WorldWideScience

Sample records for campaign cfc cruise-in

  1. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ... Doc No: 2011-30240] OFFICE OF PERSONNEL MANAGEMENT CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Establishment of advisory committee. SUMMARY: The CFC-50 Advisory Commission will hold... operation and effectiveness of the Combined Federal Campaign (CFC) to ensure its continued growth and...

  2. 77 FR 10004 - CFC-50 Commission

    Science.gov (United States)

    2012-02-21

    ... MANAGEMENT CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Establishment of advisory committee. SUMMARY: The CFC-50 Advisory Commission will hold its third and final meeting on March 2, 2012... Federal Campaign (CFC) to ensure its continued growth and success. The Commission is an advisory committee...

  3. 76 FR 53159 - CFC-50 Commission Meeting

    Science.gov (United States)

    2011-08-25

    ... MANAGEMENT CFC-50 Commission Meeting AGENCY: Office of Personnel Management. ACTION: Establishment of advisory committee. SUMMARY: The CFC-50 Advisory Commission will hold its initial meeting on September 13... Combined Federal Campaign (CFC) to ensure its continued growth and success. The Commission is an advisory...

  4. 77 FR 28639 - Meeting of the CFC-50 Commission

    Science.gov (United States)

    2012-05-15

    ... MANAGEMENT Meeting of the CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Notice. SUMMARY: The CFC-50 Advisory Commission will hold its fourth and final meeting on May 29, 2012, at the time and... ] Campaign (CFC) to ensure its continued growth and success. The Commission is an advisory committee composed...

  5. Chlorofluorocarbons: CFC-11, CFC-12, CFC-113, HCFC-21, HCFC-31, HCFC-133a

    DEFF Research Database (Denmark)

    Bredsdorff, Lea; Nielsen, Else

    The Danish EPA has requested documentation for health-based quality criteria in air and groundwater for the following six chlorofluorocarbons: CFC-11, CFC-12, HCFC-21, HCFC-31, CFC-113 (1,1,2-trichloro-1,2,2-trifluoroethane) and HCFC-133a (1-chloro-2,2,2-trifluoroethane). A concern for toxic...

  6. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  7. 5 CFR 950.801 - Campaign schedule.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Campaign schedule. 950.801 Section 950... VOLUNTARY ORGANIZATIONS CFC Timetable § 950.801 Campaign schedule. (a) The Combined Federal Campaign will be.../International and International parts of the Charity List to all local campaigns by a date to be determined by...

  8. Dicty_cDB: CFC714 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC714 (Link to dictyBase) - - - Contig-U16447-1 CFC714E (Link to Original site) CFC...714F 619 CFC714Z 688 CFC714P 1307 CFC714E 1254 Show CFC714 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-A/CFC714Q.Seq.d/ Representative seq. ID CFC...714E (Link to Original site) Representative DNA sequence >CFC714 (CFC714Q) /CSM/CF/CFC7-A/CFC...gnments: (bits) Value VFK675 (VFK675Q) /CSM/VF/VFK6-D/VFK675Q.Seq.d/ 2381 0.0 CFC714 (CFC714Q) /CSM/CF/CFC7-A/CFC

  9. Dicty_cDB: CFC367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC367 (Link to dictyBase) - - - Contig-U09658-1 CFC367E (Link to Original site) CFC...367F 596 CFC367Z 684 CFC367P 1280 CFC367E 1227 Show CFC367 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-C/CFC367Q.Seq.d/ Representative seq. ID CFC...367E (Link to Original site) Representative DNA sequence >CFC367 (CFC367Q) /CSM/CF/CFC3-C/CFC...ing significant alignments: (bits) Value CFC367 (CFC367Q) /CSM/CF/CFC3-C/CFC367Q.

  10. Dicty_cDB: CFC289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC289 (Link to dictyBase) - - - Contig-U11234-1 CFC289E (Link to Original site) CFC...289F 670 CFC289Z 718 CFC289P 1388 CFC289E 1224 Show CFC289 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC289Q.Seq.d/ Representative seq. ID CFC...289E (Link to Original site) Representative DNA sequence >CFC289 (CFC289Q) /CSM/CF/CFC2-D/CFC...nificant alignments: (bits) Value CFC289 (CFC289Q) /CSM/CF/CFC2-D/CFC289Q.Seq.d/

  11. Dicty_cDB: CFC606 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC606 (Link to dictyBase) - - - Contig-U16568-1 CFC606E (Link to Original site) CFC60...6F 691 CFC606Z 743 CFC606P 1434 CFC606E 1224 Show CFC606 Library CF (Link to library) Clone ID CFC60...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC606Q.Seq.d/ Re...presentative seq. ID CFC606E (Link to Original site) Representative DNA sequence >CFC606 (CFC606Q) /CSM/CF/CFC6-A/CFC60...ificant alignments: (bits) Value CFC606 (CFC606Q) /CSM/CF/CFC6-A/CFC606Q.Seq.d/ 2

  12. CFC Outdoor Tournament 2011

    CERN Multimedia

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  13. Dicty_cDB: CFC182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC182 (Link to dictyBase) - - - - CFC182P (Link to Original site) CFC182F 598 CFC182...Z 727 CFC182P 1325 - - Show CFC182 Library CF (Link to library) Clone ID CFC182 (Link...sukuba.ac.jp/CSM/CF/CFC1-D/CFC182Q.Seq.d/ Representative seq. ID CFC182P (Link to... Original site) Representative DNA sequence >CFC182 (CFC182Q) /CSM/CF/CFC1-D/CFC182Q.Seq.d/ ATTTTAATATATTCAC...mology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC182 (CFC182Q) /CSM/CF/CFC1-D/CFC182

