigns

    Science.gov (United States)

    Pandya, R. E.

    2011-12-01

    While successful citizen-science campaigns have demonstrable effectiveness in engaging their participants in scientific projects, and research suggests that participants learn about both scientific processes and content, many campaigns struggle to engage participants from communities that have been historically under-represented in science. This is both puzzling and unfortunate: puzzling because citizen-scientist programs are often built around phenomena that are part of many people's daily lives and unfortunate because these programs offer a new and effective approach to scientific outreach and education that could, potentially, offer new avenues to include historically underserved communities in science. This poster will explore the demographics of several well-known citizen science programs, compare them to national trends, and use this comparison to suggest goals for diversifying citizen-science participation. It will review research on minority participation in formal and informal geoscience and science education programs to identify barriers to broader participation and offer some strategies for diversifying citizen science programs. It will highlight participatory research methodologies as used in resource conservation and public health, and explore their relevance to citizen science program. The overall goal of the poster is not to suggest a singular answer or even promote best practices, since much of what works well is likely to be place-based and context dependence. Instead, we seek to raise questions, offer approaches and spark a dialogue among citizen-science practitioners that will encourage new approaches and ultimately result in broader engagement in citizen-science campaigns.

  19. Lessons Learned in a Breastfeeding Media Campaign.

    Science.gov (United States)

    Ware, Julie L; Mzayek, Fawaz; Levy, Marian

    2016-09-01

    Breastfeeding is well accepted as the optimal nutrition for babies. The American Academy of Pediatrics states that infant feeding should no longer be thought of as a lifestyle choice, but rather as a public health issue. In Shelby County, Tennessee, rates of breastfeeding continue to be disparately low. To address this public health problem, a focus group study was conducted with the Shelby County population least likely to breastfeed. Following participants' suggestion to use a billboard campaign with pictures of local mothers and families, one highway billboard and ten bus stop signs were placed around the city in areas of the lowest breastfeeding rates. Self-administered surveys were completed by convenience sampling in target population areas with women least likely to breastfeed, both before placing the signs and 6 months later. No significant differences were noted in knowledge, attitudes, or practices after the media campaign, but trends toward increased intention to breastfeed were noted among expectant mothers. With collapsed data (pre and post), a majority of participants believed that breastfeeding is the best way to feed a baby and they were significantly more likely to plan to breastfeed if they knew about health benefits to the baby and to themselves. If they had heard about breastfeeding on the TV or radio, they were more likely to believe breastfeeding is important for long-term health. These findings suggest that a media campaign could have a complementary role in promoting breastfeeding among women with low initiation rates. PMID:27463248

  20. Feasibility study of the AOSTA experimental campaign

    Directory of Open Access Journals (Sweden)

    Carta M.

    2016-01-01

    Full Text Available The reduction of the nuclear waste is one of the most important nuclear issues. The high radiotoxicity of the spent fuel is due to plutonium and some minor actinides (MAs such as neptunium, americium and curium, above all. One way to reduce their hazard is to destroy by fission MAs in appropriate nuclear reactors. To allow the MAs destruction an important effort have been done on the nuclear data due to the poor knowledge in this field. In the framework of one of the NEA Expert Group on Integral Experiments for Minor Actinide Management an analysis of the feasibility of MAs irradiation campaign in the TAPIRO fast research reactor is carried out. This paper provides preliminary results obtained by calculations modelling the irradiation, in different TAPIRO irradiation channels, of some CEA samples coming from the French experimental campaign OSMOSE, loaded with different contents of MAs, in order to access, through particular peak spectrometry, to their capture cross section. On the basis of neutron transport calculation results, obtained by both deterministic and Monte Carlo methods, an estimate of the irradiated samples counting levels from the AOSTA (Activation of OSMOSE Samples in TAPIRO experimental campaign is provided.

  1. Feasibility study of the AOSTA experimental campaign

    Science.gov (United States)

    Carta, M.; Blaise, P.; Bethaz, C.; Boccia, F.; Fabrizio, V.; Geslot, B.; Grossi, A.; Gruel, A.

    2016-03-01

    The reduction of the nuclear waste is one of the most important nuclear issues. The high radiotoxicity of the spent fuel is due to plutonium and some minor actinides (MAs) such as neptunium, americium and curium, above all. One way to reduce their hazard is to destroy by fission MAs in appropriate nuclear reactors. To allow the MAs destruction an important effort have been done on the nuclear data due to the poor knowledge in this field. In the framework of one of the NEA Expert Group on Integral Experiments for Minor Actinide Management an analysis of the feasibility of MAs irradiation campaign in the TAPIRO fast research reactor is carried out. This paper provides preliminary results obtained by calculations modelling the irradiation, in different TAPIRO irradiation channels, of some CEA samples coming from the French experimental campaign OSMOSE, loaded with different contents of MAs, in order to access, through particular peak spectrometry, to their capture cross section. On the basis of neutron transport calculation results, obtained by both deterministic and Monte Carlo methods, an estimate of the irradiated samples counting levels from the AOSTA (Activation of OSMOSE Samples in TAPIRO) experimental campaign is provided.

  2. Coordinated Science Campaign Scheduling for Sensor Webs

    Science.gov (United States)

    Edgington, Will; Morris, Robert; Dungan, Jennifer; Williams, Jenny; Carlson, Jean; Fleming, Damian; Wood, Terri; Yorke-Smith, Neil

    2005-01-01

    Future Earth observing missions will study different aspects and interacting pieces of the Earth's eco-system. Scientists are designing increasingly complex, interdisciplinary campaigns to exploit the diverse capabilities of multiple Earth sensing assets. In addition, spacecraft platforms are being configured into clusters, trains, or other distributed organizations in order to improve either the quality or the coverage of observations. These simultaneous advances in the design of science campaigns and in the missions that will provide the sensing resources to support them offer new challenges in the coordination of data and operations that are not addressed by current practice. For example, the scheduling of scientific observations for satellites in low Earth orbit is currently conducted independently by each mission operations center. An absence of an information infrastructure to enable the scheduling of coordinated observations involving multiple sensors makes it difficult to execute campaigns involving multiple assets. This paper proposes a software architecture and describes a prototype system called DESOPS (Distributed Earth Science Observation Planning and Scheduling) that will address this deficiency.

  3. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Quarterly MCLR program technical progress report, January 1, 1995--March 31, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.

    1995-04-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  4. Do vegetarian marketing campaigns promote a vegan diet?

    OpenAIRE

    James, Waters

    2015-01-01

    This paper examines whether vegetarian marketing campaigns promote a vegan diet. Our trivariate model of omnivorous, vegetarian, and vegan consumption is estimated using twenty years of UK data. For short-lived campaigns, we find no persistent effect, but observe a rise and fall in vegan numbers during adjustment. For long-running campaigns, we find that for every person who adopts a vegetarian diet in such a campaign, around 0.34 people adopt a vegan diet. In a campaign to market veganism, f...

  5. Do vegetarian marketing campaigns promote a vegan diet?

    OpenAIRE

    James, Waters

    2015-01-01

    This paper examines whether vegetarian marketing campaigns promote a vegan diet. Our trivariate model of omnivorous, vegetarian, and vegan consumption is estimated using twenty years of UK data. For short-lived campaigns, we find no persistent effect, but observe a rise and fall in vegan numbers during adjustment. For long-running campaigns, we find that for every person who adopts a vegetarian diet in such a campaign, around 0.34 people adopt a vegan diet. In a campaign to market veganis...

  6. Evaluation of the Erosion on the CFC tiles of the ITER Divertor by means o f FE calculations

    International Nuclear Information System (INIS)

    Full text of publication follows: The vertical target of the ITER divertor is armoured with Carbon Fibre Composite (CFC) mono-blocks in the lower part. This part is subjected to the maximum power and particles loads and, consequently, has a risk of high erosion and a significant risk of failure. In order to calculate the erosion during operation an original methodology has been developed using the CASTEM CEA finite element code. The calculation is based on a series of steady states the mesh being updated at each step of the iteration taking into account the rate of erosion between two steps. The model was developed thanks to the routines developed 10 years ago for the toroidal pump limiter of Tore Supra and takes into account shadowing effect and possible penetration of power into the gap between two mono-blocks. Both physical and chemical sputtering together with sublimation have been included in the code to describe the loss of material by the thermal and particle loads envisaged for ITER normal operation regime. This model has been validated by comparison with analytical or other code results. As erosion instability in normal operation in case of one faulty mono-block besides good ones due to the balanced rate between the various erosion mechanisms at different temperatures can be expected, coherent plasma parameters, which represent the worse cases of erosion in normal operation, have been taken into account to analyse the erosion behaviour of the mono-blocks. The aim of the study was also to evaluate the influence of a mono-block defect on erosion behaviour and the impact of these phenomena on the mono-block acceptance criteria. The calculations have pointed out the occurrence of some erosion instabilities for the studied cases (neighbour mono-block with reduced conductivity or with 90 deg. defects). Moreover it was shown that, when applying 20 MW/m2 to the erosion model already subjected to the normal condition loads for 10,000 s, the plasma shaping of the

  7. The POWER campaign for promotion of female and male condoms: audience research and campaign development.

    Science.gov (United States)

    Bull, Sheana Salyers; Cohen, Jennifer; Ortiz, Charlene; Evans, Tom

    2002-01-01

    In this study, we conducted and content analyzed 12 focus groups with women aged 15-25 living in inner city Denver as a process of audience research to develop a male and female condom promotion campaign. We recruited 89 women from school and community sites in central Denver neighborhoods to discuss their knowledge, attitudes, and practices regarding both male and female condoms, then solicited opinions about how to increase knowledge about and familiarity with female condoms, increase positive attitudes toward both male and female condoms, and how to increase access to and use of both male and female condoms. Opinions on these topics drove the development of a targeted media campaign promoting condom use in this population. We report here on the general findings from focus groups and provide details about the campaign the participants helped to develop. PMID:12375772

  8. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  9. Marketing campaigns and politics – british experience

    Directory of Open Access Journals (Sweden)

    Halida Sarajlić

    2007-12-01

    Full Text Available By gaining political power, individuals and political par¬ties at the same time gain the power to shape not only political but also public life. An accelerated growth of mass media communication has led to the development of various means and techniques of political marketing. This in turn requires certain adjustments to political campaigns and programs, out of which only those adapted to the new communication environment may succeed. Marketing in terms of politics and especially negative comparative advertising, which is becoming increasingly more present and intense in political campaigning, opens a series of ethical questions. Among others, these include whether such advertising in politics is effective, to what extent and what its consequences are. The goal of this paper is to present the main characteristics of political marketing, the effectiveness of the methods and techniques used in the course of elect¬ion campaigning, their consequences and basic differences between political marketing and products and services marketing. A special emphasis will be placed on the presentation of political marketing of Great Britain, which has a long tradition in utilizing marketing methods and techniques in the political arena. Moreover, political moves made by politicians and political parties in Great Britain certainly make a good starting point for shaping an optimal political strategy in other countries, while at the same time taking into account the particulars of a specific political and social environment. Content analysis methodology was used in the preparation of this paper and all the data were gathered from secondary sources.

  10. Forecasting for a Lagrangian aircraft campaign

    Directory of Open Access Journals (Sweden)

    A. Stohl

    2004-01-01

    Full Text Available A forecast system has been developed in preparation for an upcoming aircraft measurement campaign, where the same air parcels polluted by emissions over North America shall be sampled repeatedly as they leave the continent, during transport over the Atlantic, and upon their arrival over Europe. This paper describes the model system in advance of the campaign, in order to make the flight planners familiar with the novel model output. The aim of a Lagrangian strategy is to infer changes in the chemical composition and aerosol distribution occurring en route by measured upwind/downwind differences. However, guiding aircraft repeatedly into the same polluted air parcels requires careful forecasting, for which no suitable model system exists to date. This paper describes a procedure using both Eulerian-type (i.e. concentration fields and Lagrangian-type (i.e. trajectories model output from the Lagrangian particle dispersion model FLEXPART to predict the best opportunities for a Lagrangian experiment. The best opportunities are defined as being highly polluted air parcels which receive little or no emission input after the first measurement, which experience relatively little mixing, and which are reachable by as many aircraft as possible. For validation the system was applied to the period of the NARE 97 campaign where approximately the same air masses were sampled on different flights. Measured upwind/downwind differences in carbon monoxide (CO and ozone (O3 decreased significantly as the threshold values used for accepting cases as Lagrangian were tightened. This proves that the model system can successfully identify Lagrangian opportunities.

  11. Advanced Fuels Campaign Cladding & Coatings Meeting Summary

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2013-03-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) organized a Cladding and Coatings operational meeting February 12-13, 2013, at Oak Ridge National Laboratory (ORNL). Representatives from the U.S. Department of Energy (DOE), national laboratories, industry, and universities attended the two-day meeting. The purpose of the meeting was to discuss advanced cladding and cladding coating research and development (R&D); review experimental testing capabilities for assessing accident tolerant fuels; and review industry/university plans and experience in light water reactor (LWR) cladding and coating R&D.

  12. Ignition tuning for the National Ignition Campaign

    Directory of Open Access Journals (Sweden)

    Landen O.

    2013-11-01

    Full Text Available The overall goal of the indirect-drive inertial confinement fusion [1] tuning campaigns [2] is to maximize the probability of ignition by experimentally correcting for likely residual uncertainties in the implosion and hohlraum physics [3] used in our radiation-hydrodynamic computational models, and by checking for and resolving unexpected shot-to-shot variability in performance [4]. This has been started successfully using a variety of surrogate capsules that set key laser, hohlraum and capsule parameters to maximize ignition capsule implosion velocity, while minimizing fuel adiabat, core shape asymmetry and ablator-fuel mix.

  13. Results of the Venus Express Aerobraking Campaign

    Science.gov (United States)

    Svedhem, Hakan; Müller-Wodarg, Ingo

    2014-11-01

    After a very successful mission orbiting Venus for more than 8 years, slowly the fuel is running out and the spacecraft will inevitably one day end up in the hot and acid atmosphere of the planet. Being near the end of the mission and in a position to accept some risk to the spacecraft we decided to take the opportunity to dip down deep into the atmosphere, to around 130 km, in a controlled manner, in order to make detailed in situ investigations of this for remote sensing instruments difficult to access region. The on board accelerometers gave direct measurements of the deceleration which in turn is directly proportional to the local atmospheric density. This provided an excellent way to study both the total density profile throughout the orbital arc in the atmosphere and small scale density variations in the region of the pericentre. The spacecraft behaved perfectly well throughout the whole campaign and provided a wealth of data both on the atmosphere and on the response of the spacecraft to the harsh environment with strong heat loads and some dynamic stress. At the time of the campaign the pericentre was located near the terminator at about 75 degrees Northern latitude. Aerobraking is a very efficient method of reducing the pericentre velocity and thereby reducing the apocentre altitude and the orbital period.The so called "walk-in" phase started at an altitude of 190 km on 17 May and the campaign ended on 11 July, after having reached a lowest altitude of 129.2 km. Subsequently, a series of orbit control manoeuvres lifted up the pericentre to 460 km altitude and the science activities were resumed after a thorough check-out of the spacecraft. We have detected a highly variable atmosphere, both on a day to day basis and within the individual pericentre passes. The duration of each pass was approximately 100 s and the maximum dynamic pressure achieved was more than 0.75 N/m2, probably a record for a spacecraft that continued its operation afterwards. The

  14. Advanced Fuels Campaign FY 2015 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Braase, Lori Ann [Idaho National Lab. (INL), Idaho Falls, ID (United States); Carmack, William Jonathan [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-10-29

    The mission of the Advanced Fuels Campaign (AFC) is to perform research, development, and demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This report is a compilation of technical accomplishment summaries for FY-15. Emphasis is on advanced accident-tolerant LWR fuel systems, advanced transmutation fuels technologies, and capability development.

  15. Scald prevention campaigns: do they work?

    Science.gov (United States)

    Spallek, Melanie; Nixon, Jim; Bain, Chris; Purdie, David M; Spinks, Anneliese; Scott, Debbie; McClure, Rod J

    2007-01-01

    The aim of this study was to quantify the effectiveness of the Queensland "Hot Water Burns Like Fire" campaign. Cross-section temperature sampling of households' bathroom hot water taps was conducted in Brisbane in 1990 before the intervention (n = 872) and in 2002 to 2003 after the intervention (n = 871). In both surveys, temperature was measured with thermometers held under running water from the bathroom hot tap until the reading stabilized (2 minutes). In 2002 to 2003 the interviewer also recorded whether or not the householder believed a tempering valve was installed in the home. The main injury outcome measure was all scald injury-related admissions at hospitals in Queensland from July 1990 to June 2003. The difference between the mean hot water tap temperature in 1990 and in 2002 to 2003 was determined with independent sample t-tests (P < .05). Rates of hospital admissions were grouped into two categories: scald injuries per year prior to the introduction of the hot water tempering valve legislation (April 1998) and scald injuries per year post-legislation. The difference between the preintervention and postintervention mean rates was determined with t-tests (P < .05). Additionally, the rates were plotted on a scatter plot by year, and a linear regression analysis was used to quantify the relationship with rates of scald-related injuries and year. The temperature in homes where the occupants reported having a tempering valve (mean = 55.5 degrees C) was significantly lower than in homes whose occupants reported not having a tempering valve (mean = 60.1 degrees C) or did not know whether they had a tempering valve (mean = 61.8 degrees C) (P < .01). However, the comparison of the hot water temperature between 1990 and 2002 to 2003 showed a significantly higher mean hot water temperature in 2002 to 2003 (P < .01). There was a significantly higher mean scald injury rate after the introduction of the "Hot Water Burns Like Fire" campaign (170.36/100,000) than

  16. Talking About Antismoking Campaigns: What Do Smokers Talk About, and How Does Talk Influence Campaign Effectiveness?

    Science.gov (United States)

    Brennan, Emily; Durkin, Sarah J; Wakefield, Melanie A; Kashima, Yoshihisa

    2016-01-01

    Campaign-stimulated conversations have been shown to increase the effectiveness of antismoking campaigns. In order to explore why such effects occur, in the current study we coded the content of naturally occurring conversations. We also examined whether the short-term effects of talking, and of different types of talk, on quitting intentions were mediated through intrapersonal message responses. Using the Natural Exposure(SM) methodology, we exposed 411 smokers to 1 of 6 antismoking advertisements while they were watching television at home. Responses to the advertisement-conversation participation and content, emotional responses, personalized perceived effectiveness, and changes in intentions to quit-were measured within 3 days of exposure. Conversations were coded for appraisal of the advertisement (favorable, neutral, or unfavorable) and the presence of quitting talk and emotion talk. Mediation analyses indicated that the positive effects of talking on intention change were mediated through personalized perceived effectiveness and that the positive effects were driven by conversations that contained a favorable appraisal and/or quitting talk. Conversely, conversations that contained an unfavorable appraisal of the advertisement were negatively associated with campaign effectiveness. These findings highlight the importance of measuring interpersonal communication when evaluating campaigns and the need for further research to identify the message characteristics that predict when smokers talk and when they talk only in desirable ways. PMID:26376358

  17. Public health campaigns and obesity - a critique

    Directory of Open Access Journals (Sweden)

    Proietto Joseph

    2011-02-01

    Full Text Available Abstract Background Controlling obesity has become one of the highest priorities for public health practitioners in developed countries. In the absence of safe, effective and widely accessible high-risk approaches (e.g. drugs and surgery attention has focussed on community-based approaches and social marketing campaigns as the most appropriate form of intervention. However there is limited evidence in support of substantial effectiveness of such interventions. Discussion To date there is little evidence that community-based interventions and social marketing campaigns specifically targeting obesity provide substantial or lasting benefit. Concerns have been raised about potential negative effects created by a focus of these interventions on body shape and size, and of the associated media targeting of obesity. Summary A more appropriate strategy would be to enact high-level policy and legislative changes to alter the obesogenic environments in which we live by providing incentives for healthy eating and increased levels of physical activity. Research is also needed to improve treatments available for individuals already obese.

  18. Mass measles rubella immunization campaign: Bhutan experience

    Directory of Open Access Journals (Sweden)

    Bhakta R Giri

    2011-01-01

    Full Text Available Background: Bhutan has attained universal child immunization since 1991. Since then, immunization coverage is maintained at high level through routine immunization, periodic National Immunization Days, and mop up campaigns. Despite high immunization coverage, every year, significant numbers of clinically suspected measles cases were reported. Objective: To assess the cause of continuing high "suspected measles cases" and take appropriate public health measures. Materials and Methods: Febrile rash outbreaks occurred in several districts in 2003. These episodes were investigated. Simultaneously, a retrospective data search revealed evidence of congenital rubella syndrome (CRS in the country. Results: Thirty five percent of the tested samples were positive for rubella but none for measles. There were evidences of the presence of CRS. This was discussed in the annual health conference 2004, amongst health policy makers and district heads who recommended that a possibility of inclusion of rubella as an antigen be looked into. A nationwide measles and rubella immunization campaign was conducted in 2006 followed by introduction of rubella vaccine in the immunization schedule. Conclusion: Febrile rash can be caused by a host of viral infections. Following universal measles immunization, it is pertinent that febrile rash be looked in the light of rubella infections. Following the introduction of rubella vaccination in the national immunization schedule, there has been significant reduction of febrile rash episodes, cases of rubella, and congenital rubella syndrome.

  19. Post-campaign information from the Infirmary

    CERN Multimedia

    2015-01-01

    The Medical Service’s “TAKE YOUR BLOOD PRESSURE TO HEART” campaign, which ran from 24 to 27 March 2015 (see here), was a resounding success.   In total, 274 people visited the nurses at their pop-up clinics (in Building 40, Restaurants 2 and 3 and the Main Building) or at the Infirmary (Building 57). Each of them had their blood pressure measured and received information and advice about high blood pressure, its contributory factors and ways to control it. They were also offered various leaflets about this public health issue. We would like to draw attention to the fact that 21% of the participants were found to have abnormally high blood-pressure and, crucially, 72% of these had been unaware of the problem. Another point to note is that a significant proportion (16%) of the younger people tested (aged 18 to 30) had abnormal results. The results of this campaign demonstrate the importance of early screening, but also the high level of interest among the pers...