  14. Dicty_cDB: CFC494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC494 (Link to dictyBase) - - - Contig-U16368-1 CFC494P (Link to Original site) CFC...494F 590 CFC494Z 767 CFC494P 1357 - - Show CFC494 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-D/CFC494Q.Seq.d/ Representative seq. ID CFC...494P (Link to Original site) Representative DNA sequence >CFC494 (CFC494Q) /CSM/CF/CFC4-D/CFC...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC494 (CFC494Q) /CSM/CF/CFC4-D/CFC

  15. Dicty_cDB: CFC411 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC411 (Link to dictyBase) - - - Contig-U16382-1 CFC411P (Link to Original site) CFC...411F 514 CFC411Z 607 CFC411P 1121 - - Show CFC411 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-A/CFC411Q.Seq.d/ Representative seq. ID CFC...411P (Link to Original site) Representative DNA sequence >CFC411 (CFC411Q) /CSM/CF/CFC4-A/CFC...ant alignments: (bits) Value CFC411 (CFC411Q) /CSM/CF/CFC4-A/CFC411Q.Seq.d/ 2014 0.0 VFI283 (VFI283Q) /CSM/V

  16. Dicty_cDB: CFC311 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC311 (Link to dictyBase) - - - Contig-U15327-1 CFC311P (Link to Original site) CFC...311F 590 CFC311Z 704 CFC311P 1294 - - Show CFC311 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-A/CFC311Q.Seq.d/ Representative seq. ID CFC...311P (Link to Original site) Representative DNA sequence >CFC311 (CFC311Q) /CSM/CF/CFC3-A/CFC...gnificant alignments: (bits) Value CFC311 (CFC311Q) /CSM/CF/CFC3-A/CFC311Q.Seq.d/ 2432 0.0 SFI138 (SFI138Q)

  17. Dicty_cDB: CFC321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC321 (Link to dictyBase) - - - Contig-U16592-1 CFC321P (Link to Original site) CFC...321F 592 CFC321Z 657 CFC321P 1249 - - Show CFC321 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-A/CFC321Q.Seq.d/ Representative seq. ID CFC...321P (Link to Original site) Representative DNA sequence >CFC321 (CFC321Q) /CSM/CF/CFC3-A/CFC...significant alignments: (bits) Value CFC321 (CFC321Q) /CSM/CF/CFC3-A/CFC321Q.Seq.d/ 2436 0.0 VFI581 (VFI581Q

  18. Dicty_cDB: CFC750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC750 (Link to dictyBase) - - - Contig-U13830-1 CFC750P (Link to Original site) CFC...750F 435 CFC750Z 708 CFC750P 1143 - - Show CFC750 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-C/CFC750Q.Seq.d/ Representative seq. ID CFC...750P (Link to Original site) Representative DNA sequence >CFC750 (CFC750Q) /CSM/CF/CFC7-C/CFC...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC750 (CFC750Q) /CSM/CF/CFC7-C/CFC

  19. Dicty_cDB: CFC406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC406 (Link to dictyBase) - - - Contig-U16254-1 CFC406P (Link to Original site) CFC...406F 507 CFC406Z 760 CFC406P 1267 - - Show CFC406 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-A/CFC406Q.Seq.d/ Representative seq. ID CFC...406P (Link to Original site) Representative DNA sequence >CFC406 (CFC406Q) /CSM/CF/CFC4-A/CFC...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC406 (CFC406Q) /CSM/CF/CFC4-A/CFC

  20. Dicty_cDB: CFC877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC877 (Link to dictyBase) - - - Contig-U16560-1 CFC877P (Link to Original site) CFC...877F 117 CFC877Z 797 CFC877P 914 - - Show CFC877 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-D/CFC877Q.Seq.d/ Representative seq. ID CFC...877P (Link to Original site) Representative DNA sequence >CFC877 (CFC877Q) /CSM/CF/CFC8-D/CFC8...alignments: (bits) Value CFC877 (CFC877Q) /CSM/CF/CFC8-D/CFC877Q.Seq.d/ 1516 0.0 CFA841 (CFA841Q) /CSM/CF/CF

  1. Dicty_cDB: CFC683 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC683 (Link to dictyBase) - - - Contig-U16381-1 CFC683P (Link to Original site) CFC...683F 148 CFC683Z 111 CFC683P 259 - - Show CFC683 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-D/CFC683Q.Seq.d/ Representative seq. ID CFC...683P (Link to Original site) Representative DNA sequence >CFC683 (CFC683Q) /CSM/CF/CFC6-D/CFC6...re E Sequences producing significant alignments: (bits) Value CFC683 (CFC683Q) /CSM/CF/CFC6-D/CFC

  2. Dicty_cDB: CFC339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC339 (Link to dictyBase) - - - Contig-U13924-1 CFC339P (Link to Original site) CFC...339F 583 CFC339Z 718 CFC339P 1301 - - Show CFC339 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-B/CFC339Q.Seq.d/ Representative seq. ID CFC...339P (Link to Original site) Representative DNA sequence >CFC339 (CFC339Q) /CSM/CF/CFC3-B/CFC...equences producing significant alignments: (bits) Value CFC339 (CFC339Q) /CSM/CF/CFC3-B/CFC339Q.Seq.d/ 1970