  20. K2 Microlensing and Campaign 9

    Science.gov (United States)

    Penny, Matthew

    2016-06-01

    Campaign 9 of K2 will observe a contiguous 3.7 deg^2 region of the Galactic bulge in order to search for microlensing events and measure microlens parallaxes. It will also perform targeted follow-up of approximately 50 microlensing events spread throughout the Kepler focal plane. Parallax measurements are a critical ingredient for measurements of both the lens mass and distance, which contribute to our understanding of the formation of cold exoplanets, and the formation of planets as a function of Galactic environment. Additionally, as the first un-targeted, space-based microlensing survey, K2C9 offers us the first chance to measure the masses and kinematics of a large population of free-floating planet candidates, whose large abundance has been a puzzle since their discovery.I will review the scientific goals of the K2C9 survey, which will be well underway, and report on the ongoing activity of the K2 Campaign 9 Microlensing Science Team and the wider microlensing community, with a focus on the progress that has been made towards analyzing K2 data in crowded fields.

  1. Transmutation Fuel Campaign Description and Status

    International Nuclear Information System (INIS)

    This report contains a technical summary package in response to a Level 2 milestone in the transmutation fuel campaign (TFC) management work-package calling for input to the Secretarial decision. At present, the form of the Secretarial decision package is not fully defined, and it is not clear exactly what will be required from the TFC as a final input. However, it is anticipated that a series of technical and programmatic documents will need to be provided in support of a wider encompassing document on GNEP technology development activities. The TFC technical leadership team provides this report as initial input to the secretarial decision package which is being developed by the Technical Integration Office (TIO) in support of Secretarial decision. This report contains a summary of the TFC execution plan with a work breakdown structure, high level schedule, major milestones, and summary description of critical activities in support of campaign objectives. Supporting documents referenced in this report but provided under separate cover include: (1) An updated review of the state-of-the art for transmutation fuel development activities considering national as well as international fuel research and development testing activities. (2) A definition of the Technology Readiness Level (TRL) used to systematically define and execute the transmutation fuel development activities

  2. Vietnam's campaign to reduce population growth.

    Science.gov (United States)

    Haub, C

    1999-10-01

    This paper reports campaigns to reduce the population growth in Vietnam. In July, red banners flew above the broad boulevard in Hanoi proclaiming World Population Day. This widespread public attention to population issues is not surprising, given the country's sharp reduction in fertility and widespread citizen support for smaller families. Since 1961, Vietnam has been trying to formulate a policy to reduce the population rate growth. The policy was a reaction to the results of the 1960 Census of the Democratic Republic of Vietnam and reflected long-standing concerns over food shortages, as well as a desire to improve women's health and welfare. After the reunification in 1975, the policy was extended to the entire country. Since then, Vietnam's growth rate has been declining, suggesting that the national campaign for smaller families is succeeding in changing deeply held attitudes and perceptions, in addition to current practices. While the fertility decline in Vietnam may not be the world's fastest, the success of the national population policy has forever altered the country's prospect for population growth. PMID:12295331

  3. The Gemini NICI Planet-Finding Campaign

    CERN Document Server

    Liu, Michael C; Biller, Beth A; Nielsen, Eric L; Chun, Mark; Close, Laird M; Ftaclas, Christ; Hartung, Markus; Hayward, Thomas L; Clarke, Fraser; Reid, I Neill; Shkolnik, Evgenya L; Tecza, Matthias; Thatte, Niranjan; Alencar, Silvia; Artymowicz, Pawel; Boss, Alan; Burrows, Adam; Pino, Elisabethe de Gouveia Dal; Gregorio-Hetem, Jane; Ida, Shigeru; Kuchner, Marc J; Lin, Douglas; Toomey, Douglas

    2010-01-01

    Our team is carrying out a multi-year observing program to directly image and characterize young extrasolar planets using the Near-Infrared Coronagraphic Imager (NICI) on the Gemini-South 8.1-meter telescope. NICI is the first instrument on a large telescope designed from the outset for high-contrast imaging, comprising a high-performance curvature adaptive optics system with a simultaneous dual-channel coronagraphic imager. Combined with state-of-the-art observing methods and data processing, NICI typically achieves ~2 magnitudes better contrast compared to previous ground-based or space-based programs, at separations inside of ~2 arcsec. In preparation for the Campaign, we carried out efforts to identify previously unrecognized young stars, to rigorously construct our observing strategy, and to optimize the combination of angular and spectral differential imaging. The Planet-Finding Campaign is in its second year, with first-epoch imaging of 174 stars already obtained out of a total sample of 300 stars. We ...

  4. The 'Your Rights at Work' Campaign: 2005-2007

    Directory of Open Access Journals (Sweden)

    Sally McManus

    2009-08-01

    Full Text Available In 2007 the Howard Government was swept aside in a landslide at a Federal Election. On that day, many hundreds of Your Rights At Work activists were on polling booths around the country - frequently outnumbering the major parties - in what was the key phase of the campaign. The previous years had seen the largest trade union campaign for industrial rights in decades. This paper looks at how that campaign was organised, and asserts that the victory of the campaign in defeating the Howard Government was not the result of a silver bullet strategy, but a mix of campaign components in a specific context. While certain strategies were new, in many ways the Your Rights At Work campaign was a back to basic initiative that had its success on the back of local organising across the nation.

  5. RIDT/Malta Neuroscience Network (MNN) Brain Campaign 2016

    OpenAIRE

    Kenely, Wilfred; Malta Neuroscience Network (MNN); University of Malta Research Trust (RIDT)

    2015-01-01

    The University of Malta Research Trust (RIDT), in collaboration with the Malta Neuroscience Network (MNN), has chosen The Brain as its main campaign for 2016. The campaign will have two parallel strands - one strand promoting brain awareness and the other a fund-raising campaign for research in brain disorders. The main objective of the fi rst strand is for the public to understand the brain and its functions and is intended to bring together scientists and the communi...

  6. Preparing for SMOS: Sea Salinity Campaigns and Results

    OpenAIRE

    Søbjærg, Sten Schmidl; Balling, Jan E.; Kristensen, Steen Savstrup; Skou, Niels

    2006-01-01

    Mapping of sea surface salinity, based on L-band radiometric measurements, is presently investigated as a preparation for space missions. Special concern is on correction for effects caused by the sea surface roughness, and this paper will address two campaigns, LOSAC and CoSMOS, with the aim of investigating these effects. Conclusions from LOSAC are presented, and open issues to be investigated during the presently ongoing CoSMOS campaign are outlined. Finally, the installation and campaign ...

  7. Do State Campaign Finance Reforms Reduce Public Corruption?

    OpenAIRE

    Jeffrey Milyo; Adriana Cordis

    2013-01-01

    The Supreme Court has long held that campaign finance regulations are permissible for the purpose of preventing corruption or the appearance of corruption. Yet the implied hypothesis that campaign finance reforms are effective tools for combating public corruption has gone essentially untested. We conduct the first systematic evaluation of the effects of campaign finance laws on actual corruption rates in the states. We examine the effects of state reforms on both convictions and filings in p...

  8. Ethics and the choice of animal advocacy campaigns

    OpenAIRE

    Waters, James

    2014-01-01

    This paper examines how different ethical positions view various types of animal advocacy campaigns concerning a product produced using animals. The ethical positions represent common company, social, and animal advocate viewpoints. Working in a market model with a monopolistic supplier, we determine whether the ethical positions support or oppose each campaign, and in what conditions. We describe three easily implemented campaign strategies that combine animal welfare and rights goals.

  9. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  10. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase) over the South Coast Air Basin of California

    Science.gov (United States)

    Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.

    2011-03-01

    This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  11. Lessons learned from the TMT site testing campaign

    OpenAIRE

    Travouillon, T.; Els, S. G.; Riddle, R. L.; M. Schöck; Skidmore, A. W.

    2011-01-01

    After a site testing campaign spanning 5 sites over a period of 5 years, the site selection for the Thirty Meter Telescope (TMT) culminated with the choice of Mauna Kea 13N in Hawaii. During the campaign, a lot practical lessons were learned by our team and these lessons can be shared with current and future site testing campaign done for other observatories. These lessons apply to the preselection of the site, the ground work and operations of the campaign as well as the analysis of the data...

  12. "Think the sink:" Preliminary evaluation of a handwashing promotion campaign.

    Science.gov (United States)

    Mackert, Michael; Liang, Ming-Ching; Champlin, Sara

    2013-03-01

    Owing to its utility in guiding the planning and evaluation of health promotion campaigns, the Theory of Planned Behavior was used to implement a 1-month campaign aimed at increasing handwashing among college students. Based on observations of bathroom users' handwashing behavior (n = 1,005) and an online survey (n = 188), overall handwashing did not increase as a result of the campaign; however, more students did use soap (58% vs 70%). Future campaigns designed to increase handwashing behavior in students may be advised to target messages according to gender difference-based responsiveness to handwashing norms. PMID:22990299

  13. Lessons learned from the TMT site testing campaign

    CERN Document Server

    Travouillon, T; Riddle, R L; Schöck, M; Skidmore, A W

    2011-01-01

    After a site testing campaign spanning 5 sites over a period of 5 years, the site selection for the Thirty Meter Telescope (TMT) culminated with the choice of Mauna Kea 13N in Hawaii. During the campaign, a lot practical lessons were learned by our team and these lessons can be shared with current and future site testing campaign done for other observatories. These lessons apply to the preselection of the site, the ground work and operations of the campaign as well as the analysis of the data. We present of selection of such lessons in this paper preceded by a short summary of the TMT site testing activities.

  14. Campaign effects and self-analysis Internet tool

    Energy Technology Data Exchange (ETDEWEB)

    Brange, Birgitte [Danish Electricity Saving Trust (Denmark); Fjordbak Larsen, Troels [IT Energy ApS (Denmark); Wilke, Goeran [Danish Electricity Saving Trust (Denmark)

    2007-07-01

    In October 2006, the Danish Electricity Saving Trust launched a large TV campaign targeting domestic electricity consumption. The campaign was based on the central message '1000 kWh/year per person is enough'. The campaign was accompanied by a new internet portal with updated information about numerous household appliances, and by analysis tools for bringing down electricity consumption to 1000 kWh/year per person. The effects of the campaign are monitored through repeated surveys and analysed in relation to usage of internet tools.

  15. The ESA Hubble 15th Anniversary Campaign

    Science.gov (United States)

    Christensen, L. L.; Kornmesser, M.

    2005-12-01

    The 15th anniversary of the launch of the NASA/ESA Hubble Space Telescope occurred on 24th April 2005. As Hubble is one of the most successful scientific projects in the world, ESA decided to celebrate this anniversary, among other things, with the production of a Hubble 15th Anniversary movie and a book, both called "Hubble, 15 years of discovery". The movie covers all aspects of the Hubble Space Telescope project - a journey through the history, the problems and the scientific successes of Hubble. With more than 700,000 multi-lingual DVDs distributed to the public, media, educators, decision-makers and scientists, the Hubble 15th anniversary campaign has been one of the largest such projects in Europe.

  16. Environmental Awareness Campaign: The Change It Brings

    Directory of Open Access Journals (Sweden)

    Merlita C. Medallon

    2014-02-01

    Full Text Available The study was conducted to determine the awareness and sensitivity of the younger generation in environmental issues such global warming, climate change and waste management. Data were gathered from selected students who attended the environmental awareness seminar held at Lyceum of the Philippines – Laguna in 2011. There were 54 students who participated in the survey. The respondents had participated in several activities related to environmental issues which include attendance to seminars, and participation in school and community projects. Most of the information about environmental issues was obtained by the students from their teachers. Global warming was the most common issue. There was a significant increase in the level of knowledge after the environmental awareness campaign was made. As a result, the highest level of action proposed by the students is on the proper disposal of wastes and the proper segregation of wastes.

  17. Strategies for reward-based crowdfunding campaigns

    DEFF Research Database (Denmark)

    Kraus, Sascha; Richter, Christian; Brem, Alexander;

    2016-01-01

    Crowdfunding represents an alternative way of funding entrepreneurial ventures – and is attracting a high amount of interest in research as well as practice. Against this back- ground, this paper analyzes reward-based crowdfunding campaign strategies and their communication tools. To do this, 446...... crowdfunding projects were gathered and empirically analyzed. Three different paths of successful crowdfunding projects could be identified and are described in detail. Practical implications of crowdfunding strategies are derived, and are dependent on the required sales effort and the project added value. The...... terms communicator, networker and self-runner are created for this crowdfunding strategy and filled with practi- cal examples. This paper contributes to the literature in different ways: first, it sheds more light on the developing concept of crowdfunding, with an overview of current academic dis...

  18. Advanced Fuels Campaign FY 2011 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2011-11-01

    One of the major research and development (R&D) areas under the Fuel Cycle Research and Development (FCRD) program is advanced fuels development. The Advanced Fuels Campaign (AFC) has the responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. Accomplishments made during fiscal year (FY 20) 2011 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section. The order of the accomplishments in this report is consistent with the AFC work breakdown structure (WBS).

  19. Manufactured Doubt: The Campaign Against Nuclear Energy

    Science.gov (United States)

    Rogers, N. L.

    2012-12-01

    Nuclear electricity is a CO2 free technology with a proven track record of large scale commercial deployment. For example, France generates 78% of its electrical power with nuclear plants. France has the lowest pre-tax cost of electricity in Europe at 4.75 eurocents per KWH and France is the world's largest exporter of electricity. There are large world reserves of uranium sufficient for hundreds of years, even without breeder technology. Additionally, thorium, another radioactive mineral is in even more plentiful supply. Although present-day nuclear technology has proven to be safe and reliable, waiting in the wings is new generation technology that promises great improvements in both safety and cost. Yet, there has been a calculated and sophisticated campaign in the later part of the 20th century to create doubt and fear concerning nuclear power. In the United States this campaign has essentially destroyed the nuclear industry. No new plants have been commissioned for decades. Leadership in the nuclear power field has been ceded to other countries. The great paradox is that the very organizations that express great alarm concerning CO2 emissions are the same organizations that led the campaign against nuclear power decades ago. Representatives of these organizations will say privately that they are taking a new look at nuclear power, but no major organization has reversed course and become a supporter of nuclear power. To do so would involve a loss of face and create doubts concerning the credibility of the organization. As recently as 2001 environmentalist lobbyists made great efforts to ensure that no credit could be given for nuclear power under the Kyoto accords and the associated clean development mechanism. They succeeded and nuclear power receives unfavorable treatment under the Kyoto accords even though it is a proven solution for reducing CO2 emissions. The technique used to destroy nuclear energy as a viable alternative in the United States had two

  20. Cost Effective Campaigning in Social Networks

    CERN Document Server

    Kotnis, Bhushan

    2016-01-01

    Campaigners are increasingly using online social networking platforms for promoting products, ideas and information. A popular method of promoting a product or even an idea is incentivizing individuals to evangelize the idea vigorously by providing them with referral rewards in the form of discounts, cash backs, or social recognition. Due to budget constraints on scarce resources such as money and manpower, it may not be possible to provide incentives for the entire population, and hence incentives need to be allocated judiciously to appropriate individuals for ensuring the highest possible outreach size. We aim to do the same by formulating and solving an optimization problem using percolation theory. In particular, we compute the set of individuals that are provided incentives for minimizing the expected cost while ensuring a given outreach size. We also solve the problem of computing the set of individuals to be incentivized for maximizing the outreach size for given cost budget. The optimization problem t...

  1. Campaigning for Organ Donation at Mosques.

    Science.gov (United States)

    Rady, Mohamed Y; Verheijde, Joseph L

    2016-09-01

    There is a trend of recruiting faith leaders at mosques to overcome religious barriers to organ donation, and to increase donor registration among Muslims. Commentators have suggested that Muslims are not given enough information about organ donation in religious sermons or lectures delivered at mosques. Corrective actions have been recommended, such as funding campaigns to promote organ donation, and increasing the availability of organ donation information at mosques. These actions are recommended despite published literature expressing safety concerns (i.e., do no harm) in living and end-of-life organ donation. Living donors require life-long medical follow-up and treatment for complications that can appear years later. Scientific and medical controversies persist regarding the international guidelines for death determination in end-of-life donation. The medical criteria of death lack validation and can harm donors if surgical procurement is performed without general anesthesia and before biological death. In the moral code of Islam, the prevention of harm holds precedence over beneficence. Moral precepts described in the Quran encourage Muslims to be beneficent, but also to seek knowledge prior to making practical decisions. However, the Quran also contains passages that demand honesty and truthfulness when providing information to those who are seeking knowledge. Currently, information is limited to that which encourages donor registration. Campaigning for organ donation to congregations in mosques should adhere to the moral code of complete, rather than selective, disclosure of information. We recommend as a minimal standard the disclosure of risks, uncertainties, and controversies associated with the organ donation process. PMID:26940813

  2. The impact of thermal fatigue and carbidization on the W coatings deposited on CFC tiles for the ITER-like Wall project at JET

    International Nuclear Information System (INIS)

    Highlights: ► Degradation curves of the W coatings depend on temperature and number of pulses. ► Thermo-mechanical properties of the W coatings are associated with degradation curves. ► Thermal fatigue and carbidization affect the interface between CFC and W. ► A pore structure was detected at the interface by SEM examination. -- Abstract: Since August 2011 JET operates with the ITER-like wall comprising bulk Be tiles, bulk W tiles and W coated CFC tiles with a thickness of 10–15 μm and 20–25 μm. In order to evaluate behavior of the W coatings to a cyclic thermal loading relevant to JET operation, high heat flux (HHF) tests have been carried out up to 5100 pulses with an electron beam facility at peak temperatures of 1000 °C, 1250 °C and 1450 °C. The pulse duration was 24 s. Optical inspections of the W layer performed periodically by interrupting the test revealed small delaminations with the size of 50–500 μm. The dependence of the delamination percentage on the number of pulses can be seen as a degradation curve for each particular W coating. In this way the thermo-mechanical properties of the W coatings can be characterized quantitatively. Thermal fatigue and carbidization of the tungsten due to the diffusion of the carbon from the substrate have been recognized as mechanisms for degradation of the coatings. Tungsten carbides have been identified by using TEM (transmission electron microscopy) diffraction analysis on FIB (focused ion beam) prepared cross-section samples subjected to HHF tests. Nano-pores developed at the CFC–Mo and Mo–W interfaces during the tests might be also responsible for the degradation of the coating

  3. Impact of a Rural Domestic Violence Prevention Campaign.

    Science.gov (United States)

    Gadomski, Anne M.; Tripp, Maria; Wolff, Debra A.; Lewis, Carol; Jenkins, Paul

    2001-01-01

    A 7-month public health information campaign used radio advertising, mass media articles, mailings, and posters to address attitudes and behavioral intentions toward domestic violence in a rural county. The campaign raised public awareness, particularly among men; increased stated intentions to intervene in a neighbor's domestic violence; and…

  4. The Functions of Political Advertising for Campaign Organizations.

    Science.gov (United States)

    Sheinkopf, Kenneth G.; And Others

    One previously untested benefit of political advertising before elections may be that it serves "internal" as well as "external" needs, i.e., it boosts the morale of the campaign staff and provides them with information to persuade voters. This proposition was tested during the 1970 Wisconsin gubernatorial campaign by means of a questionnaire…

  5. Ninth Processing Campaign in the Waste Calcining Facility

    International Nuclear Information System (INIS)

    This report discusses the Ninth (and final) Processing Campaign at the Waste Calcining Facility. Several processing interruptions were experienced during this campaign and the emphasis of this report is on process and equipment performance with operating problems and corrective actions discussed in detail

  6. An Empirical Assessment of the "Above the Influence" Advertising Campaign

    Science.gov (United States)

    Scheier, Lawrence M.; Grenard, Jerry L.; Holtz, Kristen D.

    2011-01-01

    This study evaluated the efficacy of "Above the Influence" (ATI), a national media-based health persuasion campaign to deter youth drug use. The campaign uses public service anti-drug prevention messages and targets youth between the ages of 14 and 16, a period of heightened susceptibility to peer influences. The evaluation utilized mall…

  7. Mediacampaign: A Multimodal Semantic Analysis System for Advertisement Campaign Detection

    NARCIS (Netherlands)

    Rehatschek, Herwig; Sorschag, Robert; Rettenbacher, Bernhard; Zeiner, Herwig; Nioche, Julien; Jong, de Franciska; Ordelman, Roeland; Leeuwen, van David A.

    2008-01-01

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project’s main goal is to automate to a large degree the detection and tracking of advertisement

  8. Mediacampaign - A multimodal semantic analysis system for advertisement campaign detection

    NARCIS (Netherlands)

    Rehatschek, H.; Sorschag, R.; Rettenbacher, B.; Zeiner, H.; Nioche, J.; Jong, F. de; Ordelmann, R.; Leeuwen, D. van

    2008-01-01

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project's main goal is to automate to a large degree the detection and tracking of advertisement

  9. Evaluation of a drowning prevention campaign in King County, Washington

    OpenAIRE

    BENNETT, E; Cummings, P; Quan, L; Lewis, F M

    1999-01-01

    Objectives—A three year drowning prevention campaign focused on increasing the use of life vests among children 1–14 years old. An evaluation was conducted to determine campaign awareness, change in ownership and use of life vests by children, and predictors of life vest use.

  10. Generation Xers Create a Campaign for the Library.

    Science.gov (United States)

    Kelly, Joyce

    1997-01-01

    The American Library Association (ALA) enlisted the help of design students at the University of Illinois/Chicago to produce an advertising campaign for the nation's libraries. The campaign, which took 15 weeks to prepare, resulted in bold, unusual, sometimes ambiguous, and thought-provoking ads. It embodied the relationship between libraries and…

  11. How to Run a Successful School Levy Campaign.

    Science.gov (United States)

    Meyers, Judith K.

    This document describes the public relations strategies employed by the Lakewood (Ohio) City School district to obtain voter support for a school levy. Various aspects of this successful campaign are described, including the formation of administrative committees to oversee campaign activities, steering and citizens' committees, the use of…

  12. Queer & Ally Youth Involvement in the Fair Wisconsin Campaign

    Science.gov (United States)

    Stiegler, Sam

    2008-01-01

    This article discusses the role and experience of queer youth and allies in the Fair Wisconsin campaign that fought against the marriage amendment to that state's constitution. It illustrates how LGBT and ally youth involvement can be incorporated into other organizations. Following an explanation of the campaign, are narratives of two…

  13. 5 CFR 734.411 - Participation in political campaigning; prohibitions.

    Science.gov (United States)

    2010-01-01

    ... under this subpart may not: (a) Take an active part in managing the political campaign of a candidate for partisan political office or a candidate for political party office; (b) Campaign for partisan... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in political...

  14. The Campaign for Nuclear Disarmament in the Eighties

    International Nuclear Information System (INIS)

    The Campaign for Nuclear Disarmament has been studied during the period 1979 to 1987. The study focuses specifically upon national CND, and seeks to fulfill three objectives: to provide an analysis of the internal workings of the Campaign, a discussion of its impact upon the British political system, and to relate these to recent and contemporary theories about social movements. (author)

  15. Status Report on the Development of Research Campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Baer, Donald R.; Baker, Scott E.; Washton, Nancy M.; Linggi, Bryan E.

    2013-06-30

    Research campaigns were conceived as a means to focus EMSL research on specific scientific questions. Campaign will help fulfill the Environmental Molecular Sciences Laboratory (EMSL) strategic vision to develop and integrate, for use by the scientific community, world leading capabilities that transform understanding in the environmental molecular sciences and accelerate discoveries relevant to the Department of Energy’s (DOE’s) missions. Campaigns are multi-institutional multi-disciplinary projects with scope beyond those of normal EMSL user projects. The goal of research campaigns is to have EMSL scientists and users team on the projects in the effort to accelerate progress and increase impact in specific scientific areas by focusing user research, EMSL resources, and expertise in those areas. This report will give a history and update on the progress of those campaigns.

  16. Evaluating the effects of a youth health media campaign.

    Science.gov (United States)

    Beaudoin, Christopher E; Thorson, Esther

    2007-01-01

    This article examines the impact of a socially oriented public health media campaign that aims to influence social indicators among adults as a means to advances in youth health outcomes. Hierarchical regression analyses are conducted on telephone survey data from 18 weekly telephone surveys of adults in Kansas. Media campaign exposure was positively associated with two outcome measures: beliefs about youth development and behaviors toward youth development. In addition, these two outcome measures increased significantly over time, with the dissemination of the campaign's television and newspaper advertisements. Furthermore, these over-time increases were present only among respondents who were exposed to the media campaign. These findings offer support for the campaign's influence on the two social indicators, which would, per other research, be expected to influence improvements in youth health. Findings are discussed in reference to previous research in the areas of public health and mass communication, with implications made for practitioners and researchers. PMID:17710595

  17. High levels of confusion for cholesterol awareness campaigns.

    Science.gov (United States)

    Hall, Danika V

    2008-09-15

    Earlier this year, two industry-sponsored advertising campaigns for cholesterol awareness that target the general public were launched in Australia. These campaigns aimed to alert the public to the risks associated with having high cholesterol and encouraged cholesterol testing for wider groups than those specified by the National Heart Foundation. General practitioners should be aware of the potential for the two campaigns to confuse the general public as to who should be tested, and where. The campaign sponsors (Unilever Australasia and Pfizer) each have the potential to benefit by increased market share for their products, and increased profits. These disease awareness campaigns are examples of what is increasingly being termed "condition branding" by pharmaceutical marketing experts. PMID:18803537

  18. Autonomous Rovers for Polar Science Campaigns

    Science.gov (United States)

    Lever, J. H.; Ray, L. E.; Williams, R. M.; Morlock, A. M.; Burzynski, A. M.

    2012-12-01

    We have developed and deployed two over-snow autonomous rovers able to conduct remote science campaigns on Polar ice sheets. Yeti is an 80-kg, four-wheel-drive (4WD) battery-powered robot with 3 - 4 hr endurance, and Cool Robot is a 60-kg 4WD solar-powered robot with unlimited endurance during Polar summers. Both robots navigate using GPS waypoint-following to execute pre-planned courses autonomously, and they can each carry or tow 20 - 160 kg instrument payloads over typically firm Polar snowfields. In 2008 - 12, we deployed Yeti to conduct autonomous ground-penetrating radar (GPR) surveys to detect hidden crevasses to help establish safe routes for overland resupply of research stations at South Pole, Antarctica, and Summit, Greenland. We also deployed Yeti with GPR at South Pole in 2011 to identify the locations of potentially hazardous buried buildings from the original 1950's-era station. Autonomous surveys remove personnel from safety risks posed during manual GPR surveys by undetected crevasses or buried buildings. Furthermore, autonomous surveys can yield higher quality and more comprehensive data than manual ones: Yeti's low ground pressure (20 kPa) allows it to cross thinly bridged crevasses or other voids without interrupting a survey, and well-defined survey grids allow repeated detection of buried voids to improve detection reliability and map their extent. To improve survey efficiency, we have automated the mapping of detected hazards, currently identified via post-survey manual review of the GPR data. Additionally, we are developing machine-learning algorithms to detect crevasses autonomously in real time, with reliability potentially higher than manual real-time detection. These algorithms will enable the rover to relay crevasse locations to a base station for near real-time mapping and decision-making. We deployed Cool Robot at Summit Station in 2005 to verify its mobility and power budget over Polar snowfields. Using solar power, this zero

  19. The Stages and Functions of Communication in Ballot Issue Campaigns: A Case Study of the Kansas Campaign for Liquor by the Drink.

    Science.gov (United States)

    Prentice, Diana B.; Carlin, John

    Arguing that state and local political issue campaigns warrant increased attention from communication scholars, this paper presents a rationale for analysis of issue campaigns, develops a framework for organizing and analyzing such campaigns, and applies the framework to an analysis of the 1986 campaign for the sale of liquor "by the drink" (no…

  20. International nuclear public acceptance - campaigns and strategies

    International Nuclear Information System (INIS)

    As we approach the 21st Century, society's values and expectations are changing throughout the world. This change is particularly rapid in the Pacific Basin where industrialisation and economic growth is acting as the catalyst for change in every area of society. Rapid global communications, single issue pressure groups and an expectation by the general public and other stakeholders to be consulted and involved in every stage of corporate decision-making, place increased pressures upon the world's corporate structures. This paper will analyse the changes currently taking place and look forward into the next century. The author will then examine the possible impact of these societal changes upon the global nuclear industry and propose ways in which the industry can respond to these changes before they negatively impact the business. He will examine the role of nuclear power in a changing world, its relationship with its various stakeholders, and suggest ways in which the industry can gain the initiative in its communications programmes of the future. In doing this he will draw upon examples of communication campaigns from both the nuclear and other industries. (author)

  1. Recall campaign for gas bottles and banks

    CERN Multimedia

    2015-01-01

    The previous contract with gas supplier Carbagas ended on 31 March 2015. Gas bottles and banks are not a property of CERN. According to the contract terms, they can remain on CERN sites without any extra costs until 30 September 2015.    If you are using Carbagas containers (bottles and/or banks) for gas purchased between 1 April 2010 and 31 March 2015, multiple options exist: Return them to the closest gas point. Purchase them on the following basis:     Rent them on the following basis: 12 CHF/month for bottles, 144 CHF/month for banks. The recall campaign has been going on for several months already: we would like to thank everyone who has already replied to it. If you haven’t answered yet, there is still time. If you know of unused or abandoned Carbagas containers, please don’t hesitate to contact us. Thank you i...

  2. The Norwegian information campaign on radon

    International Nuclear Information System (INIS)

    The responsibility for providing an overview of 'all factors in the environment which are or may be having a direct or indirect influence on the health - -' rests with the municipal health authorities. In order to enable the municipal staff throughout Norway to accomplish local radon surveys, an information campaign on radon, including printed information material and training courses, was carried out in 1998-99, primarily directed towards municipal civil servants. The two-day training courses comprised of lectures and a compendium covering basic knowledge on ionizing radiation, sources of radon, measurement techniques, health risk, prophylactic and remedial measures, design and accomplishment of survey projects, and information strategy. The printed information material includes booklets providing general information on radon (health risks, measurements, and mitigation), methods for measuring radon in indoor air and construction sites, action levels, and design of municipal radon surveys. Two posters have been issued, one mainly intended for public offices and waiting rooms to motivate the public for radon measurements, the other one intended for municipal personnel and governmental offices, the latter also issued as a collection of fact sheets intended for schools etc. the booklets are displayed on the Internet (www.nrpa.no). The site also contains links to further information on mitigation techniques and economic support to remedial measures. (au)

  3. Advanced Fuels Campaign FY 2010 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2010-12-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) Accomplishment Report documents the high-level research and development results achieved in fiscal year 2010. The AFC program has been given responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. The science-based approach combines theory, experiments, and multi-scale modeling and simulation aimed at a fundamental understanding of the fuel fabrication processes and fuel and clad performance under irradiation. The scope of the AFC includes evaluation and development of multiple fuel forms to support the three fuel cycle options described in the Sustainable Fuel Cycle Implementation Plan4: Once-Through Cycle, Modified-Open Cycle, and Continuous Recycle. The word “fuel” is used generically to include fuels, targets, and their associated cladding materials. This document includes a brief overview of the management and integration activities; but is primarily focused on the technical accomplishments for FY-10. Each technical section provides a high level overview of the activity, results, technical points of contact, and applicable references.

  4. Eco-Schools campaign. The European projects

    International Nuclear Information System (INIS)

    The Foundation for Environmental Education in Europe (FEEE) was established in 1981; since then it was been actively promoting and delivering education through a series of successful internationals programmes launched in 21 different European nations. The Eco-School Campaign aims to raise students' awareness of environment issues through classroom study, and provide an integrated system for environmental management of schools based on EMAS (with waste, water and energy management as priority areas). As a process of facilitating sustainable developpement at a local level, pupils are encouraged to take an active role in mental impact of the schools. The Eco-Schools Green Flag, awarded to schools with high achievement in their Programme, is a recognised and respected eco-label for environmental education and performance. In Italy the National Eco-Schools operator was asked to set up a ten-schools pilot programme in the region Friuli Venezia Giulia: these are very first national schools that are likely to become 'Eco-Schools'

  5. Cost effective campaigning in social networks

    Science.gov (United States)

    Kotnis, Bhushan; Kuri, Joy

    2016-05-01

    Campaigners are increasingly using online social networking platforms for promoting products, ideas and information. A popular method of promoting a product or even an idea is incentivizing individuals to evangelize the idea vigorously by providing them with referral rewards in the form of discounts, cash backs, or social recognition. Due to budget constraints on scarce resources such as money and manpower, it may not be possible to provide incentives for the entire population, and hence incentives need to be allocated judiciously to appropriate individuals for ensuring the highest possible outreach size. We aim to do the same by formulating and solving an optimization problem using percolation theory. In particular, we compute the set of individuals that are provided incentives for minimizing the expected cost while ensuring a given outreach size. We also solve the problem of computing the set of individuals to be incentivized for maximizing the outreach size for given cost budget. The optimization problem turns out to be non trivial; it involves quantities that need to be computed by numerically solving a fixed point equation. Our primary contribution is, that for a fairly general cost structure, we show that the optimization problems can be solved by solving a simple linear program. We believe that our approach of using percolation theory to formulate an optimization problem is the first of its kind.

  6. 2013 Bike safety campaign: outcome and feedback

    CERN Multimedia

    HSE Unit

    2013-01-01

    From 3 to 17 June, the HSE Unit, in collaboration with the Reception and Access Control Service, led a campaign targeting CERN cyclists.   Photo: Laëtitia Wohlgemuth. In exchange for vouchers distributed by the security guards, 195 persons received a helmet and a reflective vest as well as documents on safety issues (ex: how to adjust one’s safety helmet properly; how to avoid blind spots; what is the required equipment for bikes and bike users, etc.). These persons also took part in a survey that contained questions on their cycling habits and level of knowledge on bike safety issues. It appeared that, for instance, 43% of the participants were aware that wearing a reflective vest is mandatory whenever visibility is poor (in France). 95% gave particular attention to the need to protect their heads (by assuming that wearing a helmet is either “mandatory” or “highly recommended”). The HSE Unit provided the participants with further i...

  7. A campaign strategy for your career.

    Science.gov (United States)

    Clark, Dorie

    2012-11-01

    Organizations are inherently political, and pretending they're not is just plain impractical. But strategizing like a politician to advance your career doesn't have to mean compromising your integrity. You can craft a campaign plan that actually gets results without making you feel soiled. So argues Clark, who has worked with top-tier politicians and business executives as they strive to achieve their goals. She recommends that in business, as in politics, aspiring leaders choose their career milestones from the get-go and plan precisely what reaching each one will demand. That means taking inventory of the skills you'll need to acquire and figuring out exactly where and how you'll develop them. The best career planners work backward on the calendar: They start with the end points and carefully mark, in reverse, all the steps along the way. Then they set out on the course, identifying influential people whose favor they need to win and getting specific about how to garner it. They use power maps to home in on the most influential individuals and groups, and they aren't shy about courting votes. "Being political" still sounds negative to many people in business, but learning how to play the game doesn't have to be a Machiavellian endeavor. Indeed, harming people in the process won't help you at all, but if you eschew the political process altogether, you'll only harm yourself. PMID:23156001

  8. The challenge of the virginity campaigns.

    Science.gov (United States)

    Watts, R

    1999-01-01

    In many societies, virginity is prized and achieved far more frequently by women than by men. From the early days of the AIDS pandemic, religious bodies have demanded that young people abstain from sex until marriage. The rapid spread of HIV, however, clearly indicates that these calls have gone unheeded. Apparently non-affiliated with mainstream churches and mosques, a grassroots campaign for virginity has been growing in the Durban area, centered around schools and involving virginity testing and the issuance of certificates of virginity. The testing of girls generally involves examination of the vagina by a teacher while the girl lies on the ground. A virginity test for boys involves looking for lines at the back of the knees, inspecting the foreskin (which should be hard), and testing whether boys can urinate over a wire suspended 1 m above the ground. Testing occurs in a public, ceremonial setting, with certificates subsequently awarded to virgins by the All Africa Cultural Organization. While there is unanimous accord in the medical community that it is impossible to test exclusively for virginity, these tests could help reduce the incidence of casual sex among teenagers if they believe the examinations are valid. The tradition of virginity, the teaching of non-penetrative sex practices, and the responsibilities of churches are briefly discussed. These virginity tests should be taken seriously until they can be made more effective, and the teachers involved could be co-opted into local AIDS organizations. PMID:12294476

  9. What matters most in advertising campaigns? The relative effect of media expenditure and message content strategy

    NARCIS (Netherlands)

    B. van den Putte

    2009-01-01

    Three main factors determine the effect of advertising campaigns: message content strategy, advertising expenditure and previous consumer behaviour. This study investigates the relative strength of each of these influences. Four possible campaign targets are taken into account: campaign recall, camp

  10. The National Ignition Campaign (NIC) 'Blue Team/Red Team' Simulated Campaigns (Sim-Cams)

    International Nuclear Information System (INIS)

    The Point design Target of the National Ignition Campaign (NIC) has specifications and tolerances that have been set using a multi variable sensitivity study (MVSS). The sub component interactions and sensitivities that feed the MVSS have been calculated using sophisticated target physics radiation hydro-codes. However, it is cannot be guaranteed that the point design configuration has been specified with enough precision for ignition to occur without first correcting for possible off-sets due to physics uncertainties in the data models used in these studies. For this reason the NIC includes a series of tuning experiments, which have been designed and sequenced to systematically remove potential off-sets in specified target and laser parameters as efficiently and effectively as possible. In order to test the tuning techniques and logic the NIC has been executing Simulated Campaigns (Sim-Cam's). In the Sim-Cam's are a Blue Team and a Red Team. The Blue Team conducts the experiments, making shot-to-shot decisions on how to adjust the laser pulse or target parameters, based on 'experimental' data provided by the Red Team who simulate the laser, target and diagnostics performance. To capture a plausible off-set between nature and models the Red Team construct a new virtual reality by adjusting the physics data and models, keeping the changes within their best estimate of uncertainties. The Red Team also include much of the shot-to-shot variability due to small laser and target variations that can be expected in NIF experiments, as well as diagnostic noise. The details of all of this are kept hidden from the Blue Team. The Sim-Cam's also serve to test and improve the infrastructure and processes for executing the NIF experiments. The role of the Simulated Campaigns in preparing for the NIC experimental plan will be described, and some of the results discussed.

  11. Ionospheric measurements during the CRISTA/MAHRSI campaign: their implications and comparison with previous campaigns

    Directory of Open Access Journals (Sweden)

    J. Laštovicka

    Full Text Available The CRISTA/MAHRSI experiment on board a space shuttle was accompanied by a broad campaign of rocket, balloon and ground-based measurements. Supporting lower ionospheric ground-based measurements were run in Europe and Eastern Asia between 1 October-30 November, 1994. Results of comparisons with long ionospheric data series together with short-term comparisons inside the interval October-November, 1994, showed that the upper middle atmosphere 
    (h = 80-100 km at middle latitudes of the Northern Hemisphere in the interval of the CRISTA/MAHRSI experiment (4-12 November, 1994 was very close to its expected climatological state. In other words, the average results of the experiment can be used as climatological data, at least for the given area/altitudes. The role of solar/geomagnetic and "meteorological" control of the lower ionosphere is investigated and compared with the results of MAP/WINE, MAC/SINE and DYANA campaigns. The effects of both solar/geomagnetic and global meteorological factors on the lower ionosphere are found to be weak during autumn 1994 compared to those in MAP/WINE and DYANA winters, and they are even slightly weaker than those in MAP/SINE summer. The comparison of the four campaigns suggests the following overall pattern: in winter the lower ionosphere at northern middle latitudes appears to be fairly well "meteorologically" controlled with a very weak solar influence. In summer, solar influence is somewhat stronger and dominates the weak "meteorological" influence, but the overall solar/meteorological control is weaker than in winter. In autumn we find the weakest overall solar/meteorological control, local effects evidently dominate.

    Key words. Ionosphere (ionosphere · atmosphere interactions; mid-latitude ionosphere

  12. Dropping the Ax: Illegal Firings During Union Election Campaigns

    OpenAIRE

    John Schmitt; Ben Zipperer

    2007-01-01

    This report finds a steep rise in illegal firings of pro-union workers in the 2000s relative to the last half of the 1990s. It uses published data from the National Labor Relations Board (NLRB) to update an index of the probability that a pro-union worker will be fired in the course of a union election campaign. By 2005, pro-union workers involved in union election campaigns faced about a 1.8 percent chance of being illegally fired during the course of the campaign. If we assume that employer...

  13. Some Accounting Aspects regarding the Elections Campaigns in Romania

    Directory of Open Access Journals (Sweden)

    Riana Iren Radu

    2016-07-01

    Full Text Available The objective of this paper is to present the legal framework for financing the election campaigns in Romania and in the world. There are different systems of campaign finance across the world. Some of these systems rely mainly on private funds, some are based mainly on public funds, but most systems are a combination of both. In all cases a certain degree of limitations on contributions and expenditures are a standard characteristic of the campaign finance system. Limitations on contributions can be means to reduce the corruption and limitations on expenditures may be imposed to guarantee egalitarianism among the various political forces.

  14. Preparing for SMOS: Sea Salinity Campaigns and Results

    DEFF Research Database (Denmark)

    Søbjærg, Sten Schmidl; Balling, Jan E.; Kristensen, Steen Savstrup;

    2006-01-01

    Mapping of sea surface salinity, based on L-band radiometric measurements, is presently investigated as a preparation for space missions. Special concern is on correction for effects caused by the sea surface roughness, and this paper will address two campaigns, LOSAC and CoSMOS, with the aim of...... investigating these effects. Conclusions from LOSAC are presented, and open issues to be investigated during the presently ongoing CoSMOS campaign are outlined. Finally, the installation and campaign plan for CoSMOS are presented....

  15. The VERB campaign: applying a branding strategy in public health.

    Science.gov (United States)

    Asbury, Lori D; Wong, Faye L; Price, Simani M; Nolin, Mary Jo

    2008-06-01

    A branding strategy was an integral component of the VERB Youth Media Campaign. Branding has a long history in commercial marketing, and recently it has also been applied to public health campaigns. This article describes the process that the CDC undertook to develop a physical activity brand that would resonate with children aged 9-13 years (tweens), to launch an unknown brand nationally, to build the brand's equity, and to protect and maintain the brand's integrity. Considerations for branding other public health campaigns are also discussed. PMID:18471598

  16. Conceptual Design - Polar Drive Ignition Campaign

    International Nuclear Information System (INIS)

    to be defined. In all cases, the facility modifications represent functional changes to existing systems or capabilities. The bulk of the scope yet to be identified is associated with the DPR's and MultiFM beam smoothing. Detailed development plans for these two subsystems are provided in Appendices H and I; additional discussion of subsystem requirements based on the physics of PD ignition is given in Section 3. Accordingly, LLE will work closely with LLNL to develop detailed conceptual designs for the PD-specific facility modifications, including assessments of the operational impact of implementation (e.g., changing optics for direct rather than indirect-drive illumination and swapping from a hohlraum-based ITIC to one that supports PD). Furthermore, the experimental implementation plan represents the current best understanding of the experimental campaigns required to achieve PD ignition. This plan will evolve based on the lessons learned from the National Ignition Campaign (NIC) and ongoing indirect-drive ignition experiments. The plan does not take the operational realities of the PD configuration into account; configuration planning for the proposed PD experiments is beyond the scope of this document.

  17. Conceptual Design - Polar Drive Ignition Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, R

    2012-04-05

    Review (CDR) remain to be defined. In all cases, the facility modifications represent functional changes to existing systems or capabilities. The bulk of the scope yet to be identified is associated with the DPR's and MultiFM beam smoothing. Detailed development plans for these two subsystems are provided in Appendices H and I; additional discussion of subsystem requirements based on the physics of PD ignition is given in Section 3. Accordingly, LLE will work closely with LLNL to develop detailed conceptual designs for the PD-specific facility modifications, including assessments of the operational impact of implementation (e.g., changing optics for direct rather than indirect-drive illumination and swapping from a hohlraum-based ITIC to one that supports PD). Furthermore, the experimental implementation plan represents the current best understanding of the experimental campaigns required to achieve PD ignition. This plan will evolve based on the lessons learned from the National Ignition Campaign (NIC) and ongoing indirect-drive ignition experiments. The plan does not take the operational realities of the PD configuration into account; configuration planning for the proposed PD experiments is beyond the scope of this document.