  3. Dicty_cDB: CFC152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC152 (Link to dictyBase) - - - Contig-U15738-1 CFC152P (Link to Original site) CFC...152F 490 CFC152Z 652 CFC152P 1142 - - Show CFC152 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-C/CFC152Q.Seq.d/ Representative seq. ID CFC...152P (Link to Original site) Representative DNA sequence >CFC152 (CFC152Q) /CSM/CF/CFC1-C/CFC...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC152 (CFC152Q) /CSM/CF/CFC1-C/CFC

  4. Dicty_cDB: CFC741 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC741 (Link to dictyBase) - - - Contig-U16419-1 CFC741P (Link to Original site) CFC...741F 506 CFC741Z 845 CFC741P 1351 - - Show CFC741 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-B/CFC741Q.Seq.d/ Representative seq. ID CFC...741P (Link to Original site) Representative DNA sequence >CFC741 (CFC741Q) /CSM/CF/CFC7-B/CFC...e E Sequences producing significant alignments: (bits) Value CFC741 (CFC741Q) /CSM/CF/CFC7-B/CFC741Q.Seq.d/

  5. Dicty_cDB: CFC308 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC308 (Link to dictyBase) - - - Contig-U14181-1 CFC308P (Link to Original site) CFC...308F 491 CFC308Z 714 CFC308P 1205 - - Show CFC308 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-A/CFC308Q.Seq.d/ Representative seq. ID CFC...308P (Link to Original site) Representative DNA sequence >CFC308 (CFC308Q) /CSM/CF/CFC3-A/CFC...bits) Value SFI477 (SFI477Q) /CSM/SF/SFI4-D/SFI477Q.Seq.d/ 789 0.0 CFC308 (CFC308Q) /CSM/CF/CFC3-A/CFC

  6. Dicty_cDB: CFC679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC679 (Link to dictyBase) - - - Contig-U16560-1 CFC679P (Link to Original site) CFC...679F 121 CFC679Z 796 CFC679P 917 - - Show CFC679 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-D/CFC679Q.Seq.d/ Representative seq. ID CFC...679P (Link to Original site) Representative DNA sequence >CFC679 (CFC679Q) /CSM/CF/CFC6-D/CFC6...ficant alignments: (bits) Value CFC679 (CFC679Q) /CSM/CF/CFC6-D/CFC679Q.Seq.d/ 1518 0.0 CHB384 (CHB384Q) /CS

  7. Dicty_cDB: CFC314 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC314 (Link to dictyBase) - - - Contig-U16368-1 CFC314P (Link to Original site) CFC...314F 543 CFC314Z 650 CFC314P 1193 - - Show CFC314 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-A/CFC314Q.Seq.d/ Representative seq. ID CFC...314P (Link to Original site) Representative DNA sequence >CFC314 (CFC314Q) /CSM/CF/CFC3-A/CFC...SSSATS*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC314 (CFC314Q) /CSM/CF/CFC3-A/CFC

  8. Dicty_cDB: CFC851 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC851 (Link to dictyBase) - - - Contig-U15337-1 CFC851P (Link to Original site) CFC...851F 624 CFC851Z 719 CFC851P 1343 - - Show CFC851 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-C/CFC851Q.Seq.d/ Representative seq. ID CFC...851P (Link to Original site) Representative DNA sequence >CFC851 (CFC851Q) /CSM/CF/CFC8-C/CFC...roducing significant alignments: (bits) Value CFC851 (CFC851Q) /CSM/CF/CFC8-C/CFC851Q.Seq.d/ 2623 0.0 VHQ296

  9. Dicty_cDB: CFC252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC252 (Link to dictyBase) - - - Contig-U16245-1 CFC252P (Link to Original site) CFC...252F 496 CFC252Z 676 CFC252P 1172 - - Show CFC252 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC252Q.Seq.d/ Representative seq. ID CFC...252P (Link to Original site) Representative DNA sequence >CFC252 (CFC252Q) /CSM/CF/CFC2-C/CFC...ing significant alignments: (bits) Value CFC252 (CFC252Q) /CSM/CF/CFC2-C/CFC252Q.Seq.d/ 2278 0.0 SFI736 (SFI

  10. Dicty_cDB: CFC892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC892 (Link to dictyBase) - - - Contig-U16243-1 CFC892P (Link to Original site) CFC...892F 534 CFC892Z 634 CFC892P 1168 - - Show CFC892 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-D/CFC892Q.Seq.d/ Representative seq. ID CFC...892P (Link to Original site) Representative DNA sequence >CFC892 (CFC892Q) /CSM/CF/CFC8-D/CFC...nificant alignments: (bits) Value CFC892 (CFC892Q) /CSM/CF/CFC8-D/CFC892Q.Seq.d/ 2276 0.0 VFM101 (VFM101Q) /

  11. Dicty_cDB: CFC791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC791 (Link to dictyBase) - - - Contig-U16413-1 CFC791P (Link to Original site) CFC...791F 656 CFC791Z 696 CFC791P 1352 - - Show CFC791 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-D/CFC791Q.Seq.d/ Representative seq. ID CFC...791P (Link to Original site) Representative DNA sequence >CFC791 (CFC791Q) /CSM/CF/CFC7-D/CFC...ore E Sequences producing significant alignments: (bits) Value CFC791 (CFC791Q) /CSM/CF/CFC7-D/CFC791Q.Seq.d