  18. Manus Water Isotope Investigation Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Conroy, Jessica L [University of Illinois, Urbana-Champaign; Cobb, Kim M [Georgia Institute of Technology; Noone, David [University of Colorado, Boulder

    2016-03-01

    The objective of this field campaign was to investigate climatic controls on the stable isotopic composition of water vapor, precipitation, and seawater in the western tropical Pacific. Simultaneous measurements of the stable isotopic composition of vapor and precipitation from April 28 to May 8, 2013, at the Manus Tropical Western Pacific Atmospheric Radiation Measurement site, provided several key insights into the nature of the climate signal archived in precipitation and vapor isotope ratios. We observed a large shift from lower to higher isotopic values in vapor and precipitation because of the passage of a mesoscale convective system west of the site and a transition from a regional stormy period into a more quiescent period. During the quiescent period, the stable isotopic composition of vapor and precipitation indicated the predominance of oceanic evaporation in determining the isotopic composition of boundary-layer vapor and local precipitation. There was not a consistent relationship between intra-event precipitation amount at the site and the stable isotopic composition of precipitation, thus challenging simplified assumptions about the isotopic “amount effect” in the tropics on the time scale of individual storms. However, some storms did show an amount effect, and deuterium excess values in precipitation had a significant relationship with several meteorological variables, including precipitation, temperature, relative humidity, and cloud base height across all measured storms. The direction of these relationships points to condensation controls on precipitation deuterium excess values on intra-event time scales. The relationship between simultaneous measurements of vapor and precipitation isotope ratios during precipitation events indicates the ratio of precipitation-to-vapor isotope ratios can diagnose precipitation originating from a vapor source unique from boundary-layer vapor and rain re-evaporation.

  19. An overview of the HIBISCUS campaign

    Directory of Open Access Journals (Sweden)

    J.-P. Pommereau

    2007-02-01

    Full Text Available HIBISCUS was a field campaign for investigating the impact of deep convection on the Tropical Tropopause Layer (TTL and the Lower Stratosphere, which took place during the Southern Hemisphere summer in February–March 2004 in the State of São Paulo, Brazil. Its objective was to provide a set of new observational data on meteorology, tracers of horizontal and vertical transport, water vapour, clouds, and chemistry in the tropical UT/LS from balloon observations at local scale over a land convective area, as well as at global scale using circumnavigating long-duration balloons. Overall, the composition of the TTL, the region between 14 and 19 km of intermediate lapse rate between the almost adiabatic upper troposphere and the stable stratosphere, appears highly variable. Tracers and ozone measurements performed at both the local and the global scale indicate a strong quasi-horizontal isentropic exchange with the lowermost mid-latitude stratosphere suggesting that the barrier associated to the tropical jet is highly permeable at these levels in summer. But the project also provides clear indications of strong episodic updraught of cold air, short-lived tracers, low ozone, humidity and ice particles across the lapse rate tropopause at about 15 km, up to 18 or 19 km at 420–440 K potential levels in the lower stratosphere, suggesting that, in contrast to oceanic convection penetrating little the stratosphere, fast daytime developing land convective systems could be a major mechanism in the troposphere-stratosphere exchange at the global scale.

    The present overview is meant to provide the background of the project, as well as overall information on the instrumental tools available, on the way they have been used within the highly convective context of the South Atlantic Convergence Zone, and a brief summary of the results, which will be detailed in several other papers of this special issue.

  20. The Australian national binge drinking campaign: campaign recognition among young people at a music festival who report risky drinking

    Directory of Open Access Journals (Sweden)

    Sacks-Davis Rachel

    2011-06-01

    Full Text Available Abstract Background The Australian Government launched a mass media campaign in 2009 to raise awareness of the harms and costs associated risky drinking among young Australians. The aim of this study was to assess if young people attending a music festival who report frequent risky single occasions of drinking (RSOD recognise the key message of the campaign, "Binge drinking can lead to injuries and regrets", compared to young people who report less frequent RSOD. Methods A cross-sectional behavioural survey of young people (aged 16-29 years attending a music festival in Melbourne, Australia, was conducted in January 2009. We collected basic demographics, information on alcohol and other drug use and sexual health and behaviour during the previous 12 months, and measured recognition of the Australian National Binge Drinking Campaign key message. We calculated the odds of recognition of the key slogan of the Australian National Binge Drinking Campaign among participants who reported frequent RSOD (defined as reported weekly or more frequent RSOD during the previous 12 months compared to participants who reported less frequent RSOD. Results Overall, three-quarters (74.7% of 1072 participants included in this analysis recognised the campaign message. In the adjusted analysis, those reporting frequent RSOD had significantly lower odds of recognising the campaign message compared to those not reporting frequent RSOD (OR 0.7, 95% CI 0.5-0.9, whilst females had significantly greater odds of recognising the campaign message compared to males (OR 1.8, 95% CI 1.4-2.1. Conclusions Whilst a high proportion of the target group recognised the campaign, our analysis suggests that participants that reported frequent RSOD - and thus the most important group to target - had statistically significantly lower odds of recognising the campaign message.

  1. Evaluation tool for road safety campaigns – a short overview

    Directory of Open Access Journals (Sweden)

    Marko Divjak

    2011-04-01

    Full Text Available The aim of this paper is to introduce the Evaluation tool for road safety campaigns which is one of the most important results of the CAST project. Recommendations and guidelines of the Evaluation tool are based on the fact that certain attributes (the scope of a campaign, the target group(s, the goals and the activities of a campaign of a campaign have a detrimental effect upon designing evaluation, which means choosing suitable measurement variables, data collection methods/techniques and research designs. Recommendations and guidelines about various options for evaluation are given for each of the four attributes separately. The Evaluation tool guides evaluator through the process by emphasizing the approaches that appear most useful in a given context together with the main strengths and weaknesses.

  2. University's marketing campaign receives Virginia Public Relations awards

    OpenAIRE

    Owczarski, Mark

    2009-01-01

    The Richmond chapter of the Public Relations Society of America (PRSA) honored Virginia Tech's "This is the Future" campaign with a bronze medallion for its microsite and a silver certificate of merit for reputation and brand management.

  3. Zambia Communications Support for Health Safe Love Campaign Outcome Evaluation

    Data.gov (United States)

    US Agency for International Development — The Safe Love campaign was a three-year comprehensive HIV prevention behavior change and communication (BCC) initiative implemented between June 2011 and June 2014....

  4. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (< 1 year). In both cases MRTs of 13 - 17 years, calculated

  5. Consumer Perceptions of Education-Based Corporate Social Responsibility Campaigns

    OpenAIRE

    Ahmet Uyar; Berrin Onaran,; Ali Avan

    2013-01-01

    The main purpose of this study is to evaluate education supported corporate social responsibility campaigns from customers’ point of view. Within this scope, corporate social responsibility notion has been explained and especially education based social responsibility campaigns have been evaluated. The population of the study was constituted from the undergraduate students which study in Afyon Kocatepe University. The survey implementation was conducted through 451 participants, which is abov...

  6. Setting up measuring campaigns for integrated wastewater modelling

    DEFF Research Database (Denmark)

    Vanrolleghem, P.A.; Schilling, W.; Rauch, Wolfgang; Krebs, P.; Aalderink, H.

    1999-01-01

    recommendations have been formulated for design of measuring campaigns. The inclusion of iteration in the overall planning of measuring campaigns is advised and the use of preliminary sensitivity analysis is shown to allow maximisation of information retrieval from experimental efforts. Case studies covering...... problems related to suspended solids, specific contaminants, hygienic hazards and total pollutant loss illustrate the recommendations presented. (C) 1999 IAWQ Published by Elsevier Science Ltd. All rights reserved....

  7. Changing regional images; are regional marketing campaigns successful?

    OpenAIRE

    Wilhelm J. Meester; Pellenbarg, Pieter H.

    2001-01-01

    An important element in the urban and regional development strategy of many local and regional governments is geographical marketing. The process of geographical marketing combines promotional, spatial and organisational activities, and can be aimed at various groups. In 1989 a marketing campaign was started by the province of Groningen, in the northern part of the Netherlands. This campaign, which is still being carried on, has used various means of communication: advertisements in newspaper...

  8. Purex process operation and performance, 1970 Thoria Campaign

    International Nuclear Information System (INIS)

    The Hanford Purex Plant fulfilled a 1970 commitment to the Atomic Energy Commission to produce 360 kilograms of high purity 233U as uranyl nitrate solution. Overall plant performance during both 1970 and 1966 confirmed the suitability of Purex for processing thorium on a campaign basis. The 1970 processing campaign, including flushing operations, is discussed with particular emphasis on problem areas. Background information on the process and equipment used is also presented. The organizations and their designations described are those existing in 1970

  9. Crowdfunding Campaigns Help Researchers Launch Projects and Generate Outreach.

    Science.gov (United States)

    Dahlhausen, Katherine; Krebs, Bethany L; Watters, Jason V; Ganz, Holly H

    2016-03-01

    Organizers of participatory research (citizen science) projects can generate funds and outreach through crowdfunding. Here we provide insights from three successful science crowdfunding campaigns recently completed on Indiegogo, Experiment, and Kickstarter. Choosing a crowdfunding platform that fits the project is just the beginning; a successful campaign reflects its content, management, and marketing, and some researchers may need to acquire new skills. In addition, the growing trend of crowdfunding for science reinforces the importance of academic engagement with social media. PMID:27047586

  10. Crowdfunding Campaigns Help Researchers Launch Projects and Generate Outreach

    OpenAIRE

    Katherine Dahlhausen; Krebs, Bethany L.; Watters, Jason V.; Ganz, Holly H.

    2015-01-01

    Organizers of participatory research (citizen science) projects can generate funds and outreach through crowdfunding. Here we provide insights from three successful science crowdfunding campaigns recently completed on Indiegogo, Experiment, and Kickstarter. Choosing a crowdfunding platform that fits the project is just the beginning; a successful campaign reflects its content, management, and marketing, and some researchers may need to acquire new skills. In addition, the growing trend of cro...

  11. Crowdfunding Campaigns Help Researchers Launch Projects and Generate Outreach

    Directory of Open Access Journals (Sweden)

    Katherine Dahlhausen

    2015-11-01

    Full Text Available Organizers of participatory research (citizen science projects can generate funds and outreach through crowdfunding. Here we provide insights from three successful science crowdfunding campaigns recently completed on Indiegogo, Experiment, and Kickstarter. Choosing a crowdfunding platform that fits the project is just the beginning; a successful campaign reflects its content, management, and marketing, and some researchers may need to acquire new skills. In addition, the growing trend of crowdfunding for science reinforces the importance of academic engagement with social media.

  12. The role of authenticity in electoral social media campaigns

    OpenAIRE

    Grow, Gabrielle; Ward, Janelle

    2013-01-01

    textabstractAuthenticity is a popular buzzword in electoral politics: Electoral candidates and politicians are expected to be authentic in their public interactions. Since 2008, campaigning via social media has become an integral part of elections in the United States, and continues to gain importance. In such an environment, this paper presents research into the role of authenticity in electoral social media campaigns. Using Gilpin, et al.'s (2010) definition of authenticity as the theoretic...

  13. Monitoring the exposure of "America Responds to AIDS" PSA campaign.

    OpenAIRE

    Gentry, E M; Jorgensen, C M

    1991-01-01

    The "America Responds to AIDS" campaign is the focal point of an integrated mass communications system for AIDS education and information dissemination developed by the National AIDS Information and Education Program of the Centers for Disease Control. Television and radio public service announcements are an integral part of the campaign. One measure of their success is the extent to which they are aired on both national and local levels. Since 1987, the total dollar value for air time donate...

  14. Analysis of snow bidirectional reflectance from ARCTAS spring-2008 campaign

    OpenAIRE

    A. Lyapustin; C. K. Gatebe; R. Kahn; R. Brandt; J. Redemann; P. Russell; M. D. King; PEDERSEN, C.A.; S. Gerland; R. Poudyal; A. Marshak; Wang, Y.; Schaaf, C; Hall, D.; A. Kokhanovsky

    2009-01-01

    The spring 2008 Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) experiment was one of major intensive field campaigns of the International Polar Year aimed at detailed characterization of atmospheric physical and chemical processes in the Arctic region. A part of this campaign was a unique snow bidirectional reflectance experiment on the NASA P-3B aircraft conducted on 7 and 15 April by the Cloud Absorption Radiometer (CAR) jointly with airborne Ame...

  15. Mass-media publicity campaign on driving while intoxicated.

    OpenAIRE

    Wesemann, P.

    1986-01-01

    Mass media publicity campaigns against driving while intoxicated have been conducted in the netherlands for a number of years. A new, more aggressive approach was introduced in 1984 with the slogan "alcohol ..... all too easily a crime". Goals of this campaign were (1) internationalization of the legal norm (0.5 promille) (2) increased social control and (3) increased knowledge on sanctions and sobering remedies. An evaluation was conducted with the main objective to determine whether or not ...

  16. The role of authenticity in electoral social media campaigns

    OpenAIRE

    Grow, Gabrielle; Ward, Janelle

    2013-01-01

    Authenticity is a popular buzzword in electoral politics: Electoral candidates and politicians are expected to be authentic in their public interactions. Since 2008, campaigning via social media has become an integral part of elections in the United States, and continues to gain importance. In such an environment, this paper presents research into the role of authenticity in social media electoral campaigns. Using Gilpin, et al.’s (2010) definition of authenticity as the theoretical bas...

  17. GLOBE Aerosol Field Campaign - U.S. Pilot Study 2016

    Science.gov (United States)

    Pippin, Margaret; Marentette, Christina; Bujosa, Robert; Taylor, Jessica; Lewis, Preston

    2016-01-01

    During the spring of 2016, from April 4 - May 27, sixteen GLOBE schools participated in the GLOBE Aerosol Field Campaign - U.S. Pilot Study. Thirteen teachers from these schools had previously participated in the NASA LEARN program (Long-term Experience in Authentic Research with NASA) where they were GLOBE trained in Atmosphere protocols, and engaged in 1-3 years of research under the mentorship of NASA scientists. Each school was loaned two aerosol instruments for the Campaign duration, either 2 GLOBE sun photometers, 2 Calitoo sun photometers, or 1 of each. This allowed for students to make measurements side-by-side and in the case of the Calitoos, to compare AOT results immediately with each other for better consistency in data collection. Additionally, as part of the Field Campaign evaluation, multiple instruments allow for an assessment of the ease of use of each instrument for grade level of students, whether in middle school or high school. Before the Campaign, all GLOBE and Calitoo instruments were 'checked out' against an AERONET, then checked again upon return after the Campaign. By examining all data, before, during and after the Campaign, this gives an indication of instrument performance and proficiency obtained by the students. Support was provided to each teacher and their students at the level requested, via email, phone or video conferencing.

  18. Do anti-smoking media campaigns help smokers quit?

    Science.gov (United States)

    Popham, W J; Potter, L D; Bal, D G; Johnson, M D; Duerr, J M; Quinn, V

    1993-01-01

    As part of an evaluation of the 1990-91 anti-tobacco media campaign carried out by the California Department of Health Services, a study was conducted among 417 regular smokers who had quit during the period of the media campaign. In brief telephone interviews, all respondents identified up to three events or experiences that had influenced them to quit. In response to uncued questions, 6.7 percent of those interviewed indicated that they had been influenced to quit by an advertisement they had seen or heard on radio, television, or billboards. In response to direct questions about the media campaign, 34.3 percent of the respondents indicated that the media campaign's advertisement had played a part in their decision to quit. Applying the 6.7 percentage to the number of Californians who quit smoking in 1990-91, it can be estimated that for 33,000 former smokers, the anti-tobacco media advertisements were an important stimulus in their quit decision. Multiplying the 34.3 percent by the number of former California smokers who quit in 1990-91, the estimate of former smokers for whom the media campaign's advertisements played at least some part in their decision to quit rises to 173,000 persons. While causal attributions from such investigations should be made with caution, the evidence suggests that the 1990-91 campaign did influence substantial number of smokers in California to quit. PMID:8341788

  19. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems. PMID:26863003

  20. On the impact of Twitter-based health campaigns: a cross-country analysis of movember

    NARCIS (Netherlands)

    Dwi Prasetyo, N.; Hauff, C.; Nguyen, Dong-Phuong; van den Broek, T.; Hiemstra, D.

    2015-01-01

    Health campaigns that aim to raise awareness and subsequently raise funds for research and treatment are commonplace. While many local campaigns exist, very few attract the attention of a global audience. One of those global campaigns is Movember, an annual campaign during the month of November, tha

  1. The Christian Schools Campaign: What Were Its Long-Term Consequences?

    Science.gov (United States)

    Baker, Sylvia

    2009-01-01

    This article looks at the long-term consequences of a political campaign that was influential in Britain between 1988 and 1992, the Christian Schools Campaign. The campaign was a response to the need for funding of a group of small independent Christian schools. The article brings up to date the direct outcomes of the campaign in two areas. The…

  2. EMECC campaign at TRILLO: results and comparison with French feedback

    International Nuclear Information System (INIS)

    The reduction of collective dose is an important objective for all nuclear plant operators. One of the support for studying the impact of design and operation parameters is the measurement campaigns of contamination in PWRs. EDF performs consequently gamma spectrometry measurements with CEA and his EMECC system, with more than 300 campaigns in EDF plants and also some campaigns in collaboration with other operators. Commissioned in 1988, the only unit of the nuclear power plant of TRILLO, located in Spain, is a 3-loop PWR of 1066 MWe designed by KWU-Siemens. TRILLO-1, equipped with alloy 800 tubed steam generators, is characterized by a low dosimetry. In order to compare the contamination level of TRILLO-1 to that of French PWRs, an EMECC campaign was performed within the framework of a contract between EDF and the CEA, and with the agreement of CNAT/TRILLO and the support of the CSN (Consejo de Seguridad Nuclear). This campaign took place during the refueling shutdown at the end of cycle 21 from 9 to 16 February 2009. A previous EMECC campaign was performed in 1992 during the refueling shutdown of cycle 4. At the first time, this paper will present the main conclusions of this EMECC campaign: deposited activities measured on legs walls and steam generator tubes walls; and, dose rates measurements. The evolution of the contamination since cycle 4 will be also analyzed. Furthermore, a comparison with the French unit St-LAURENT B1 will be achieved in order to better understand the origin of the differences (source term or outage management) and to improve good operational practices in the future. (author)

  3. 242-A Campaign 94-1 post run document

    International Nuclear Information System (INIS)

    The purpose of this post-run document is to summarize the results of 242-A Evaporator Campaign 94-1 as required. Campaign 94-1 represents the first Evaporator operation since 1989, following completion of the B-534 upgrades and Liquid Effluent Retention Facility (LERF) construction. The purpose of Campaign 94-1 was to concentrate dilute waste from TK-102-AW, TK-106-AW, and TK-103-AP. From an available 2.87 million gallon feedstock of dilute waste contained in 102-AW, 106-AW and 103-AP, an overall Waste Volume Reduction (WVR) of 2.39 million gallons (83% WVRF) was achieved. At the completion of the campaign, approximately 477,000 gallons of dilute double-shell slurry feed (DDSSF) was produced with a SpG. of 1.25--1.30. Total process condensate discharged to LERF was 3.09 million gallons, achieving a condensate/WVR ratio of 1.29. Throughput for Campaign 94-1 was 5.27 million gallons. Total steam condensate and cooling water discharge to B-pond was 4.7 and 216 million gallons respectively. The evaporator operated approximately 43 days of the 60 day campaign for a total operating efficiency of 73%. Campaign 94-1 was completed without any discharge limit, Operating Specification Document, or Operational Safety Requirement violations. Major problems encountered during the run included the following: (1) high CA1 deentrainment pad dP's caused by foaming, (2) condensate pump P-C100 failure, and (3) ion exchange column dP's and efficiency

  4. Portuguese road safety campaigns: an analysis of its influence

    Directory of Open Access Journals (Sweden)

    Manuel José Fonseca

    2012-09-01

    Full Text Available Focused in road safety campaigns, thisstudy aims to analyze the attitude of the Portuguesedrivers towards these campaigns, particularly in relationto different creative dimensions. In addition,based on this attitude, this research aims to proposea segmentation of Portuguese drivers accordingto their attitude towards these campaigns. In termsof methodology we developed a conceptual modelinvolving creative dimensions of these campaigns.Subsequently a questionnaire was administered toa sample of 305 Portuguese drivers, where it wasintended to assess the influence of each dimensionto the driving behavior. Based on the results wecome up with some contributions to the validationof the model and also to identify three distinctgroups of drivers in terms of att itude to communicationcampaigns: “Indiff erent”, “Influenced”, and“Interested.”As main results, we found that theseroad safety campaigns are not consensual, and thatthere are drivers who reject this type of campaignsand others who identify themselves as being stronglyinfluenced by them. It was also found that thestructure of messages based in dramatic tones andfear appeals could lead to an increase in its persuasivepotential.

  5. The impact of mass communication campaigns in the health field.

    Science.gov (United States)

    Alcalay, R

    1983-01-01

    This article analyzes a series of health education projects that used the mass media to change behavior. First, the article describes how persuasion theories are used to maximize impact in mass communication campaigns. Second, this paper discusses theories of social psychology used in such campaigns. One such theory, cognitive dissonance, explains changes at the level of attitudes, beliefs and opinion. Another theory, social learning, defines strategies of behavior changes. A third theory, concerning diffusion of innovations, helps understand the network of interpersonal relationships essential for the adoption of any innovation. McGuire's inoculation theory suggests strategies to aid resistance to harmful environmental influences (e.g. smoking, excessive drinking, etc.). Third, this work reviews public health campaigns that have used one or more of these theories of social psychology. The first project, dealing with smoking behavior cessation and prevention, mainly used strategies of interpersonal communication for inoculating and modeling useful behavior in order to resist social pressures favorable to smoking. The second project, designed to prevent alcoholism, used the mass media primarily. The objective of this campaign was to obtain changes in knowledge, attitude and behavior in the public through modeling desirable behaviors over public service announcements. The third campaign, a heart disease prevention program, used a combination of mass media and interpersonal communication to achieve changes in lifestyle of the population. Finally, this article describes limitations in using mass media in behavior change health programs. PMID:6836345

  6. A hypothesis-driven approach to optimize field campaigns

    Science.gov (United States)

    Nowak, Wolfgang; Rubin, Yoram; de Barros, Felipe P. J.

    2012-06-01

    Most field campaigns aim at helping in specified scientific or practical tasks, such as modeling, prediction, optimization, or management. Often these tasks involve binary decisions or seek answers to yes/no questions under uncertainty, e.g., Is a model adequate? Will contamination exceed a critical level? In this context, the information needs of hydro(geo)logical modeling should be satisfied with efficient and rational field campaigns, e.g., because budgets are limited. We propose a new framework to optimize field campaigns that defines the quest for defensible decisions as the ultimate goal. The key steps are to formulate yes/no questions under uncertainty as Bayesian hypothesis tests, and then use the expected failure probability of hypothesis testing as objective function. Our formalism is unique in that it optimizes field campaigns for maximum confidence in decisions on model choice, binary engineering or management decisions, or questions concerning compliance with environmental performance metrics. It is goal oriented, recognizing that different models, questions, or metrics deserve different treatment. We use a formal Bayesian scheme called PreDIA, which is free of linearization, and can handle arbitrary data types, scientific tasks, and sources of uncertainty (e.g., conceptual, physical, (geo)statistical, measurement errors). This reduces the bias due to possibly subjective assumptions prior to data collection and improves the chances of successful field campaigns even under conditions of model uncertainty. We illustrate our approach on two instructive examples from stochastic hydrogeology with increasing complexity.

  7. INFORMATION CAMPAIGNS – MEANS OF COMMUNICATION WITH CUSTOMERS

    Directory of Open Access Journals (Sweden)

    Claudia-Nicoleta Dobrescu

    2014-01-01

    Full Text Available Within a company’s activities, an important role is granted to the performance and implementation of information campaigns for the final consumers. The paper has the general objective to identify specific issues that constitute the premises for the preparation and conduct of such activities, and especially the expected results. The analysis is performed and based on a direct research among several companies, which operate in various fields, for the identification of a method of performance and implementation of information campaigns that are necessary for ensuring visibility on the reference market. The aim of the study was to identify the importance that the firms from Resita give to information campaigns addressed to a target audience. The study was carried from April to May 2013 on a sample of small, medium and large firms, which operate in trade, manufacturing and services. The questions and the discussions addressed to the public were meant to outline the specific aspects of the exact way in which the information campaigns were done for their clients, but also to underline the results obtained with the help of these campaigns.

  8. Massachusetts nuclear power referendum: Lessons learned from the campaign trail

    International Nuclear Information System (INIS)

    Last November, Massachusetts voters cast their ballots on a binding initiative which, if passed, would have prohibited the production of high-level waste, thereby permanently shutting down the state's two nuclear power plants: Yankee and Pilgrim. Question 4, as the initiative became known, posed an unprecedented challenge for the state's six major utilities. Essentially, Question 4 was defeated for two reasons: compelling arguments and a well-founded strategy for communicating those arguments. One part of that strategy was the use of debates and public-speaking engagements before both civic groups and on radio/television. These debates and presentations were clearly the most interesting part of the campaign and provided many insights that may be applied to long-term public policy and informational programs. Obviously, there is a significant difference between an intense, focused campaign and an ongoing, diverse public information program-but many of the principles are the same. The purpose of this paper is to review some of the key lessons learned from over 300 debates and presentations in the highly emotional atmosphere of the Question 4 campaign. Throughout the campaign, debaters and speakers submitted after action reports, and it is from these as well as the overall campaign results that the lessons and anecdotes are derived

  9. impact of six multimodal country-wide campaigns to promote hand hygiene in belgian hospitals

    OpenAIRE

    Fonguh, Sylvanus; Hammami, N; Catry, B; Simon, Anne; ICPIC

    2015-01-01

    Six campaigns sponsored by the Belgian federal government were organized to promote hand hygiene(HH) in Belgian hospitals between 2005 and 2015. The campaigns combined educational sessions for healthcare workers (HCWs), promotion of alcohol-based hand rubs, patient awareness and audits with performance feedback. Each campaign consisted of a pre-campaign data collection period, an awareness period with training and a post-campaign data collection period.

  10. Astrometric Calibration of the Gemini NICI Planet-Finding Campaign

    CERN Document Server

    Hayward, Thomas L; Liu, Michael C; Nielsen, Eric L; Wahhaj, Zahed; Chun, Mark; Ftaclas, Christ; Hartung, Markus; Toomey, Douglas W

    2014-01-01

    We describe the astrometric calibration of the Gemini NICI Planet-Finding Campaign. The Campaign requires a relative astrometric accuracy of $\\approx$ 20 mas across multi-year timescales in order to distinguish true companions from background stars by verifying common proper motion and parallax with their parent stars. The calibration consists of a correction for instrumental optical image distortion, plus on-sky imaging of astrometric fields to determine the pixel scale and image orientation. We achieve an accuracy of $\\lesssim 7$ mas between the center and edge of the 18$''$ NICI field, meeting the 20 mas requirement. Most of the Campaign data in the Gemini Science Archive are accurate to this level but we identify a number of anomalies and present methods to correct the errors.

  11. Buildings and Health. Educational campaign for healthy buildings. Educational material

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    In recent years health and comfort problems associated with the indoor climate have come to constitute a problem in Sweden. To come to grips with this a nationwide educational campaign on Buildings and Health is being run. It is directed to those involved in planning, project design, construction and management of buildings. The objective is to convey a body of knowledge to the many occupational and professional groups in the construction sector on how to avoid indoor climate problems in homes, schools, offices and other workplaces. The campaign is being run by the Swedish National Board of Housing and Planning and the Swedish Council for Building Research, in co-operation with various organizations and companies in the construction industry, and with municipalities and authorities. The knowledge which is being disseminated through the campaign is summarized in this compendium. figs., tabs.

  12. Approach For Investigating Crowdfunding Campaigns With Platform Data

    DEFF Research Database (Denmark)

    Huhtamäki, Jukka; Lasrado, Lester; Menon, Karan;

    2015-01-01

    Crowdfunding via the internet is a relatively new phenomenon in research and gaining momentum currently. While taking a data-driven approach into investigating the properties and dynamics of crowdfunding campaigns would allow the use of computational social science in investigations on crowdfunding......, existing data-driven research on crowdfunding remains very limited. This is particularly true on the level of individual funder data. In this study, we contribute to the empirical body of knowledge on crowdfunding by introducing Indiegogo as a data source and, more specifically, the development and...... implementation of a crawler and scraper for accessing Indiegogo campaign data, and sharing this openly for other researchers. Due to the extremely dynamic and rapidly increasing amount of crowdfunding data in terms of the number of crowdfunding campaigns and the available investment and individual investor data...

  13. The case for periodic OPV routine vaccination campaigns.

    Science.gov (United States)

    Houy, Nicolas

    2016-01-21

    The possibility of periodic routine vaccination campaigns (PRVCs) is introduced in the context of a search for optimal oral poliovirus vaccine (OPV) administration strategies. Like the usual continuous routine vaccination campaign (CRVC), PRVCs target only newborns. However, they are not necessarily implemented continuously in time. Using a dynamic and compartmental polio transmission model in a stochastic context, it is shown that some PRVCs can achieve much greater efficiency than CRVC in terms of probability of wild poliovirus (WPV) eradication, even though they never outperform CRVC in terms of total number of paralytic infections. Moreover, these PRVCs results can be obtained at a lower price than CRVC. It is also shown that, even though PRVCs do not perform better than pulse vaccination campaigns (PVCs) when only epidemiological outputs are valued, they can do so when a cost-benefit analysis is preferred. PMID:26523796

  14. Online Political Campaigning during the 2014 Regional Elections in Poland

    Directory of Open Access Journals (Sweden)

    Paweł Baranowski

    2015-12-01

    Full Text Available This article is dedicated to the analysis and evaluation of political communication on a regional level. Without any doubt, the Internet revolution affected electoral campaigning on every level. Online campaigning before local elections is often marginalized by political scientists and other scholars researching political marketing. However, the question emerges: are the candidates aware of the possibilities that new media has brought to political communication? Content analysis of all the major online communication tools has allowed the author to analyze the patterns of using websites, official Facebook profiles and Twitter accounts of candidates during the 2014 Lower Silesian Regional assembly elections. The Lower Silesian Voivodeship is among the fastest developing regions in Poland with high Internet penetration rate. Is the Internet campaign treated as a second-class way to communicate with potential voters, or is it perceived as an opportunity to reach electorate online?

  15. Exploring Affordances of Social Media Use in Election Campaigns

    DEFF Research Database (Denmark)

    Dyrby, Signe; Jensen, Tina Blegind

    this tendency by posing two research questions: 1) what do political parties perceive as affordances of social media use in their campaign strategy? And 2) how are these affordances reflected in the political parties’ actual actions during the campaign? To address the two questions, we conducted a...... of generating interaction and involvement is limited by their actions as most of them do not engage with the users’ posts and comments. The tensions between perceived affordances and actual use prompt further investigation of what political parties should consider when engaging in social media......In recent years, social media have become omnipresent and highly important for social networking and content sharing. Lately we have witnessed how also political parties adopt social media as part of their political campaign strategy. The purpose of this work-in-progress paper is to investigate...

  16. Shortwave Hyperspectral Observations During MAGIC Final Campaign Summary

    Energy Technology Data Exchange (ETDEWEB)

    McBride, P. J. [Atmospheric Radiation Measurement, Washington, DC (United States); Marshak, A. [Atmospheric Radiation Measurement, Washington, DC (United States); Yang, W. [Atmospheric Radiation Measurement, Washington, DC (United States)

    2016-03-01

    The Marine ARM GPCI1 Investigation of Clouds (MAGIC) field campaign was initiated to improve our understanding of low-level marine clouds that have a significant influence on the Earth’s climate. The campaign was conducted using an ARM mobile facility deployed on a commercial ship traveling between Honolulu, Hawaii, and Los Angeles, California, from October 2012 to September 2013. The solar spectral flux radiometer (SSFR) was deployed on July 6, 2013, through the end of the campaign. The SSFR was calibrated and installed by Warren Gore of NASA Ames Research Center, and the data is and will be analyzed by Drs. Alexander Marshak and Weidong Yang of NASA Goddard Space Flight Center, Dr. Samuel LeBlanc of NASA Ames Research Center, Dr. Sebastian Schmidt of the University of Colorado-Boulder, and Dr. Patrick McBride of Atmospheric & Space Technology Research Associates in Boulder, Colorado.

  17. The Strategy and Implementation of the Rosetta Communication Campaign

    Science.gov (United States)

    Bauer, M.; McCaughrean, M.; Landeau-Constantin, J.

    2016-03-01

    The communication campaign for Rosetta has been the biggest success in the history of European Space Agency outreach, resulting in global awareness for the agency. The mission itself is an extraordinary operational and scientific success, but communicating only the operational and scientific firsts would likely not have brought the Rosetta orbiter and Philae lander to the attention of so many people, and would not have made the mission part of people's lives across the globe. The additional impact brought to the mission through the communication campaign was based on a strategic approach focusing on: real-time release of information with maximum transparency; direct real-time access for media and social media; adding a human dimension to the story; and communicating the risks openly in order to manage expectations. In this article we describe our overall strategy, illustrate its implementation, and provide the framework for subsequent articles in this journal highlighting specific aspects of the campaign in more detail.

  18. Radiation exposure control during EMCCR campaign at MAPS

    International Nuclear Information System (INIS)

    Enmasse Coolant Channel Replacement (EMCCR) work is second of its kind for Indian PHWR- next to RAPS - 2 campaign- after successful demonstration of ability by NPCIL to carry out such major core component maintenance. The Challenges posed during such campaign are mainly attributed to the radiation field, continuous occupancy, and large quantity of material handling for execution as well as preparing infrastructure, exposure control for large number of workmen. Extensive planning was carried out to address all these issues in order to reduce the downtime of the station keeping the collective dose as low as reasonable achievable (ALARA). This paper highlights the strategy adopted, logistics involved in execution of work and the efforts taken to control radiation exposure during this major campaign. (author)

  19. Update of the Used Fuel Disposition Campaign Implementation Plan

    Energy Technology Data Exchange (ETDEWEB)

    Jens Birkholzer; Robert MacKinnon; Kevin McMahon; Sylvia Saltzstein; Ken Sorenson; Peter Swift

    2014-09-01

    This Campaign Implementation Plan provides summary level detail describing how the Used Fuel Disposition Campaign (UFDC) supports achievement of the overarching mission and objectives of the Department of Energy Office of Nuclear Energy Fuel Cycle Technologies Program The implementation plan begins with the assumption of target dates that are set out in the January 2013 DOE Strategy for the Management and Disposal of Used Nuclear Fuel and High-Level Radioactive Waste (http://energy.gov/downloads/strategy-management-and-disposal-used-nuclear-fuel-and-high-level-radioactive-waste). These target dates and goals are summarized in section III. This implementation plan will be maintained as a living document and will be updated as needed in response to progress in the Used Fuel Disposition Campaign and the Fuel Cycle Technologies Program.

  20. Clean Air for London (CLEARFLO) Final Campaign Summary

    Energy Technology Data Exchange (ETDEWEB)

    Worsnop, D. R. [Aerodyne Research, Inc., Billerica, MA (United States); Williams, L. R. [Aerodyne Research, Inc., Billerica, MA (United States); Herndon, S. C. [Aerodyne Research, Inc., Billerica, MA (United States); Dubey, M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Ng, N. L. [Georgia Inst. of Technology, Atlanta, GA (United States); Thornton, J. [Univ. of Washington, Seattle, WA (United States); Knighton, B. [Montana State Univ., Bozeman, MT (United States); Coulter, R. [Argonne National Lab. (ANL), Argonne, IL (United States); Prévôt, Ash [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2016-03-01

    This field campaign funded the participation of scientists from seven different research groups and operated over thirty instruments during the Winter Intensive Operating Period (January-February 2012) of the Clean Air for London (ClearfLo) campaign. The campaign took place at a rural site in Detling, UK, 45 kilometers southeast of central London. The primary science questions for the ClearfLo winter IOP (intensive operational periods) were: 1) “what is the urban increment of particulate matter (PM) and other pollutants in the greater London area?” and 2) “what is the contribution of solid fuel use for home heating to wintertime PM?” An additional motivation for the Detling measurements was the question of whether coatings on black carbon particles enhance absorption.

  1. Erosion at the inner wall of JET during the discharge campaign 2011–2012 in comparison with previous campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Krat, S. [National Research Nuclear University “MEPhI”, Moscow Kashirskoe shosse 31, 115409 (Russian Federation); Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Gasparyan, Yu; Pisarev, A. [National Research Nuclear University “MEPhI”, Moscow Kashirskoe shosse 31, 115409 (Russian Federation); Bykov, I. [Fusion Plasma Physics, Royal Institute of Technology (KTH), Teknikringen 31, Stockholm 10044 (Sweden); Mayer, M., E-mail: matej.mayer@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Saint Aubin, G. de; Balden, M. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Lungu, C.P. [NILPRP, Association EURATOM-MEdC, Bucharest (Romania); Widdowson, A. [Culham Science Centre, EURATOM/UKAEA – Fusion Association, Abingdon, Oxfordshire OX14 3DB (United Kingdom)

    2015-01-15

    The erosion of Be and W marker layers was investigated using long-term samples during the first ITER-like wall discharge campaign 2011–2012. The markers were mounted in Be coated Inconel tiles between the inner wall guard limiters (IWGL). They were analyzed using Rutherford backscattering (RBS) before and after exposure. All samples showed strong erosion. The results were compared to the data for Be and W erosion rates for the 2005–2009 and the 2001–2004 campaigns, respectively, when JET was operated with a carbon wall. In 2005–2009 Be and C samples were used, and W samples were used in 2001–2004. The mean W erosion rates and the toroidal and poloidal distributions of the W erosion were the same for the 2001–2004 and the 2011–2012 campaigns. The mean erosion rate of Be during the 2011–2012 campaign was smaller by a factor of about two compared to the 2005–2009 campaign and showed a different poloidal distribution. The mean erosion rate of the inner JET ITER-like wall was about 4–5 times smaller than the mean erosion rate of the carbon wall.

  2. Campaigns and cliques: variations in effectiveness of an antismoking campaign as a function of adolescent peer group identity.

    Science.gov (United States)

    Moran, Meghan Bridgid; Murphy, Sheila T; Sussman, Steve

    2012-01-01

    Identity-based strategies have been suggested as a way to promote healthy behaviors when traditional approaches fall short. The truth® campaign, designed to reduce smoking in adolescents, is an example of a campaign that uses such a strategy to reach youth described as being outside the mainstream. This article examines the effectiveness of this strategy in promoting antitobacco company beliefs among youth. Survey data from 224 adolescents between 14 and 15 years of age were used to examine whether the truth® campaign was more or less effective at reaching and promoting antitobacco company beliefs among youth who identify with nonmainstream crowds (deviants and counterculture) versus those who identify with mainstream crowds (elites and academics). Analyses revealed that adolescents who identified as deviants and counterculture were more likely to have been persuaded by the truth® campaign. Social identity theory is used as a theoretical framework to understand these effects and to make recommendations for future health campaigns. PMID:23066900

  3. Revisiting the Effect of Anthropomorphizing a Social Cause Campaign.

    Directory of Open Access Journals (Sweden)

    Lisa A Williams

    Full Text Available Recent research suggests that anthropomorphism can be harnessed as a tool to boost intentions to comply with social cause campaigns. Drawing on the human tendency to extend moral concern to entities portrayed as humanlike, it has been argued that adding personified features to a social campaign elevates anticipated guilt at failing to comply, and this subsequently boosts intentions to comply with that campaign. The present research aimed to extend extant research by disentangling the effects of emotional and non-emotional anthropomorphism, and differentiating amongst other emotional mechanisms of the anthropomorphism-compliance effect (namely, anticipated pride and anticipated regret. Experiment 1 (N = 294 compared the effectiveness of positive, negative, and emotionally-neutral anthropomorphized campaign posters for boosting campaign compliance intentions against non-anthropomorphized posters. We also measured potential mechanisms including anticipated guilt, regret, and pride. Results failed to support the anthropomorphism-compliance effect, and no changes in anticipated emotion according to anthropomorphism emerged. Experiments 2 (N = 150 and 3 (N = 196 represented further tests of the anthropomorphism-compliance effect. Despite high statistical power and efforts to closely replicate the conditions under which the anthropomorphism-compliance effect had been previously observed, no differences in compliance intention or anticipated emotion according to anthropomorphism emerged. A meta-analysis of the effects of anthropomorphism on compliance and anticipated emotion across the three experiments revealed effect size estimates that did not differ significantly from zero. The results of these three experiments suggest that the anthropomorphism-compliance effect is fragile and perhaps subject to contextual and idiographic influences. Thus, this research provides important insight and impetus for future research on the applied and theoretical

  4. Effects of a guerrilla advertising campaign on brand associations

    OpenAIRE

    Salonen, Marjaana

    2015-01-01

    The purpose of the thesis was to find out what immediate effects a guerrilla advertising campaign planned and carried out by a group of JAMK business students would have on the strength and favorability of the MakuLaku brand among Finnish grocery store customers. The thesis was assigned by JAMK. Several groups of students were tasked with designing a guerrilla advertisement campaign for the partner company MakuLaku Lakritsa Oy Ltd. as part of a marketing communications course. Out of all t...

  5. Network Analysis of Recurring YouTube Spam Campaigns

    OpenAIRE

    O'Callaghan, Derek; Harrigan, Martin; Carthy, Joe; Cunningham, Pádraig

    2012-01-01

    As the popularity of content sharing websites such as YouTube and Flickr has increased, they have become targets for spam, phishing and the distribution of malware. On YouTube, the facility for users to post comments can be used by spam campaigns to direct unsuspecting users to bogus e-commerce websites. In this paper, we demonstrate how such campaigns can be tracked over time using network motif profiling, i.e. by tracking counts of indicative network motifs. By considering all motifs of up ...

  6. Do anti-smoking media campaigns help smokers quit?

    OpenAIRE

    Popham, W J; Potter, L D; Bal, D G; Johnson, M.D.; Duerr, J M; Quinn, V.

    1993-01-01

    As part of an evaluation of the 1990-91 anti-tobacco media campaign carried out by the California Department of Health Services, a study was conducted among 417 regular smokers who had quit during the period of the media campaign. In brief telephone interviews, all respondents identified up to three events or experiences that had influenced them to quit. In response to uncued questions, 6.7 percent of those interviewed indicated that they had been influenced to quit by an advertisement they h...

  7. RFI and SMOS: Preparatory campaigns and first observations from space

    DEFF Research Database (Denmark)

    Balling, Jan E.; Søbjærg, Sten Schmidl; Kristensen, Steen Savstrup;

    2010-01-01

    In support of the ESA Soil Moisture and Ocean Salinity (SMOS) mission, a number of campaigns, including airborne L-band radiometer measurements, have been carried out. The radiometer used in this context is fully polarimetric and has built-in Radio Frequency Interference (RFI) detection capabilit......In support of the ESA Soil Moisture and Ocean Salinity (SMOS) mission, a number of campaigns, including airborne L-band radiometer measurements, have been carried out. The radiometer used in this context is fully polarimetric and has built-in Radio Frequency Interference (RFI) detection...