  12. Dicty_cDB: CFC658 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC658 (Link to dictyBase) - - - Contig-U16291-1 CFC658P (Link to Original site) CFC...658F 534 CFC658Z 408 CFC658P 942 - - Show CFC658 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-C/CFC658Q.Seq.d/ Representative seq. ID CFC...658P (Link to Original site) Representative DNA sequence >CFC658 (CFC658Q) /CSM/CF/CFC6-C/CFC6...LTW Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC658 (CFC658Q) /CSM/CF/CFC6-C/CFC

  13. Dicty_cDB: CFC645 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC645 (Link to dictyBase) - - - Contig-U16412-1 CFC645P (Link to Original site) CFC...645F 626 CFC645Z 690 CFC645P 1316 - - Show CFC645 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-B/CFC645Q.Seq.d/ Representative seq. ID CFC...645P (Link to Original site) Representative DNA sequence >CFC645 (CFC645Q) /CSM/CF/CFC6-B/CFC... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC645 (CFC645Q) /CSM/CF/CFC6-B/CFC

  14. Dicty_cDB: CFC605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC605 (Link to dictyBase) - - - Contig-U15327-1 CFC605P (Link to Original site) CFC60...5F 581 CFC605Z 729 CFC605P 1310 - - Show CFC605 Library CF (Link to library) Clone ID CFC60...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC605Q.Seq.d/ Representative seq. ID CFC60...5P (Link to Original site) Representative DNA sequence >CFC605 (CFC605Q) /CSM/CF/CFC6-A/CFC60...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC605 (CFC605Q) /CSM/CF/CFC6-A/CFC60

  15. Dicty_cDB: CFC607 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC607 (Link to dictyBase) - - - - CFC607P (Link to Original site) CFC607F 635 CFC60...7Z 741 CFC607P 1376 - - Show CFC607 Library CF (Link to library) Clone ID CFC607 (Link...sukuba.ac.jp/CSM/CF/CFC6-A/CFC607Q.Seq.d/ Representative seq. ID CFC607P (Link to... Original site) Representative DNA sequence >CFC607 (CFC607Q) /CSM/CF/CFC6-A/CFC607Q.Seq.d/ ATTCCACAACACTACA...NXGTLKXKS Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC607 (CFC607Q) /CSM/CF/CFC6-A/CFC60

  16. Dicty_cDB: CFC602 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC602 (Link to dictyBase) - - - Contig-U16240-1 CFC602P (Link to Original site) CFC60...2F 689 CFC602Z 776 CFC602P 1465 - - Show CFC602 Library CF (Link to library) Clone ID CFC60...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC602Q.Seq.d/ Representative seq. ID CFC60...2P (Link to Original site) Representative DNA sequence >CFC602 (CFC602Q) /CSM/CF/CFC6-A/CFC60...ignificant alignments: (bits) Value CFC602 (CFC602Q) /CSM/CF/CFC6-A/CFC602Q.Seq.d/ 2664 0.0 CFJ653 (CFJ653Q)

  17. Global atmospheric chemistry of CFC-123

    Science.gov (United States)

    Prinn, Ronald G.; Golombek, Amram

    1990-01-01

    The compound 1,1-dichloro--2,2,2-trifluoroethane (CFC-123) has been proposed as an industrial substitute for trichlorofluoromethane (CFC-11). The chemical destruction rates of CFC-123 by various processes is calculated here using a three-dimensional global model of the atmosphere, and it is confirmed that the chief sink of CFC-123 is destruction by OH radicals below 12 km, accounting for 88 percent of its loss. The calculated destruction rate is greatest in the equatorial region below 2 km. The calculated steady-state lifetime of CFC-123 is 1.5 years, much shorter than that of CFC-11, the destruction of which is largely confined to the stratosphere. For equal rates of CFC-123 and CFC-11 emission to the atmosphere, the molar content in the atmosphere and the injection rate of chlorine into the stratosphere are, respectively, 48 and 14 times greater for CFC-11 than for CFC-123 in steady state.

  18. [CFC gases in medicinal sprays].

    Science.gov (United States)

    Pedersen, P H; Svendsen, U G

    1989-03-20

    In 1987, approximately 1.18 million aerosol dispensers for medicinal use were sold in Denmark. These contained approximately 29 tons of completely halogenized CFC gases ("Freon") and the preparations were employed for the treatment of bronchial asthma and rhinitis. The possibilities of substitutes are discussed in this article. Preparations are already available which do not contain CFC. Producers of CFC are also attempting to develop new aerosol gases which do not damage the environment. Perhaps these will be found in medicinal preparations in the future.

  19. Dicty_cDB: CFC117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC117 (Link to dictyBase) - - - - CFC117F (Link to Original site) CFC...117F 118 - - - - - - Show CFC117 Library CF (Link to library) Clone ID CFC117 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-A/CFC...117Q.Seq.d/ Representative seq. ID CFC117F (Link to Original site) R...epresentative DNA sequence >CFC117 (CFC117Q) /CSM/CF/CFC1-A/CFC117Q.Seq.d/ AGTATTTTGTTCATATTCAAATTAAATATCAAT

  20. Dicty_cDB: CFC577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC577 (Link to dictyBase) - - - Contig-U16455-1 CFC577P (Link to Original site) CFC...577F 643 CFC577Z 708 CFC577P 1351 - - Show CFC577 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-D/CFC577Q.Seq.d/ Representative seq. ID CFC...577P (Link to Original site) Representative DNA sequence >CFC577 (CFC577Q) /CSM/CF/CFC5-D/CFC...somal >> prediction for CFC577 is cyt 5' end seq. ID CFC577F 5' end seq. >CFC577F.Seq AATTTTATTCATTAATTTATTA