  8. The British Nuclear Industry Forum's public affairs campaign

    International Nuclear Information System (INIS)

    Full text: In March 1999, BNIF launched a public affairs Campaign with the objective of influencing the views of opinion formers - particularly in the political field - about the case for nuclear energy as a long-term, sustainable component of the UK's energy mix. The Campaign was launched to BNIF's 70 member companies under the slogan, Profiting through Partnership - By Changing the Climate of Opinion. That slogan was chosen to emphasise a key feature of the Campaign approach, which is the importance of an industry speaking collectively with one voice, but with each individual company actively playing its part by spreading the industry's messages to their own local and regional audiences - Members of Parliament, local politicians, local media - to build a groundswell of support for the eventual renewal of nuclear energy in the UK. Our aim was to place the prospect of a new nuclear power station firmly on the political agenda during the lifetime of the next Parliament - that is, in the period 2002-2007. The Campaign was launched at a time when a few encouraging signs were emerging of a growing recognition in Government, Parliament, and in academic and scientific circles that nuclear energy has an important role to play in meeting the energy and environmental challenges of the 21st century. The challenge, in particular, of climate change and the UK Government's commitment to reduce greenhouse gas emissions undertaken at Kyoto and in its election manifesto, gave the industry a strong, positive issue on which to campaign. However, we fully recognised that to make a convincing case for nuclear energy we would also have to address the issues of concern and doubt in the minds of the public and politicians - economic competitiveness, waste management, transport and decommissioning. During the year, BNIF produced a range of Campaign materials, made submissions to several Government and other inquiries and consultations, organised events, meetings and discussions, all with

  9. Materials Compatibility and Lubricants Research on CFC-refrigerant substitutes. Quarterly MCLR Program technical progress report, July 1--September 30, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.; Amrane, K.

    1995-10-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. This report summarizes the research conducted during the third quarter of calendar year 1995 on the following projects: Thermophysical properties of HCFC alternatives; Compatibility of manufacturing process fluids with HFC refrigerants and ester lubricants; Compatibility of motor materials used in air-conditioning for retrofits with alternative refrigerants and lubricants; Compatibility of lubricant additives with HFC refrigerants and synthetic lubricants; Products of motor burnouts; Accelerated test methods for predicting the life of motor materials exposed to refrigerant-lubricant mixtures; Investigation of flushing and clean-out methods; Investigation into the fractionation of refrigerant blends; Lean flammability limits as a fundamental refrigerant property; Effect of selected contaminants in AC and R equipment; Study of foaming characteristics; Study of lubricant circulation in systems; Evaluation of HFC-245ca for commercial use in low pressure chillers; Infrared analysis of refrigerant mixtures; Refrigerant database; Refrigerant toxicity survey; Thermophysical properties of HFC-32, HFC-123, HCFC-124 and HFC-125; Thermophysical properties of HFC-143a and HFC-152a; Theoretical evaluations of R-22 alternative fluids; Chemical and thermal stability of refrigerant-lubricant mixtures with metals; Miscibility of lubricants with refrigerants; Viscosity, solubility and density measurements of refrigerant-lubricant mixtures; Electrohydrodynamic enhancement of pool and in-tube boiling of alternative refrigerants; Accelerated screening methods; and more.

  10. Optimizing Field Campaigns Using A Hypothesis Testing Framework

    Science.gov (United States)

    Harken, B. J.; Over, M. W.; Rubin, Y.

    2012-12-01

    Field campaigns in hydrogeology often aim to characterize aquifers for modeling and predicting flow and transport of contaminants to facilitate in some objective related to environmental protection or public health and safety. Many times these objectives depend on predicting the answer to a yes/no question, such as: will contaminant concentration in an aquifer surpass a threshold value? Will a contaminant reach a river outflow before it degrades? Is water from an extraction well safe for consumption? It remains difficult, however, to predict the extent to which a field campaign will improve modeling and prediction efforts or the chance of success in the original objective. Presented here is a method for designing field campaigns around the original objective by posing it in a hypothesis testing framework and optimizing campaigns with minimizing probability of error as the goal. The first step in this process is to formulate the null and alternative hypotheses, which represent the two possible outcomes of the yes/no question in the objective. The alternative hypothesis is the desirable outcome which requires a specified level of certainty to be accepted. The null hypothesis, on the other hand, is the "safe" fallback assumption, which is accepted if the alternative hypothesis lacks sufficient supporting evidence. Of key concern in designing field campaigns is the probability of making an error (Type I or Type II). A level of significance is chosen based on the severity of each type of error and the level of risk that is considered acceptable for each case. A field campaign can then be designed to gain enough information to reduce the probability of error to the acceptable level while expending as few resources as possible. A case study examined here is attempting to predict the arrival time of a contaminant in an aquifer. A scenario is first established in which a contaminant is travelling from a point source to a control plane, which could represent, for example, a

  11. ESA airborne campaigns in support of Earth Explorers

    Science.gov (United States)

    Casal, Tania; Davidson, Malcolm; Schuettemeyer, Dirk; Perrera, Andrea; Bianchi, Remo

    2013-04-01

    In the framework of its Earth Observation Programmes the European Space Agency (ESA) carries out ground based and airborne campaigns to support geophysical algorithm development, calibration/validation, simulation of future spaceborne earth observation missions, and applications development related to land, oceans and atmosphere. ESA has been conducting airborne and ground measurements campaigns since 1981 by deploying a broad range of active and passive instrumentation in both the optical and microwave regions of the electromagnetic spectrum such as lidars, limb/nadir sounding interferometers/spectrometers, high-resolution spectral imagers, advanced synthetic aperture radars, altimeters and radiometers. These campaigns take place inside and outside Europe in collaboration with national research organisations in the ESA member states as well as with international organisations harmonising European campaign activities. ESA campaigns address all phases of a spaceborne missions, from the very beginning of the design phase during which exploratory or proof-of-concept campaigns are carried out to the post-launch exploitation phase for calibration and validation. We present four recent campaigns illustrating the objectives and implementation of such campaigns. Wavemill Proof Of Concept, an exploratory campaign to demonstrate feasibility of a future Earth Explorer (EE) mission, took place in October 2011 in the Liverpool Bay area in the UK. The main objectives, successfully achieved, were to test Astrium UKs new airborne X-band SAR instrument capability to obtain high resolution ocean current and topology retrievals. Results showed that new airborne instrument is able to retrieve ocean currents to an accuracy of ± 10 cms-1. The IceSAR2012 campaign was set up to support of ESA's EE Candidate 7,BIOMASS. Its main objective was to document P-band radiometric signatures over ice-sheets, by upgrading ESA's airborne POLARIS P-band radar ice sounder with SAR capability. Campaign

  12. Process Control Plan for 242A Evaporator Campaign

    Energy Technology Data Exchange (ETDEWEB)

    LE, E.Q.

    2000-04-06

    The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms.

  13. Functional brain imaging predicts public health campaign success.

    Science.gov (United States)

    Falk, Emily B; O'Donnell, Matthew Brook; Tompson, Steven; Gonzalez, Richard; Dal Cin, Sonya; Strecher, Victor; Cummings, Kenneth Michael; An, Lawrence

    2016-02-01

    Mass media can powerfully affect health decision-making. Pre-testing through focus groups or surveys is a standard, though inconsistent, predictor of effectiveness. Converging evidence demonstrates that activity within brain systems associated with self-related processing can predict individual behavior in response to health messages. Preliminary evidence also suggests that neural activity in small groups can forecast population-level campaign outcomes. Less is known about the psychological processes that link neural activity and population-level outcomes, or how these predictions are affected by message content. We exposed 50 smokers to antismoking messages and used their aggregated neural activity within a 'self-localizer' defined region of medial prefrontal cortex to predict the success of the same campaign messages at the population level (n = 400,000 emails). Results demonstrate that: (i) independently localized neural activity during health message exposure complements existing self-report data in predicting population-level campaign responses (model combined R(2) up to 0.65) and (ii) this relationship depends on message content-self-related neural processing predicts outcomes in response to strong negative arguments against smoking and not in response to compositionally similar neutral images. These data advance understanding of the psychological link between brain and large-scale behavior and may aid the construction of more effective media health campaigns. PMID:26400858

  14. U.S. Campaign Advertises American Higher Education in China

    Science.gov (United States)

    McMurtrie, Beth

    2007-01-01

    A marketing campaign intended to persuade Chinese students to study in the United States will soon branch out to other parts of the globe. The U.S.-led program, which includes slick television commercials and a one-stop-shopping Web portal, was introduced in China last fall. The commercials, which run about 30 minutes and were filmed on American…

  15. 1991 National campaign to increase safety belt usage.

    NARCIS (Netherlands)

    National Highway Traffic Safety Administration NHTSA

    1992-01-01

    The central theme of this paper is the national campaign of the USA to be conducted in 1991 and 1992, in order to reach the goal of 70 percent safety belt usage by 1992. Among other things, it is shown that visible enforcement of existing laws offers the greatest potential for achieving this goal. F

  16. 78 FR 34109 - ``Script Your Future'' Medication Adherence Campaign

    Science.gov (United States)

    2013-06-06

    ... HUMAN SERVICES Food and Drug Administration ``Script Your Future'' Medication Adherence Campaign AGENCY: Food and Drug Administration, HHS. ACTION: Notice. SUMMARY: The Food and Drug Administration (FDA) is...) called ``Script Your Future''. To continue and enhance this important public health initiative,...

  17. Shock Timing Plan for the National Ignition Campaign

    Science.gov (United States)

    Munro, D. H.; Robey, H. F.; Spears, B. K.; Boehly, T. R.

    2006-10-01

    We report progress on the design of the shock timing tuning procedure for the 2010 ignition campaign at the National Ignition Facility. Our keyhole target design provides adequate drive surrogacy for us to time the first three shocks empirically. The major risk to our plan is hard x-ray preheat, which can cause the diagnostic window to become opaque.

  18. Analysis of water from K west basin canisters (second campaign)

    Energy Technology Data Exchange (ETDEWEB)

    Trimble, D.J., Fluor Daniel Hanford

    1997-03-06

    Gas and liquid samples have been obtained from a selection of the approximately 3,820 spent fuel storage canisters in the K West Basin. The samples were taken to characterize the contents of the gas and water in the canisters. The data will provide source term information for two subprojects of the Spent Nuclear Fuel Project (SNFP) (Fulton 1994): the K Basins Integrated Water Treatment System subproject (Ball 1996) and the K Basins Fuel Retrieval System subproject (Waymire 1996). The barrels of ten canisters were sampled in 1995, and 50 canisters were sampled in a second campaign in 1996. The analysis results for the gas and liquid samples of the first campaign have been reported (Trimble 1995a; Trimble 1995b; Trimble 1996a; Trimble 1996b). An analysis of cesium-137 (137CS ) data from the second campaign samples was reported (Trimble and Welsh 1997), and the gas sample results are documented in Trimble 1997. This report documents the results of all analytes of liquid samples from the second campaign.

  19. 5 CFR 950.401 - Campaign and publicity information.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Campaign and publicity information. 950.401 Section 950.401 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) SOLICITATION OF FEDERAL CIVILIAN AND UNIFORMED SERVICE PERSONNEL FOR CONTRIBUTIONS TO PRIVATE VOLUNTARY...

  20. Thai Electoral Campaigning: Vote-Canvassing Networks and Hybrid Voting

    Directory of Open Access Journals (Sweden)

    Anyarat Chattharakul

    2010-01-01

    Full Text Available Based on evidence gathered through participant observation, this article illuminates the nature of vote-canvassing, previously a black box in Thai electoral studies. Offering a close-up study of the internal mechanisms of an individual Thai election campaign, this article reveals that vote-canvasser networks are underpinned by long-term dyadic relationships, both hierarchical and horizontal, between the candidate, vote-canvassers and voters. These networks continue to be the most important factor in winning elections. This article documents how candidates draw up an election campaign map and identify voters along residential lines to maximise their vote-canvassing strategy. The findings of this article challenge Anek’s 1996 concept of “two democracies”, which argues that rural voters are influenced by money, local leaders, political factions and corrupt politicians while more well-educated, urban, middle-class voters are more oriented toward the alternative policies offered by competing parties. The case study of Kom’s election campaign showed that the role of the much-vaunted middle-class voters is not decisive, even in suburban areas of Bangkok. While political marketing has grown in importance in Thai elections, it has not displaced traditional electoral practices. Thai society is, in fact, deeply fragmented and diverse – too complex to be divided in such a simplistic manner. This article suggests that rather than undergoing a linear transformation, political hybridisation is a key trend in Thai election campaigns.

  1. The Bolund experiment - design of measurement campaign using CFD

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Johansen, Jeppe; Sørensen, Niels N.

    upcoming measurement campaign. The simulation results are used for estimating rational positions of measuring masts and instrumentation. A total of ten measuring masts are proposed consisting of two 16 m masts, six 9 m masts and two 5 m masts. The masts are instrumented with 12 cup anemometers for mean...

  2. Campaign to gather medical devices containing radium: results

    International Nuclear Information System (INIS)

    Campaign to gather medical devices containing radium: results. On December 1, 1999, at the request of the French Health Ministry, OPRI and ANDRA launched a campaign to gather medical devices containing radium, formerly used in brachytherapy. This campaign addressed a public health issue because of the risks actually involved in a careless handling of these objects. Moreover the growing number of reported scattered radium medical devices in the last few years reinforced the necessity of the campaign. The gathering was initiated by a call of the owners (hospitals, caring centers, retired doctors or their heirs) to a toll free number. OPRI or ANDRA then appreciated the situation urgency. Priority was given to private people because most of them did not have suitable storage facilities. OPRI teams operated according a strict protocol guaranteeing their own safety, proper procedures and compliance with transport regulations for radioactive materials. 517 objects amounting to an activity of 1.32 x 1011 Bq have been gathered in 90 operations. Properly packaged they were transported to and safely stored at the CEA Saclay site before their permanent storage in the ANDRA facilities. (author)

  3. A New Look at the Literacy Campaign in Cuba.

    Science.gov (United States)

    Kozol, Jonathan

    1978-01-01

    Based on interviews in Cuba and publications generally unavailable in the U.S., author examines history and success of Cuban literacy campaign. Outlines logistical/pedagogical challenges; describes recruitment and training of volunteer teachers and development of instructional methods. Concludes with case studies illustrating application of Paulo…

  4. Mass Media Campaign Impacts Influenza Vaccine Obtainment of University Students

    Science.gov (United States)

    Shropshire, Ali M.; Brent-Hotchkiss, Renee; Andrews, Urkovia K.

    2013-01-01

    Objective: To describe the effectiveness of a mass media campaign in increasing the rate of college student influenza vaccine obtainment. Participants/Methods: Students ("N" = 721) at a large southern university completed a survey between September 2011 and January 2012 assessing what flu clinic media sources were visualized and if they…

  5. Managing Dog Waste: Campaign Insights from the Health Belief Model

    Science.gov (United States)

    Typhina, Eli; Yan, Changmin

    2014-01-01

    Aiming to help municipalities develop effective education and outreach campaigns to reduce stormwater pollutants, such as pet waste, this study applied the Health Belief Model (HBM) to identify perceptions of dog waste and corresponding collection behaviors from dog owners living in a small U.S. city. Results of 455 online survey responses…

  6. Wind turbine and actuator disc wake: Two experimental campaigns

    NARCIS (Netherlands)

    Lignarolo, L.; Ragni, D.; Simao Ferreira, C.J.; van Bussel, G.J.W.

    2015-01-01

    The present paper is the summary of 3 years of research on the wake aerodynamics of horizontal axis wind turbine at Delft University of Technology, the Netherlands. In particular, the main results and the conclusions of two experimental campaigns are collected. The underlying research question is: h

  7. Structure versus level: A unified approach to campaign evaluation

    DEFF Research Database (Denmark)

    Scholderer, Joachim; Grunert, Klaus G.

    2001-01-01

    Based on a modified version of the theory of planned behavior (Ajzen, 1985), a general model for the evaluation of social interventions is developed. Whilst common practice defines campaign success in terms of absolute levels of the target variables, the present approach stresses changes...

  8. Process Control Plan for 242-A Evaporator Campaign

    International Nuclear Information System (INIS)

    The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms

  9. Search Engine Advertising Effectiveness in a Multimedia Campaign

    NARCIS (Netherlands)

    Zenetti, German; Bijmolt, Tammo H. A.; Leeflang, Peter S. H.; Klapper, Daniel

    2014-01-01

    Search engine advertising has become a multibillion-dollar business and one of the dominant forms of advertising on the Internet. This study examines the effectiveness of search engine advertising within a multimedia campaign, with explicit consideration of the interaction effects between search eng

  10. 5 CFR 734.205 - Participation in political campaigns.

    Science.gov (United States)

    2010-01-01

    ... Environmental Protection Agency may broadcast endorsements for a partisan political candidate via a public... factual material about a partisan political candidate. However, should a member of the public stop the... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in political campaigns....

  11. EARLINET instrument intercomparison campaigns: overview on strategy and results

    Science.gov (United States)

    Wandinger, Ulla; Freudenthaler, Volker; Baars, Holger; Amodeo, Aldo; Engelmann, Ronny; Mattis, Ina; Groß, Silke; Pappalardo, Gelsomina; Giunta, Aldo; D'Amico, Giuseppe; Chaikovsky, Anatoli; Osipenko, Fiodor; Slesar, Alexander; Nicolae, Doina; Belegante, Livio; Talianu, Camelia; Serikov, Ilya; Linné, Holger; Jansen, Friedhelm; Apituley, Arnoud; Wilson, Keith M.; de Graaf, Martin; Trickl, Thomas; Giehl, Helmut; Adam, Mariana; Comerón, Adolfo; Muñoz-Porcar, Constantino; Rocadenbosch, Francesc; Sicard, Michaël; Tomás, Sergio; Lange, Diego; Kumar, Dhiraj; Pujadas, Manuel; Molero, Francisco; Fernández, Alfonso J.; Alados-Arboledas, Lucas; Bravo-Aranda, Juan Antonio; Navas-Guzmán, Francisco; Guerrero-Rascado, Juan Luis; José Granados-Muñoz, María; Preißler, Jana; Wagner, Frank; Gausa, Michael; Grigorov, Ivan; Stoyanov, Dimitar; Iarlori, Marco; Rizi, Vincenco; Spinelli, Nicola; Boselli, Antonella; Wang, Xuan; Lo Feudo, Teresa; Perrone, Maria Rita; De Tomasi, Ferdinando; Burlizzi, Pasquale

    2016-03-01

    This paper introduces the recent European Aerosol Research Lidar Network (EARLINET) quality-assurance efforts at instrument level. Within two dedicated campaigns and five single-site intercomparison activities, 21 EARLINET systems from 18 EARLINET stations were intercompared between 2009 and 2013. A comprehensive strategy for campaign setup and data evaluation has been established. Eleven systems from nine EARLINET stations participated in the EARLINET Lidar Intercomparison 2009 (EARLI09). In this campaign, three reference systems were qualified which served as traveling standards thereafter. EARLINET systems from nine other stations have been compared against these reference systems since 2009. We present and discuss comparisons at signal and at product level from all campaigns for more than 100 individual measurement channels at the wavelengths of 355, 387, 532, and 607 nm. It is shown that in most cases, a very good agreement of the compared systems with the respective reference is obtained. Mean signal deviations in predefined height ranges are typically below ±2 %. Particle backscatter and extinction coefficients agree within ±2 × 10-4 km-1 sr-1 and ± 0.01 km-1, respectively, in most cases. For systems or channels that showed larger discrepancies, an in-depth analysis of deficiencies was performed and technical solutions and upgrades were proposed and realized. The intercomparisons have reinforced confidence in the EARLINET data quality and allowed us to draw conclusions on necessary system improvements for some instruments and to identify major challenges that need to be tackled in the future.

  12. DOMECair: An Airborne Campaign in Antarctica Supporting SMOS Calibration

    DEFF Research Database (Denmark)

    Skou, Niels; Kristensen, Steen Savstrup; Søbjærg, Sten Schmidl; Balling, Jan E.

    2013-01-01

    In search for a stable, well characterized terrestrial calibration target for SMOS, an airborne campaign was carried out in January 2013 over the Dome C area of Antarctica, and the surface was measured by an L-band radiometer. The focus was on homogeneity, and an area of 350 × 350 km around the...

  13. Cross-Language System Evaluation: The CLEF Campaigns.

    Science.gov (United States)

    Peters, Carol; Braschler, Martin

    2001-01-01

    Describes the goals of the CLEF (Cross-Language Evaluation Forum) series of evaluation campaigns for information retrieval systems operating on European languages. Examines the difficulties of organizing an activity which aims at an objective evaluation of systems running on and over a number of different languages. (Author/LRW)

  14. Recruiting New Teachers: Campaign Response 1988-1992. Executive Summary.

    Science.gov (United States)

    Harris, Louis

    This study evaluated the impact of a public service advertising campaign conducted for Recruiting New Teachers, Inc (RNT). The study surveyed a national sample of 2,750 individuals who called the RNT toll-free number mentioned in public service advertising and returned information about their educational background and teaching interests. The…

  15. Message Testing to Create Effective Health Communication Campaigns

    Science.gov (United States)

    Domigan, Juliane; Glassman, Tavis J.; Miller, Jeff; Hug, Heather; Diehr, Aaron J.

    2015-01-01

    Purpose: The purpose of this paper was to assess a health communication campaign designed to reduce distracted driving among college students within the USA. Design/methodology/approach: Utilizing central interviewing techniques, participants were asked qualitative and quantitative items soliciting feedback concerning the efficacy of the messages.…

  16. Overview of the 2011 Draconids airborne observation campaign

    Czech Academy of Sciences Publication Activity Database

    Vaubaillon, J.; Koten, Pavel; Rudawska, R.; Bouley, S.; Maquet, L.; Colas, F.; Toth, J.; Zender, J.; McAuliffe, J.; Pautet, D.; Jenniskens, P.; Gerding, M.; Borovička, Jiří; Koschny, D.; Leroy, A.; Lecacheux, J.; Gritsevich, M.; Ďuriš, F.