  1. Dicty_cDB: CFC817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC817 (Link to dictyBase) - - - Contig-U16477-1 CFC817P (Link to Original site) CFC...817F 600 CFC817Z 658 CFC817P 1258 - - Show CFC817 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-A/CFC817Q.Seq.d/ Representative seq. ID CFC...817P (Link to Original site) Representative DNA sequence >CFC817 (CFC817Q) /CSM/CF/CFC8-A/CFC...es of secretory system >> prediction for CFC817 is nuc 5' end seq. ID CFC817F 5' end seq. >CFC

  2. Dicty_cDB: CFC812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC812 (Link to dictyBase) - - - Contig-U13381-1 CFC812P (Link to Original site) CFC...812F 109 CFC812Z 281 CFC812P 390 - - Show CFC812 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-A/CFC812Q.Seq.d/ Representative seq. ID CFC...812P (Link to Original site) Representative DNA sequence >CFC812 (CFC812Q) /CSM/CF/CFC8-A/CFC8...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC812 (CFC812Q) /CSM/CF/CFC

  3. Dicty_cDB: CFC533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC533 (Link to dictyBase) - - - Contig-U16381-1 CFC533P (Link to Original site) CFC...533F 124 CFC533Z 652 CFC533P 776 - - Show CFC533 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-B/CFC533Q.Seq.d/ Representative seq. ID CFC...533P (Link to Original site) Representative DNA sequence >CFC533 (CFC533Q) /CSM/CF/CFC5-B/CFC5...0 %: mitochondrial 4.0 %: plasma membrane >> prediction for CFC533 is nuc 5' end seq. ID CFC533F 5' end seq. >CFC

  4. Dicty_cDB: CFC719 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC719 (Link to dictyBase) - - - Contig-U15887-1 CFC719P (Link to Original site) CFC...719F 617 CFC719Z 114 CFC719P 731 - - Show CFC719 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-A/CFC719Q.Seq.d/ Representative seq. ID CFC...719P (Link to Original site) Representative DNA sequence >CFC719 (CFC719Q) /CSM/CF/CFC7-A/CFC7...k*kkkikk*krynkik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC719 (CFC719Q) /CSM/CF/CFC

  5. Dicty_cDB: CFC728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC728 (Link to dictyBase) - - - Contig-U09897-1 CFC728E (Link to Original site) CFC...728F 596 CFC728Z 778 CFC728P 1374 CFC728E 1245 Show CFC728 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-B/CFC728Q.Seq.d/ Representative seq. ID CFC...728E (Link to Original site) Representative DNA sequence >CFC728 (CFC728Q) /CSM/CF/CFC7-B/CFC...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC728 (CFC

  6. Dicty_cDB: CFC427 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC427 (Link to dictyBase) - - - Contig-U16450-1 CFC427P (Link to Original site) CFC...427F 533 CFC427Z 747 CFC427P 1280 - - Show CFC427 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-B/CFC427Q.Seq.d/ Representative seq. ID CFC...427P (Link to Original site) Representative DNA sequence >CFC427 (CFC427Q) /CSM/CF/CFC4-B/CFC...FYAITLSVMXF K*xiirvqsis Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC427 (CFC

  7. Dicty_cDB: CFC583 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC583 (Link to dictyBase) - - - Contig-U15309-1 CFC583Z (Link... to Original site) - - CFC583Z 630 - - - - Show CFC583 Library CF (Link to library) Clone ID CFC583 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-D/CFC583Q.Seq.d/ Representative seq. ID CFC58...3Z (Link to Original site) Representative DNA sequence >CFC583 (CFC583Q) /CSM/CF/CFC5-D/CFC583Q.Seq.d/ XXXXX...lignments: (bits) Value CFC583 (CFC583Q) /CSM/CF/CFC5-D/CFC583Q.Seq.d/ 1201 0.0 SFJ215 (SFJ215Q) /CSM/SF/SFJ

  8. Dicty_cDB: CFC881 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC881 (Link to dictyBase) - - - Contig-U16249-1 CFC881F (Link to Original site) CFC...881F 587 - - - - - - Show CFC881 Library CF (Link to library) Clone ID CFC881 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-D/CFC881Q.Seq.d/ Representative seq. ID CFC88...1F (Link to Original site) Representative DNA sequence >CFC881 (CFC881Q) /CSM/CF/CFC8-D/CFC881Q.Seq.d/ AAAAC...cant alignments: (bits) Value SLA503 (SLA503Q) /CSM/SL/SLA5-A/SLA503Q.Seq.d/ 961 0.0 CFC881 (CFC881Q) /CSM/CF/CFC8-D/CFC

  9. Dicty_cDB: CFC509 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC509 (Link to dictyBase) - - - Contig-U15333-1 CFC509P (Link to Original site) CFC...509F 586 CFC509Z 739 CFC509P 1325 - - Show CFC509 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-A/CFC509Q.Seq.d/ Representative seq. ID CFC...509P (Link to Original site) Representative DNA sequence >CFC509 (CFC509Q) /CSM/CF/CFC5-A/CFC...ytmls*rlklsiiignv fs*if*kn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC509 (CFC

  10. Dicty_cDB: CFC564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC564 (Link to dictyBase) - - - Contig-U16358-1 CFC564F (Link to Original site) CFC...564F 609 - - - - - - Show CFC564 Library CF (Link to library) Clone ID CFC564 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-C/CFC564Q.Seq.d/ Representative seq. ID CFC56...4F (Link to Original site) Representative DNA sequence >CFC564 (CFC564Q) /CSM/CF/CFC5-C/CFC564Q.Seq.d/ ACTTC... 1207 0.0 CFD614 (CFD614Q) /CSM/CF/CFD6-A/CFD614Q.Seq.d/ 1207 0.0 CFC564 (CFC564Q) /CSM/CF/CFC5-C/CFC564Q.Se

  11. Dicty_cDB: CFC147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC147 (Link to dictyBase) - - - Contig-U16381-1 CFC147F (Link to Original site) CFC...147F 122 - - - - - - Show CFC147 Library CF (Link to library) Clone ID CFC147 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-B/CFC147Q.Seq.d/ Representative seq. ID CFC14...7F (Link to Original site) Representative DNA sequence >CFC147 (CFC147Q) /CSM/CF/CFC1-B/CFC147Q.Seq.d/ TACAT...nificant alignments: (bits) Value CFC147 (CFC147Q) /CSM/CF/CFC1-B/CFC147Q.Seq.d/ 218 1e-56 SLK648 (SLK648Q)

  12. Dicty_cDB: CFC844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC844 (Link to dictyBase) - - - Contig-U16455-1 CFC844P (Link to Original site) CFC...844F 625 CFC844Z 745 CFC844P 1370 - - Show CFC844 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-B/CFC844Q.Seq.d/ Representative seq. ID CFC...844P (Link to Original site) Representative DNA sequence >CFC844 (CFC844Q) /CSM/CF/CFC8-B/CFC...rkvlllhqrrnk *xkknfiii* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC844 (CFC

  13. Dicty_cDB: CFC872 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC872 (Link to dictyBase) - - - Contig-U16524-1 CFC872P (Link to Original site) CFC...872F 183 CFC872Z 129 CFC872P 312 - - Show CFC872 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-C/CFC872Q.Seq.d/ Representative seq. ID CFC...872P (Link to Original site) Representative DNA sequence >CFC872 (CFC872Q) /CSM/CF/CFC8-C/CFC8...ysynl*ll*xnyvyiyk*llls Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC872 (CFC

  14. Dicty_cDB: CFC612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC612 (Link to dictyBase) - - - Contig-U16368-1 CFC612Z (Link... to Original site) - - CFC612Z 435 - - - - Show CFC612 Library CF (Link to library) Clone ID CFC612 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC612Q.Seq.d/ Representative seq. ID CFC61...2Z (Link to Original site) Representative DNA sequence >CFC612 (CFC612Q) /CSM/CF/CFC6-A/CFC612Q.Seq.d/ XXXXX... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC612 (CFC612Q) /CSM/CF/CFC6-A/CFC

  15. Dicty_cDB: CFC585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC585 (Link to dictyBase) - - - Contig-U16081-1 CFC585P (Link to Original site) CFC...585F 524 CFC585Z 549 CFC585P 1073 - - Show CFC585 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-D/CFC585Q.Seq.d/ Representative seq. ID CFC...585P (Link to Original site) Representative DNA sequence >CFC585 (CFC585Q) /CSM/CF/CFC5-D/CFC...*xnlnkkiknkik *kkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC585 (CFC

  16. Dicty_cDB: CFC467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC467 (Link to dictyBase) - - - Contig-U13522-1 CFC467Z (Link... to Original site) - - CFC467Z 235 - - - - Show CFC467 Library CF (Link to library) Clone ID CFC467 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-C/CFC467Q.Seq.d/ Representative seq. ID CFC46...7Z (Link to Original site) Representative DNA sequence >CFC467 (CFC467Q) /CSM/CF/CFC4-C/CFC467Q.Seq.d/ XXXXX...i Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC467 (CFC467Q) /CSM/CF/CFC4-C/CFC

  17. Dicty_cDB: CFC346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC346 (Link to dictyBase) - - - Contig-U10808-1 CFC346Z (Link... to Original site) - - CFC346Z 172 - - - - Show CFC346 Library CF (Link to library) Clone ID CFC346 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-B/CFC346Q.Seq.d/ Representative seq. ID CFC34...6Z (Link to Original site) Representative DNA sequence >CFC346 (CFC346Q) /CSM/CF/CFC3-B/CFC346Q.Seq.d/ XXXXX...ucing significant alignments: (bits) Value CFC346 (CFC346Q) /CSM/CF/CFC3-B/CFC346Q.Seq.d/ 305 1e-82 VSJ366 (

  18. Dicty_cDB: CFC352 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC352 (Link to dictyBase) - - - Contig-U08174-1 CFC352Z (Link... to Original site) - - CFC352Z 543 - - - - Show CFC352 Library CF (Link to library) Clone ID CFC352 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-C/CFC352Q.Seq.d/ Representative seq. ID CFC35...2Z (Link to Original site) Representative DNA sequence >CFC352 (CFC352Q) /CSM/CF/CFC3-C/CFC352Q.Seq.d/ XXXXX...ignificant alignments: (bits) Value CFC352 (CFC352Q) /CSM/CF/CFC3-C/CFC352Q.Seq.d/ 1076 0.0 SFE582 (SFE582Q)