    Howe: International Meteor Organization, 2013 - (Gyssens, M.), s. 61-64 ISBN 978-2-87355-024-4. [International Meteor Conference. La Palma, Canary Islands, (ES), 20.09.2012-23.09.2012] R&D Projects: GA ČR GA205/09/1302 Institutional support: RVO:67985815 Keywords : draconids * observation campaign Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  17. 242-A campaign 95-1 post run document

    International Nuclear Information System (INIS)

    The 242-A Evaporator Campaign 95-1 was started on June 6, 1995 and finished July 27, 1995. An overall Waste Volume Reduction (WVR) of 8.18 million liters (2.16 mGAL OR 87.6% WVRF) was achieved from 9.35 million liters (2.47 Mgal) of processable waste contained in 108-AP, 107-AP, 106-AW and 102-AW. Slurry generated from Campaign 95-1 consisted of 1.05 million liters (278,000 gal) of dilute double-shell slurry feed (DDSSF) with a SpG of approximately 1.34. Total process condensate discharged to LERF was 10.3 million liters (2.72 Mgal), achieving a condensate/WVR efficiency ratio of 1.26. Total throughout for Campaign 95-1 was 18.1 million liters (4.79 Mgal). B Pond discharges from steam condensate and cooling water were 15.8 and 583 million liters (4.17 and 154 Mgal) respectively. Based on 145 hours of unplanned downtime, the 242-A Evaporator maintained an operating efficiency of 86% during the 49 day campaign

  18. IBMMS DECISION SUPPORT TOOL FOR MANAGEMENT OF BANK TELEMARKETING CAMPAIGNS

    Directory of Open Access Journals (Sweden)

    Ali KELES

    2015-10-01

    Full Text Available Although direct marketing is a good method for banks to utilize in the face of global competition and the financial crisis, it has been shown to exhibit poor performance. However, there are some drawbacks to direct campaigns, such as those related to improving the negative attributes that customers ascribe to banks. To overcome these problems, attractive long-term deposit campaigns should be organized and managed more effectively. The aim of this study is to develop an Intelligent Bank Market Management System (IBMMS for bank managers who want to manage efficient marketing campaigns. IBMMS is the first system developed by combining the power of data mining with the capabilities of expert systems in this area. Moreover, IBMMS includes important features that enable it to be intelligent: a knowledge base, an inference engine and an advisor. Using this system, a manager can successfully direct marketing campaigns and follow the decision schemas of customers both as individuals and as a group; moreover, a manager can make decisions that lead to the desired response by customers.

  19. Eifel field operation campaign supporting Moon Mars and NEO exploration

    Science.gov (United States)

    Kamps, Oscar; Foing, Bernard H.; Offringa, Marloes

    2016-07-01

    As follow-up on the 2009 Eifel field campaign new field tests with our ExoGeoLab lander were conducted in November 2015 and February 2016. The two phase campaign was used to test the usability of a mock-up lander as test bench for experiments and its remote control in a Moon, Mars analogue environment. In a real mission such a lander could be used in a robotic or manned mission as scientific tool for scientists on Earth to do preliminary study on in-situ collected rocks. This could be useful for example for a sample return mission where scientists on Earth can determine if sample is interesting enough for a more detailed study. The prototype lander is one of the components of the ExoGeoLab project from ESA and ILEWG. Several student projects have prepared the lander for a geological field campaign in lunar and Martian analogue terrain. The lander can be divided in three sections which are used to store several components of the lander. The lower compartment can be used to store a rover or used as laboratory. The middle compartment is used for the lander computer(s), spectrometers and the associated cables. The top plate is used for a telescope which in our case is used to observe the environment around the lander and to guide astronauts during their EVA. As closest volcanic are there is chosen to do the Eifel area, Germany. Several stages of volcanism from Devon till Quaternary resulted in a variation of rocks which is analogue to volcanic rocks from Moon, Mars and other near Earth objects. Several topics we would like to test were pre-defined. Functional tests and demo were performed at European astronaut centre prior to the campaign. The latest updates with respect to the remote control were tested. The pressurised transport vehicle was equipped as remote base for (scientific) support during the campaign. The new instrument set-up were tested and some spectra were measured on collected rocks. The telescope was used to study the environment around the lander

  20. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    OpenAIRE

    Francisco Marton Gleuson Pinheiro; José Maria Dias Filho; Raimundo Nonato Lima Filho; Laerson Morais Silva Lopes

    2013-01-01

    This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE) from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified in...

  1. Coordinated Airborne Studies in the Tropics (CAST) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Vaughan, Geraint [Univ. of Manchester (United Kingdom)

    2016-05-01

    The last field campaign held at the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility site on Manus Island, Papua New Guinea (PNG), was conducted in February 2014 as part of the Co-ordinated Airborne Studies in the Tropics (CAST) campaign. This campaign was a collaboration between the National Aeronautics and Space Administration (NASA), National Center for Atmospheric Research (NCAR), and the United Kingdom’s (UK) Natural Environment Research Council (NERC) to study the composition of the Tropical Tropopause Layer (TTL) and the impact of deep convection on this composition. There are three main areas of interest: i) transport of trace gases in the tropical atmosphere (especially short-lived halogenated compounds that can be lifted rapidly into the TTL, where they augment the stratospheric loading of these species); ii) formation of cirrus and its impact on the TTL; and iii) the upper-atmosphere water vapor budget. Overall, the aim was to improve understanding of the dynamical, radiative, and chemical role of the TTL. The Manus operation was a joint experiment between the Universities of Manchester and Cambridge and the UK National Centre for Atmospheric Science (NCAS). It consisted of two elements: an ozonesonde campaign to measure ozone vertical profiles through the TTL, and ground-based monitoring of ozone, halogenated hydrocarbons, and greenhouse gases to determine the composition of lower-boundary-layer air in the Warm Pool region. Thanks to the support from the ARM Climate Research Facility and the exemplary collaboration of ARM staff in the region, the campaign was very successful.

  2. Breastfeeding social marketing: lessons learned from USDA's "Loving Support" campaign.

    Science.gov (United States)

    Pérez-Escamilla, Rafael

    2012-10-01

    Social marketing involves the application of commercial marketing principles to advance the public good. Social marketing calls for much more than health communications campaigns. It involves four interrelated tasks: audience benefit, target behavior, essence (brand, relevance, positioning), and developing the "4Ps" (product, price, place, promotion) marketing mix. The ongoing U.S. Department of Agriculture "Loving Support Makes Breastfeeding Work" campaign was launched in 1997 based on social marketing principles to increase breastfeeding initiation rates and breastfeeding duration among Special Supplemental Nutrition Program for Women, Infants and Children (WIC) participants. Since then there have been improvements in breastfeeding duration in the country, and the majority of WIC women now initiate breastfeeding. Breastfeeding in public places is still not well accepted by society at large, and any and exclusive breastfeeding durations remain exceedingly low. Lessons learned from "Loving Support" and other campaigns indicate that it is important to design social marketing campaigns to target the influential societal forces (e.g., family and friends, healthcare providers, employers, formula industry, legislators) that affect women's decision and ability to breastfeed for the recommended amount of time. This will require formative research that applies the social-ecological model to different population segments, taking and identifying the right incentives to nudge more women to breastfeed for longer. Any new breastfeeding campaign needs to understand and take into account the information acquisition preferences of the target audiences. The vast majority of WIC women have mobile devices and are accessing social media. The Brazilian experience indicates that making breastfeeding the social norm can be done with a solid social marketing strategy. This is consistent with the recently released "Six Steps to Achieve Breastfeeding Goals for WIC Clinics," which identifies

  3. Social Media as a Tool for Online Advocacy Campaigns: Greenpeace Mediterranean’s Anti Genetically Engineered Food Campaign in Turkey

    Directory of Open Access Journals (Sweden)

    B. Pınar Özdemir

    2012-12-01

    Full Text Available Advocacy has been one of the main fields of study in public relations and is established amongst the main functions of public relations. The strong need of non-governmental organizations for public support in order to reach their goals locates public relations and advocacy at a central position for these organizations. Social media, which have been introduced by the further development of Internet technology, especially Web 2.0, has had a significant impact upon public relations and advocacy activities of non-governmental organizations in particular. This development also led non-governmental organizations towards online advocacy campaigns that promote active participation of supporters with more cost effective methods that can easily become widespread. The aim of this study is to place the advocacy campaigns of non-governmental organizations into the context of public relations and to discuss how social media can be utilized in online advocacy through the case study of the Yemezler! (We do not buy it! campaign by Greenpeace Mediterranean that has been significantly successful in a short period in Turkey. The Dragonfly Effect model developed by Aaker and Smith (2010 is employed as a framework in the analysis of the Yemezler! campaign.

  4. Buttons to Bumper Stickers: Political Campaign Memorabilia--Campaign Memorabilia Can Help Students Connect Past with Present

    Science.gov (United States)

    Potter, Lee Ann

    2004-01-01

    During the season of political campaigns scores of bumper stickers, posters, and other items with slogans supporting one candidate or another suddenly appear and quickly multiply around neighborhoods and towns, with stickers plastered on cars, and posters hanging in windows, or posted in front yards. From George Washington to George W. Bush,…

  5. Evaluating the effectiveness of an Australian obesity mass-media campaign: how did the 'Measure-Up' campaign measure up in New South Wales?

    Science.gov (United States)

    King, E L; Grunseit, A C; O'Hara, B J; Bauman, A E

    2013-12-01

    In 2008, the Australian Government launched a mass-media campaign 'Measure-Up' to reduce lifestyle-related chronic disease risk. Innovative campaign messages linked waist circumference and chronic disease risk. Communication channels for the campaign included television, press, radio and outdoor advertising and local community activities. This analysis examines the impact of the campaign in the state of New South Wales, Australia. Cross-sectional telephone surveys (n = 1006 adults pre- and post-campaign) covered self-reported diet and physical activity, campaign awareness, knowledge about waist circumference, personal relevance of the message, perceived confidence to make lifestyle changes and waist-measuring behaviours. The campaign achieved high unprompted (38%) and prompted (89%) awareness. From pre- to post-campaign, knowledge and personal relevance of the link between waist circumference and chronic disease and waist measuring behaviour increased, although there were no significant changes in reported fruit and vegetable intake nor in physical activity. Knowledge of the correct waist measurement threshold for chronic disease risk increased over 5-fold, adjusted for demographic characteristics. 'Measure-Up' was successful at communicating the new campaign messages. Continued long-term investment in campaigns such as 'Measure-Up', supplemented with community-based health promotion, may contribute to population risk factor understanding and behaviour change to reduce chronic disease. PMID:23962490

  6. Muscular Dystrophy Campaign: Putting Some Financial Muscle Behind Finding a Cure

    OpenAIRE

    Pohlschmidt, Marita

    2012-01-01

    The Muscular Dystrophy Campaign, a London-based charitable organization, funds research on muscle function and muscle disease, including the study of muscle stem cells. Dr. Marita Pohlschmidt, the Muscular Dystrophy Campaign's director of research, describes its vision and goals.

  7. The relationship between campaigning on Twitter and electoral support: present or absent

    NARCIS (Netherlands)

    S. Kruikemeier; G. van Noort; R. Vliegenthart

    2013-01-01

    This study investigates the content characteristics of political communication on Twitter during an election campaign and the relationship between candidates’ style of online campaigning (i.e., politically personalized and interactive communication) and electoral support for those candidates. Thereb

  8. EDF launching a new advertising campaign for nuclear power

    International Nuclear Information System (INIS)

    Full text: Starting on November 12 [art, Electricite de France launched its sixth advertising campaign for nuclear power, running in newspapers, magazines and on television. Inserts were published in 10 national daily newspapers and 7 magazines spread over a week period. A 40 second TV commercial will also be broadcast on 15 different channels between November 17 and December 7,1997. In a setting of renewed opposition to nuclear power, the 1997 campaign is a deliberate voicing of opinion and a response designed to instill responsibility and clearly inform the public over the results of the French nuclear electricity programme. The campaign, costing 22 million francs 9 million for the publication of inserts and 13 million for the TV spots) dwells heavily on the programme's comparative benefits for France. The TV commercial, created by the ad agency Callegari Berville, conveys communication based on proof. The rationale is informative in tone, stating that nuclear power ensures a part, of France's independence for energy, and that this is an inexpensive form of power, the results of which are visible on every electricity bill. What is more, nuclear power is a clean and non-polluting energy form. Through scenes of daily life and other imaginary scenes, the spot highlights the advantages nuclear power gives our country. The press campaign is a continuity of the campaign run in November 1996, with EDF using information developed in advertisements to respond to the major questions being asked by the public: how does nuclear power make the cost of electricity competitive? Why does, nuclear power create more jobs in France than other forms of energy? What is the impact of nuclear power on global warming? What do we do with nuclear waste? Why does nuclear power help put our trade balance in the black? The campaign also helps meet a demand by using a reply coupon to propose a number of documents such as 'Focus on the French Nuclear Electricity Programme' or 'Nuclear Waste in

  9. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC) evidence

    Science.gov (United States)

    Stewart, M. K.; Thomas, J. T.

    2008-01-01

    The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA) underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%), with smaller contributions from the Upper Takaka River (18%) and valley rainfall (8%), while Fish Creek Spring contains mostly Upper Takaka River water (50%). In addition, much of the Upper Takaka River contribution to the aquifer (58%) bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows much of the

  10. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2007-05-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusive below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs

  11. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2008-01-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows

  12. Change and continuity in the Liberal Democrat election campaign of 2005

    OpenAIRE

    Grayson, Richard S.

    2005-01-01

    The Liberal Democrat campaign of 2005 was judged by the public to be the most effective of the three main campaigns. It also delivered tangible gains: more seats and more votes for the second successive election. However, the campaign has been criticised, and there has been disappointment within the party that the gains were not greater. This article considers why the party's 2005 campaign was largely the same as in 2001, examining how far the party changed in the intervening years. It begins...

  13. Negative Effects of Incentivised Viral Campaigns for Activity in Social Networks

    OpenAIRE

    Michalski, Radosław; Jankowski, Jarosław; Kazienko, Przemysław

    2013-01-01

    Viral campaigns are crucial methods for word-of-mouth marketing in social communities. The goal of these campaigns is to encourage people for activity. The problem of incentivised and non-incentivised campaigns is studied in the paper. Based on the data collected within the real social networking site both approaches were compared. The experimental results revealed that a highly motivated campaign not necessarily provides better results due to overlapping effect. Additional studies have shown...

  14. Citizenship in action: the lived experiences of citizens with dementia who campaign for social change

    OpenAIRE

    Bartlett, Ruth

    2014-01-01

    This article examines the experiences of citizens with dementia who campaign for social change, with a particular focus on the effects of campaigning on citizenry identity and psycho-emotional well-being. In diary-interviews, 16 people with dementia recorded and described their experiences of campaigning. Findings revealed that although campaigning can be energising and reaffirming of citizen identity, because it (re)located a person within the realm of work, individuals may experience dement...

  15. Integrating Public Relations with Advertising: An Exercise for Students in the College Public Relations Campaigns Course

    Science.gov (United States)

    Moody, Reginald Ford

    2012-01-01

    Today's public relations (PR) campaigns courses give students the opportunity to research, analyze, plan, and, in many cases, execute a campaign for a real client. Even so, today's campaigns courses may leave students with a weak understanding of how PR can best partner with other tools in the communication mix, namely advertising. Educators may…

  16. Awareness Effects of a Youth Suicide Prevention Media Campaign in Louisiana

    Science.gov (United States)

    Jenner, Eric; Jenner, Lynne Woodward; Matthews-Sterling, Maya; Butts, Jessica K.; Williams, Trina Evans

    2010-01-01

    Research on the efficacy of mediated suicide awareness campaigns is limited. The impacts of a state-wide media campaign on call volumes to a national hotline were analyzed to determine if the advertisements have raised awareness of the hotline. We use a quasi-experimental design to compare call volumes from ZIP codes where and when the campaign is…

  17. MTV's "Staying Alive" Global Campaign Promoted Interpersonal Communication about HIV and Positive Beliefs about HIV Prevention

    Science.gov (United States)

    Geary, Cynthia Waszak; Burke; Holly McClain; Castelnau, Laure; Neupane; Shailes; Sall, Yacine Ba; Wong, Emily; Tucker, Heidi Toms

    2007-01-01

    In 2002 MTV launched a global multicomponent HIV prevention campaign, "Staying Alive," reaching over 166 countries worldwide. An evaluation of this campaign focused on three diverse sites: Kathmandu, Nepal; Sao Paulo, Brazil; and Dakar, Senegal. Data were collected before and after campaign implementation through population-based household…

  18. Exposure to MTV's Global HIV Prevention Campaign in Kathmandu, Nepal; Sao Paulo, Brazil; and Dakar, Senegal

    Science.gov (United States)

    Geary, Cynthia Waszak; Burke, Holly McClain; Castelnau, Laure; Neupane, Shailes; Sall, Yacine Ba; Wong, Emily

    2007-01-01

    In 2002 MTV aired a global media campaign, "Staying Alive," to promote HIV prevention among 16- to 25-year-olds. Skeptics believed that a global MTV campaign would reach only a small group of elite young people. MTV increased access to its campaign, however, by making all materials "rights free" to third-party (non-MTV) broadcasters. Over 789…

  19. Improving the effectiveness of road safety campaigns: Current and new practices

    NARCIS (Netherlands)

    Hoekstra, T.; Wegman, F.C.M.

    2011-01-01

    The evaluation of campaigns aimed at improving road safety is still the exception rather than the rule. Because of this, ineffective campaigns and campaign techniques are allowed to continue to be utilised without question, while new methods of behaviour modification are often ignored. Therefore, th

  20. Improving the effectiveness of road safety campaigns : current and new practices.

    NARCIS (Netherlands)

    Hoekstra, A.T.G. & Wegman, F.C.M.

    2015-01-01

    The evaluation of campaigns aimed at improving road safety is still the exception rather than the rule. Because of this, ineffective campaigns and campaign techniques are allowed to continue to be utilised without question, while new methods of behaviour modification are often ignored. Therefore, th

  1. [Evaluation of national prevention campaigns against AIDS: analysis model].

    Science.gov (United States)

    Hausser, D; Lehmann, P; Dubois, F; Gutzwiller, F

    1987-01-01

    The evaluation of the "Stop-Aids" campaign is based upon a model of behaviour modification (McAlister) which includes the communication theory of McGuire and the social learning theory of Bandura. Using this model, it is possible to define key variables that are used to measure the impact of the campaign. Process evaluation allows identification of multipliers that reinforce and confirm the initial message of prevention (source) thereby encouraging behaviour modifications that are likely to reduce the transmission of HIV (condom use, no sharing of injection material, monogamous relationship, etc.). Twelve studies performed by seven teams in the three linguistic areas contribute to the project. A synthesis of these results will be performed by the IUMSP. PMID:3687209

  2. A campaign against violence: USAID / Kenya funds "Breaking the Silence".

    Science.gov (United States)

    1997-01-01

    From November 25 to December 10, 1996, USAID/Kenya supported 16 days of activism against gender violence. Called "Breaking the Silence," this annual national campaign was aimed at raising awareness of the rising level of violence against women in Kenya. At meeting places around the country, the campaign, organized by the Coalition on Violence Against Women/Kenya and partially funded by USAID/Kenya, brought together hundreds of participants for a dialogue about gender-based violence. Speakers sought to debunk the myths surrounding violence, including the tendency to blame the victims of gender violence. Victims of violence described their treatment at the hands of abusers. Information brochures discussing domestic battery, wife killing, incest, and other forms of violence against women were distributed. USAID/Kenya has provided funding for this coalition since 1995. PMID:12321054

  3. Analytical study plan: Shielded Cells batch 1 campaign; Revision 1

    International Nuclear Information System (INIS)

    Radioactive operations in the Defense Waste Processing Facility (DWPF) will require that the Savannah River Technology Center (SRTC) perform analyses and special studies with actual Savannah River Site (SRS) high-level waste sludge. SRS Tank 42 and Tank 51 will comprise the first batch of sludge to be processed in the DWPF. Approximately 25 liters of sludge from each of these tanks will be characterized and processed in the Shielded Cells of SRTC. During the campaign, processes will include sludge characterization, sludge washing, rheology determination, mixing, hydrogen evolution, feed preparation, and vitrification of the waste. To complete the campaign, the glass will be characterized to determine its durability and crystallinity. This document describes the types of samples that will be produced, the sampling schedule and analyses required, and the methods for sample and analytical control

  4. Capsule performance optimization in the National Ignition Campaign

    International Nuclear Information System (INIS)

    A capsule performance optimization campaign will be conducted at the National Ignition Facility [G. H. Miller et al., Nucl. Fusion 44, 228 (2004)] to substantially increase the probability of ignition by laser-driven hohlraums [J. D. Lindl et al., Phys. Plasmas 11, 339 (2004)]. The campaign will experimentally correct for residual uncertainties in the implosion and hohlraum physics used in our radiation-hydrodynamic computational models before proceeding to cryogenic-layered implosions and ignition attempts. The required tuning techniques using a variety of ignition capsule surrogates have been demonstrated at the OMEGA facility under scaled hohlraum and capsule conditions relevant to the ignition design and shown to meet the required sensitivity and accuracy. In addition, a roll-up of all expected random and systematic uncertainties in setting the key ignition laser and target parameters due to residual measurement, calibration, cross-coupling, surrogacy, and scale-up errors has been derived that meets the required budget.

  5. Capsule performance optimization in the national ignition campaign

    International Nuclear Information System (INIS)

    A capsule performance optimization campaign will be conducted at the National Ignition Facility [1] to substantially increase the probability of ignition. The campaign will experimentally correct for residual uncertainties in the implosion and hohlraum physics used in our radiation-hydrodynamic computational models before proceeding to cryogenic-layered implosions and ignition attempts. The required tuning techniques using a variety of ignition capsule surrogates have been demonstrated at the Omega facility under scaled hohlraum and capsule conditions relevant to the ignition design and shown to meet the required sensitivity and accuracy. In addition, a roll-up of all expected random and systematic uncertainties in setting the key ignition laser and target parameters due to residual measurement, calibration, cross-coupling, surrogacy, and scale-up errors has been derived that meets the required budget.

  6. Capsule performance optimization in the national ignition campaign

    Science.gov (United States)

    Landen, O. L.; MacGowan, B. J.; Haan, S. W.; Edwards, J.