  19. Dicty_cDB: CFC294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC294 (Link to dictyBase) - - - Contig-U16381-1 CFC294F (Link to Original site) CFC...294F 124 - - - - - - Show CFC294 Library CF (Link to library) Clone ID CFC294 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC294Q.Seq.d/ Representative seq. ID CFC29...4F (Link to Original site) Representative DNA sequence >CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC294Q.Seq.d/ ATTGT...CFF876 (CFF876Q) /CSM/CF/CFF8-D/CFF876Q.Seq.d/ 157 5e-38 CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC

  20. Dicty_cDB: CFC180 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC180 (Link to dictyBase) - - - Contig-U03116-1 CFC180Z (Link... to Original site) - - CFC180Z 566 - - - - Show CFC180 Library CF (Link to library) Clone ID CFC180 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-D/CFC180Q.Seq.d/ Representative seq. ID CFC18...0Z (Link to Original site) Representative DNA sequence >CFC180 (CFC180Q) /CSM/CF/CFC1-D/CFC180Q.Seq.d/ XXXXX...xkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC180 (CFC180Q) /CSM/CF/CFC1-D/CFC

  1. Dicty_cDB: CFC696 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC696 (Link to dictyBase) - - - Contig-U16470-1 CFC696P (Link to Original site) CFC...696F 646 CFC696Z 679 CFC696P 1325 - - Show CFC696 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-D/CFC696Q.Seq.d/ Representative seq. ID CFC...696P (Link to Original site) Representative DNA sequence >CFC696 (CFC696Q) /CSM/CF/CFC6-D/CFC...dtsaaaiivtl*fqi*rnkxs Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC696 (CFC

  2. Dicty_cDB: CFC476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC476 (Link to dictyBase) - - - Contig-U15745-1 CFC476Z (Link... to Original site) - - CFC476Z 662 - - - - Show CFC476 Library CF (Link to library) Clone ID CFC476 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-D/CFC476Q.Seq.d/ Representative seq. ID CFC47...6Z (Link to Original site) Representative DNA sequence >CFC476 (CFC476Q) /CSM/CF/CFC4-D/CFC476Q.Seq.d/ XXXXX...CHL6-B/CHL635Q.Seq.d/ 1092 0.0 CFC476 (CFC476Q) /CSM/CF/CFC4-D/CFC476Q.Seq.d/ 109

  3. Dicty_cDB: CFC673 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC673 (Link to dictyBase) - - - Contig-U16475-1 CFC673P (Link to Original site) CFC...673F 567 CFC673Z 636 CFC673P 1203 - - Show CFC673 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-D/CFC673Q.Seq.d/ Representative seq. ID CFC...673P (Link to Original site) Representative DNA sequence >CFC673 (CFC673Q) /CSM/CF/CFC6-D/CFC...*kstl*ltninpkt*fikscivliliffqsyfh Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC673 (CFC

  4. Dicty_cDB: CFC270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC270 (Link to dictyBase) - - - Contig-U16058-1 CFC270Z (Link... to Original site) - - CFC270Z 688 - - - - Show CFC270 Library CF (Link to library) Clone ID CFC270 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC270Q.Seq.d/ Representative seq. ID CFC27...0Z (Link to Original site) Representative DNA sequence >CFC270 (CFC270Q) /CSM/CF/CFC2-C/CFC270Q.Seq.d/ XXXXX...ences producing significant alignments: (bits) Value CFC270 (CFC270Q) /CSM/CF/CFC2-C/CFC

  5. Dicty_cDB: CFC773 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC773 (Link to dictyBase) - - - Contig-U16464-1 CFC773Z (Link... to Original site) - - CFC773Z 655 - - - - Show CFC773 Library CF (Link to library) Clone ID CFC773 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-D/CFC773Q.Seq.d/ Representative seq. ID CFC77...3Z (Link to Original site) Representative DNA sequence >CFC773 (CFC773Q) /CSM/CF/CFC7-D/CFC773Q.Seq.d/ XXXXX...mology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC773 (CFC773Q) /CSM/CF/CFC7-D/CFC

  6. Dicty_cDB: CFC559 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC559 (Link to dictyBase) - - - Contig-U14181-1 CFC559Z (Link... to Original site) - - CFC559Z 611 - - - - Show CFC559 Library CF (Link to library) Clone ID CFC559 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-C/CFC559Q.Seq.d/ Representative seq. ID CFC55...9Z (Link to Original site) Representative DNA sequence >CFC559 (CFC559Q) /CSM/CF/CFC5-C/CFC559Q.Seq.d/ XXXXX...k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC559 (CFC559Q) /CSM/CF/CFC5-C/CFC

  7. Dicty_cDB: CFC551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC551 (Link to dictyBase) - - - Contig-U16381-1 CFC551P (Link to Original site) CFC...551F 121 CFC551Z 718 CFC551P 839 - - Show CFC551 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-C/CFC551Q.Seq.d/ Representative seq. ID CFC...551P (Link to Original site) Representative DNA sequence >CFC551 (CFC551Q) /CSM/CF/CFC5-C/CFC5...2.0 %: nuclear 20.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CFC551 is nuc 5' end seq. ID CFC