    2010-08-01

    A capsule performance optimization campaign will be conducted at the National Ignition Facility [1] to substantially increase the probability of ignition. The campaign will experimentally correct for residual uncertainties in the implosion and hohlraum physics used in our radiation-hydrodynamic computational models before proceeding to cryogenic-layered implosions and ignition attempts. The required tuning techniques using a variety of ignition capsule surrogates have been demonstrated at the Omega facility under scaled hohlraum and capsule conditions relevant to the ignition design and shown to meet the required sensitivity and accuracy. In addition, a roll-up of all expected random and systematic uncertainties in setting the key ignition laser and target parameters due to residual measurement, calibration, cross-coupling, surrogacy, and scale-up errors has been derived that meets the required budget.

  7. OLYMPEX Counterflow Spectrometer and Impactor Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Poellot, Michael [Univ. of North Dakota, Grand Forks, ND (United States)

    2016-07-01

    The U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s ARM Aerial Facility (AAF) Counterflow Spectrometer and Impactor (CSI) probe was flown on the University of North Dakota Cessna Citation research aircraft during the Olympic Mountain Experiment (OLYMPEX). The field campaign took place from November 12 through December 19, 2015, over the Olympic Mountains and coastal waters of Washington State as part of a National Aeronautics and Space Administration (NASA) Global Precipitation Measurement (GPM) validation campaign. The CSI was added to the Citation instrument suite to support the NASA Aerosol-Cloud Ecosystem (ACE) satellite program and flights of the NASA Lockheed Earth Resources (ER-2) aircraft. ACE funded extra ER-2 flights to focus on clouds that are weakly precipitating, which are also of interest to the DOE Atmospheric System Research (ASR) program.

  8. Electoral Campaigning in Indonesia: The Professionalization and Commercialization after 1998

    Directory of Open Access Journals (Sweden)

    Andreas Ufen

    2010-01-01

    Full Text Available According to “Western” models, there are three different stages of electioneering. In Indonesia, elements of these different stages are now combined. The result is not a comprehensive “Americanization”, but a professionalization, along with a hybridization of indigenous and foreign methods. At the beginning, the elections of 1955 were marked by a localized campaign and the absence of TV, pollsters and consultants. The long suppression of electoral politics (from 1957 until 1998 has decelerated the transition toward new forms of electioneering. Technological change, institutional reforms (especially the introduction of direct presidential and direct local elections, the general dealignment of political parties, and the extraordinary rise of pollsters and consultants have effected a professionalization and commercialization of campaigning since the fall of Suharto. Political parties are now tending to become more market-oriented.

  9. Ion chromatography campaigns at several boiling water reactors

    International Nuclear Information System (INIS)

    Water chemistry characterization campaigns using on-line ion chromatography were conducted at several BWRs during 1989. Some of the highlights from these campaigns, along with equipment and IC methods are presented in this paper. Monitoring copper ion in final feedwater and filter demineralizer effluents at levels <0.2 ppb enabled optimum operation of the condensate demineralizer system. The need for new precoats was based on ion trends, not pressure drop or volume limitations. Conductivity transients, due to power reductions, were characterized. Magnesium, calcium, sulfate and chromate were the major contributors. Start up, water chemistry transients, were monitored, revealing organics from sealing compounds used in the condenser and turbine. On-line IC is an effective tool for understanding power plant chemistry and improving operations of condensate cleanup systems

  10. Capsule Performance Optimization in the National Ignition Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Landen, O L; MacGowan, B J; Haan, S W; Edwards, J

    2009-10-13

    A capsule performance optimization campaign will be conducted at the National Ignition Facility to substantially increase the probability of ignition. The campaign will experimentally correct for residual uncertainties in the implosion and hohlraum physics used in our radiation-hydrodynamic computational models before proceeding to cryogenic-layered implosions and ignition attempts. The required tuning techniques using a variety of ignition capsule surrogates have been demonstrated at the Omega facility under scaled hohlraum and capsule conditions relevant to the ignition design and shown to meet the required sensitivity and accuracy. In addition, a roll-up of all expected random and systematic uncertainties in setting the key ignition laser and target parameters due to residual measurement, calibration, cross-coupling, surrogacy, and scale-up errors has been derived that meets the required budget.

  11. New awareness campaign increases appeal of family planning.

    Science.gov (United States)

    1999-06-01

    This article examines the impact of the campaign known as "Bringing New Marital and Reproductive Styles into Tens of Thousands of Households" on family planning in China. The awareness campaign, which started in October 1998, was established to increase the effectiveness of family planning and introduce progressive lifestyles among the population through an interactive and service-oriented approach focusing on the needs of human beings. The program emphasizes the following elements: 1) late marriage; 2) late childbirth; 3) fewer childbirth; 4) gender equality; 5) male participation in family planning; 6) dissemination of family planning and reproductive health knowledge; 7) healthier births and quality of education; 8) enhanced self-care capabilities; 9) higher quality of life; and 10) healthier lifestyles. A face-to-face approach was used to encourage public participation and increase the appeal of family planning programs to ordinary people. Efforts are also being made to expose rural residents to new ideas and lifestyles. PMID:12319745

  12. Targeting young voters in a political campaign: Empirical insights into an interactive digital marketing campaign in the 2007 Finnish general election

    OpenAIRE

    Leppäniemi, Matti; Karjaluoto, Heikki; Lehto, Heikki; Goman, Anni

    2010-01-01

    At general elections across Europe, turnout among young people tends to be significantly lower than among older voters. Therefore, this paper examines a digital marketing campaign that was targeted at young voters in the 2007 Finnish general election. More specifically, this paper aims to provide insights into the creative development process of a political marketing campaign and the nature of the client-agency relationship in political campaigns. The methodology adopted in thi...

  13. Automated System for Effective Internet Marketing Campaign (ASEIMC)

    OpenAIRE

    Kovacheva, Todorka

    2008-01-01

    The purpose of the paper is to present an automated system for realization of effective internet marketing campaign (ASEIMC). The constantly growing number of websites available online brings more problems for the contemporary enterprises to reach their potential customers. Therefore the companies have to discover novel approaches to increase their online sales. The presented ASEIMC system gives such an approach and helps small and medium enterprises to compete for customers ...

  14. Tips From Former Smokers – 2013 Campaign

    Centers for Disease Control (CDC) Podcasts

    2013-03-28

    Tim McAfee, MD, MPH, of CDC’s Office on Smoking and Health, discusses the 2013 Tips campaign, and his personal experience as a doctor treating people with diseases caused by smoking, or made worse by it. He also offers advice on how people can quit smoking.  Created: 3/28/2013 by Office on Smoking and Health, National Center for Chronic Disease Prevention and Health Promotion.   Date Released: 3/28/2013.

  15. Negative economic consequences of ethical campaigns?: Market data evidence

    OpenAIRE

    Yamamoto, Wataru

    2013-01-01

    This study demonstrates how ethical attributes of goods affect market outcomes on the basis of market data and actual ethical campaigns. Among the various types of such attributes, such as eco-label and fair trade label, I focus on cause-related marketing (CRM), which economists study less frequently than other ethical attributes. Researchers who analyzed this topic focused largely on experimental data, which has less noise and enables researchers to obtain the pure effect of ethical attribut...

  16. Developing integrated marketing communication campaign for CoreFinland Ltd

    OpenAIRE

    Kucher, Kristina

    2012-01-01

    The aim of this study is to develop marketing communication campaign for a small-sized snacks- producing company CoreFinland Ltd using the integrated approach. The research question defines what kind of marketing activities the case company needs in order to improve the interaction with consumers and raise brand awareness. The first part of the research is a qualitative study of relevant marketing literature that concentrates on comparison between traditional and modern marketing. An...

  17. 242-A Campaign 99-1 process control plan

    Energy Technology Data Exchange (ETDEWEB)

    LE, E.Q.

    1999-08-25

    242-A Evaporator 99-1 will process approximately one million gallons of waste from tank 102-AW in June 1999. The process control Plan provides a general description of activities, which will occur during 242-A Evaporator Campaign 99-1 and to document analyses conducted to demonstrate that 102-AW waste is acceptable for processing. Predict is a registered trademark of Risk Decisions England Corporation, United Kingdom.

  18. Increase of campaign attractiveness and taking advantage of online trends

    OpenAIRE

    Braga, Carolina

    2016-01-01

    This document is based on a master’s thesis work project conducted by Nova SBE students to help the leading Portuguese telecom provider MEO increase its digital campaign’s attractiveness and to take better advantage of the new online trends. Recommendations are given based on primary research in the form of a focus group and a survey questionnaire launched online. Subjects such as digital marketing channels, high-impact digital advertisement formats, campaign content and the emergence of new ...

  19. Party Activists, Campaign Funding and the Quality of Government

    OpenAIRE

    John Maloney; Andrew Pickering

    2010-01-01

    We study the formation of government policy in democracies when turnout depends on party activists and campaign spending ‐ parties’ ‘political capital’. The functional importance of political capital determines equilibrium rent-seeking in government. Often the more potent political capital is the greater the extent of rent-seeking. Limiting the level of political capital is distinct from reducing its potency, and whereas we find a strong case for reducing potency we find that placing limits o...

  20. Public funding of political parties when campaigns are informative

    OpenAIRE

    Ortuño Ortín, Ignacio; Schultz, Christian

    2012-01-01

    The paper considers public funding of political parties when some voters are poorly informed about parties? candidates and campaigns are informative. For symmetric equilibria, it is shown that more public funding leads parties to chose more moderate candidates, and that an increase in the funding's dependence on vote shares induces further moderation and improves welfare. If parties are asymmetric, vote share dependent public funding bene?ts the large party and makes it moderate its candidate...

  1. The Hadia Story: Digital Storytelling in Election Campaigns

    OpenAIRE

    Øyvind Kalnes; Eva Bakøy

    2010-01-01

    Digital storytelling in election campaigns is a relatively recent phenomenon, which needs to be investigated in order to enhance our understanding of changes and developments in modern political communication. This article is an analysis of how the Norwegian-Pakistani Labour politician, Hadia Tajik, has used digital storytelling to construct her political identity, and a discussion of the consequences of her experiments with this genre. The focus is on the five video stories she released d...

  2. Mass Media Social Marketing Campaigns: A Practitioners Perspective

    OpenAIRE

    Patrick van Esch; Darejan Tsartsidze; Linda Jean van Esch

    2014-01-01

    This paper explores mass media social marketing practitioner perspectives of the intersect where the dimensionsof religion taxonomy and mass media social marketing campaigns meet. Under an interpretive paradigm (Crotty,1998), in-depth interviews were conducted with five expert mass media social marketing practitioners inAustralia. The data was analysed qualitatively with the data analysis software package NVivo. Five themesemerged from the results: (1) The dimension of religion taxonomy does ...

  3. Social media as political party campaign in Indonesia

    OpenAIRE

    Abdillah, Leon Andretti

    2014-01-01

    Social media as a trend in the Internet is now used as a medium for political campaigns. Author explores the advantages and social media implementation of any political party in Indonesia legislative elections 2014. Author visited and analyzed social media used by the contestants, such as: Facebook, and Twitter. Author collected data from social media until the end of April 2014. This article discusses the use of social media by political parties and their features. The results of this study ...

  4. Development of Web Service Integration and Advertisement Campaign Design Interface

    OpenAIRE

    Nilsson, Johan

    2012-01-01

    Ad Gateway is a product which provides targeting of online advertisements. This thesis focuses on improving its web based admin interface, used for defining targeting properties as well as creating the advertisements. First by integrating the system with third party web services used for storage of advertisement campaigns, called advertisement providers, allowing advertisement to be retrieved and uploaded directly to their servers. Later to extend the admin interface with new functionality, i...

  5. Social Networking Websites in Electoral Campaigns: the Case of Lithuania

    OpenAIRE

    Suminas, Andrius

    2012-01-01

    In recent years social networking websites, and especially Facebook, have attracted millions of new users. For that reason, politicians seek to use this interactive space more and more intensively for their goals, most often during the period of election campaigns. This article analyzes the processes of political communication via social networking sites, and discusses the benefits and some negative aspects of these communicational activities. As well, the article presents the analysis of the...

  6. Barrow Black Carbon Source and Impact Study Final Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, Tate

    2014-07-01

    The goal of the Barrow Black Carbon Source and Impact campaign was to characterize the concentration and isotopic composition of carbonaceous atmospheric particulate matter (PM) at the Atmospheric Radiation Measurement (ARM) Climate Research Facility site in Barrow, Alaska. The carbonaceous component was characterized by measuring the organic and black carbon (OC and BC) components of the total PM. To facilitate complete characterization of the PM, filter-based collections were used, including a medium volume PM2.5 sampler and a high volume PM10 sampler. Thirty-eight fine PM fractions (PM2.5) and 49 coarse (PM10) PM fractions were collected at weekly and bi-monthly intervals. The PM2.5 sampler operated with minimal maintenance during the 12 month campaign. The PM10 sampler used for the Barrow Black Carbon Source and Impact (BBCSI) study used standard Tisch “hi-vol” motors that have a known lifetime of approximately 1 month under constant use; this necessitated monthly maintenance, and it is suggested that, for future deployment in the Arctic, the motors be upgraded to industrial blowers. The BBCSI sampling campaign successfully collected and archived 87 ambient atmospheric PM samples from Barrow, Alaska, from July 2012 to June 2013. Preliminary analysis of the OC and BC concentrations has been completed. This campaign confirmed known trends of high BC lasting from the winter through to spring haze periods and low BC concentrations in the summer. However, the annual OC concentrations had a very different seasonal pattern with the highest concentrations during the summer, lowest concentrations during the fall, and increased concentrations during the winter and spring (Figure 1).

  7. Process control plan for 242-A Campaign 99-1

    International Nuclear Information System (INIS)

    242-A Evaporator 99-1 will process approximately one million gallons of waste from tank 102-AW in June 1999. The process control Plan provides a general description of activities, which will occur during 242-A Evaporator Campaign 99-1 and to document analyses conducted to demonstrate that 102-AW waste is acceptable for processing. Predict is a registered trademark of Risk Decisions England Corporation, United Kingdom

  8. The linguistic aspect of strategic framing in modern political campaigns

    OpenAIRE

    Agnieszka Pluwak

    2015-01-01

    The linguistic aspect of strategic framing in modern political campaignsThe following article describes the role of semantics in political marketing, emphasizing the mechanism of framing and perspectivising in discourse. The complexity of the framing process is discussed in the introduction, then the linguistic aspect of political framing is debated and the technique of wording formulation in political discourse analyzed. Finally, implications and conclusions for further research are presente...

  9. Smart Pacing for Effective Online Ad Campaign Optimization

    OpenAIRE

    Xu, Jian; Lee, Kuang-chih; Li, Wentong; Qi, Hang; Lu, Quan

    2015-01-01

    In targeted online advertising, advertisers look for maximizing campaign performance under delivery constraint within budget schedule. Most of the advertisers typically prefer to impose the delivery constraint to spend budget smoothly over the time in order to reach a wider range of audiences and have a sustainable impact. Since lots of impressions are traded through public auctions for online advertising today, the liquidity makes price elasticity and bid landscape between demand and supply ...

  10. Stroke risk perception among participants of a stroke awareness campaign

    OpenAIRE

    Heuschmann Peter U; Heidrich Jan; Kraywinkel Klaus; Wagner Markus; Berger Klaus

    2007-01-01

    Abstract Background Subjective risk factor perception is an important component of the motivation to change unhealthy life styles. While prior studies assessed cardiovascular risk factor knowledge, little is known about determinants of the individual perception of stroke risk. Methods Survey by mailed questionnaire among 1483 participants of a prior public stroke campaign in Germany. Participants had been informed about their individual stroke risk based on the Framingham stroke risk score. S...

  11. Clustering Methods Application for Customer Segmentation to Manage Advertisement Campaign

    OpenAIRE

    Maciej Kutera; Mirosława Lasek

    2010-01-01

    Clustering methods are recently so advanced elaborated algorithms for large collection data analysis that they have been already included today to data mining methods. Clustering methods are nowadays larger and larger group of methods, very quickly evolving and having more and more various applications. In the article, our research concerning usefulness of clustering methods in customer segmentation to manage advertisement campaign is presented. We introduce results obtained by using four sel...

  12. Exploring social marketing landscapes: A review of food campaigns

    OpenAIRE

    CAVICCHI A.; G.Stefani; Romano, D.

    2011-01-01

    Social marketing is a growing research field. It has been proved that social marketing has some effectiveness in health programs and can help in shaping people’s behaviour. This paper examines the role of social marketing in public communication campaigns and, more specifically, it explores the issue of healthy food habits promotion. An overview of theoretical issues surrounding definitions of basic principles and contents of social marketing is presented. Consequently social marketing is ana...

  13. Kony 2012 - Knowledge and Responsibility in Development Campaigns

    OpenAIRE

    Lindskrog, Tine Irming

    2013-01-01

    This thesis investigates how the social movement Invisible Children frames meaning for action in its Kony2012 campaign, how we can understand such framing of meaning for action as knowledge, and whether Invisible Children is responsible for the implications of such framings. The thesis integrates the subjects of International Development Studies and Philosophy and will integrate theoretical aspects and discussions from both subjects. Invisible Children is a US-based social movement that a...

  14. Optimizing multi-channel use in digital marketing campaigns

    OpenAIRE

    Lemos, André Miguel Fonseca

    2015-01-01

    Digital marketing has been gaining importance in the last years. It has become an easier, faster and more accountable way to reach customers than traditional, offline marketing, leading to more effective results and lower campaign costs. In digital marketing, the need to constantly reach large audiences is met by integrating online communication channels, as this increases customer touch points and ad exposures. It becomes thus important to know which channels perform better, individually or ...

  15. Seeing Stars: A GLOBE at Night Campaign Update

    Science.gov (United States)

    Walker, Constance E.; Pompea, S. M.; Sparks, R. T.; Newhouse, M.

    2012-01-01

    The emphasis in the international citizen-science, star-hunting campaign, GLOBE at Night, is in bringing awareness to the public on issues of light pollution. Light pollution threatens not only observatory sites and our "right to starlight", but can affect energy consumption, wildlife and health. GLOBE at Night has successfully reached a few 100,000 citizen-scientists. What has done in the last year to contribute to its success? • To promote the campaign via popular social media, GLOBE at Night created Facebook and Twitter pages. • Videos have been created for 4 out of 8 Dark Skies Rangers activities. • Sky brightness measurements can be submitted in real time with smart phones or tablets using the new Web application at www.globeatnight.org/webapp/. The location, date and time register automatically. • As a proto-type, an adopt-a-street program had people in Tucson take measurements every mile for the length of the street. Grid measurements canvassed the town, allowing for comparisons of light levels over time. • The increase to 2 campaigns in 2011 re-enforces these studies. In 2012, the campaign will be offered 4 times for 10 days a month: January 14-23, February 12-21, March 13-22 and April 11-20. • A new Web application (www.globeatnight.org/mapapp/) allows for mapping GLOBE at Night data points within a specified distance around a city or area of choice. The resulting maps are bookmarkable and shareable. • NOAO and Arizona Game and Fish Department started a project with GLOBE at Night data and bat telemetry to examine a dark skies corridor in Tucson where endangered bats fly. While providing these updates to the GLOBE at Night program, the presentation will highlight the education and outreach value of the program's resources and outcomes, lessons learned, successes and pitfalls in communicating awareness with the public and attracting young people to study science.

  16. THE INTERCULTURAL IMPACT OF MARKETING CAMPAIGNS OF THE BENETTON BRAND

    OpenAIRE

    Corina Anamaria IOAN; Florin-Alexandru LUCA

    2014-01-01

    Ad campaigns created in-house in Benetton - United Color of Benneton, by Oliviero Toscani, the a known avant-garde photographer, made around the world to talk about the company for over 20 years. Black woman breastfeeding a white child, an AIDS photographed faces of dying or sentenced to death in American prisons are some of the most controversial advertising images of the past decade. The steps of the original communication- or socking- were appreciated and rewarded socially, professional...

  17. Viral Marketing Campaign Plan and Its Results : Relationship Games Ltd.

    OpenAIRE

    Komendová, Alena Alisa

    2013-01-01

    Relationship Games Ltd., the commissioner of this thesis, is a globally operating online company based in Helsinki, Finland. Relationship Games provides its customers with services to improve already existing interpersonal romantic relationships. The main goal was to promote Relationship Games Ltd., to attract attention and to gain new customers for Relationship Games via viral marketing campaign using the social media platforms. The objective of the thesis was to plan, develop and ex...

  18. Localisation in the 2004 Presidential Election Campaign in Taiwan

    OpenAIRE

    Wai Kwok Wong, Benson

    2008-01-01

    The 2004 presidential election campaign in Taiwan brought head to head the political alliance of the Kuomintang (KMT), the People’s First Party (PFP) and the New Party (NP) on one side, and of the Democracy Progressive Party (DPP) and the Taiwan Solidarity Union (TSU) on the other. Adopting an iconographic approach, this article looks at four aspects of “Taiwanisation”: a stronger Taiwan identity, the island’s ability to face political challenges arising from democratisation and political unr...

  19. BC Walks: Replication of a Communitywide Physical Activity Campaign.

    OpenAIRE

    Reger-Nash, Bill; Fell, Patricia; Spicer, Deborah; Fisher, Brian D.; Cooper, Linda; Chey, Tien; Bauman, Adrian

    2006-01-01

    Introduction Individuals not engaging in recommended amounts of moderate-intensity physical activity are deemed insufficiently active and are at greater risk of chronic disease. Social marketing strategies may promote positive changes in physical activity levels among insufficiently active individuals. Methods A quasi-experimental design was used to determine whether the results of a previous communitywide physical activity social marketing campaign conducted in Wheeling, WVa (population, 31,...

  20. Images and bodies subject: sexuality in advertising campaign be stupid

    OpenAIRE

    Douglas Luiz Menegazzi

    2013-01-01

    This paper discusses the portrayal of sexuality and gender in contemporary advertising by the image and it focuses on visual analysis of the case study of the campaign Be Stupid, the clothing brand Diesel. Examines some of the ads clearer suggestions to the theme of sexuality, about fifteen images, running between 2010 and 2011em many countries, including Brazil, having won the controversial impact of media such as magazines, billboards and especially the Internet. Perform a survey of theoret...