  8. Dicty_cDB: CFC652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC652 (Link to dictyBase) - - - Contig-U02523-1 CFC652Z (Link... to Original site) - - CFC652Z 713 - - - - Show CFC652 Library CF (Link to library) Clone ID CFC652 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-C/CFC652Q.Seq.d/ Representative seq. ID CFC65...2Z (Link to Original site) Representative DNA sequence >CFC652 (CFC652Q) /CSM/CF/CFC6-C/CFC652Q.Seq.d/ XXXXX...icant alignments: (bits) Value CFF277 (CFF277Q) /CSM/CF/CFF2-D/CFF277Q.Seq.d/ 569 e-161 CFC652 (CFC652Q) /CSM/CF/CFC6-C/CFC

  9. Dicty_cDB: CFC838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC838 (Link to dictyBase) - - - Contig-U16511-1 CFC838P (Link to Original site) CFC...838F 176 CFC838Z 674 CFC838P 850 - - Show CFC838 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-B/CFC838Q.Seq.d/ Representative seq. ID CFC...838P (Link to Original site) Representative DNA sequence >CFC838 (CFC838Q) /CSM/CF/CFC8-B/CFC8....0 %: cytoskeletal 4.0 %: plasma membrane 4.0 %: endoplasmic reticulum >> prediction for CFC838 is nuc 5' end seq. ID CFC

  10. Dicty_cDB: CFC190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC190 (Link to dictyBase) - - - Contig-U14174-1 CFC190F (Link to Original site) CFC...190F 638 - - - - - - Show CFC190 Library CF (Link to library) Clone ID CFC190 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-D/CFC190Q.Seq.d/ Representative seq. ID CFC19...0F (Link to Original site) Representative DNA sequence >CFC190 (CFC190Q) /CSM/CF/CFC1-D/CFC190Q.Seq.d/ ATTTT...cing significant alignments: (bits) Value CFC190 (CFC190Q) /CSM/CF/CFC1-D/CFC190Q.Seq.d/ 1229 0.0 SFG650 (SF

  11. Dicty_cDB: CFC461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC461 (Link to dictyBase) - - - Contig-U16358-1 CFC461F (Link to Original site) CFC...461F 563 - - - - - - Show CFC461 Library CF (Link to library) Clone ID CFC461 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-C/CFC461Q.Seq.d/ Representative seq. ID CFC46...1F (Link to Original site) Representative DNA sequence >CFC461 (CFC461Q) /CSM/CF/CFC4-C/CFC461Q.Seq.d/ ACAAA...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC461 (CFC461Q) /CSM/CF/CFC4-C/CFC

  12. Dicty_cDB: CFC121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC121 (Link to dictyBase) - - - Contig-U16511-1 CFC121Z (Link... to Original site) - - CFC121Z 525 - - - - Show CFC121 Library CF (Link to library) Clone ID CFC121 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-A/CFC121Q.Seq.d/ Representative seq. ID CFC12...1Z (Link to Original site) Representative DNA sequence >CFC121 (CFC121Q) /CSM/CF/CFC1-A/CFC121Q.Seq.d/ XXXXX...cDNA Score E Sequences producing significant alignments: (bits) Value CFC121 (CFC121Q) /CSM/CF/CFC1-A/CFC

  13. Dicty_cDB: CFC621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC621 (Link to dictyBase) - - - Contig-U16255-1 CFC621Z (Link... to Original site) - - CFC621Z 683 - - - - Show CFC621 Library CF (Link to library) Clone ID CFC621 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC621Q.Seq.d/ Representative seq. ID CFC62...1Z (Link to Original site) Representative DNA sequence >CFC621 (CFC621Q) /CSM/CF/CFC6-A/CFC621Q.Seq.d/ XXXXX...ing significant alignments: (bits) Value CFC621 (CFC621Q) /CSM/CF/CFC6-A/CFC621Q.

  14. Dicty_cDB: CFC604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC604 (Link to dictyBase) - - - Contig-U15823-1 CFC604F (Link to Original site) CFC60...4F 594 - - - - - - Show CFC604 Library CF (Link to library) Clone ID CFC604 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC604Q.Seq.d/ Representative seq. ID CFC60...4F (Link to Original site) Representative DNA sequence >CFC604 (CFC604Q) /CSM/CF/CFC6-A/CFC604Q.Seq.d/ ATATA... producing significant alignments: (bits) Value CFC604 (CFC604Q) /CSM/CF/CFC6-A/CFC604Q.Seq.d/ 1041 0.0 VFF8

  15. Dicty_cDB: CFC609 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC609 (Link to dictyBase) - - - Contig-U16050-1 CFC609P (Link to Original site) CFC60...9F 518 CFC609Z 683 CFC609P 1201 - - Show CFC609 Library CF (Link to library) Clone ID CFC60...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC609Q.Seq.d/ Representative seq. ID CFC60...9P (Link to Original site) Representative DNA sequence >CFC609 (CFC609Q) /CSM/CF/CFC6-A/CFC60...FNKYKSQYHIIASKRCKRFRFIN Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC609 (CFC60

  16. Dicty_cDB: CFC603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC603 (Link to dictyBase) - - - Contig-U15329-1 CFC603Z (Link... to Original site) - - CFC603Z 393 - - - - Show CFC603 Library CF (Link to library) Clone ID CFC603 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC603Q.Seq.d/ Representative seq. ID CFC60...3Z (Link to Original site) Representative DNA sequence >CFC603 (CFC603Q) /CSM/CF/CFC6-A/CFC603Q.Seq.d/ XXXXX...Sequences producing significant alignments: (bits) Value CFC603 (CFC603Q) /CSM/CF/CFC6-A/CFC60

  17. CFC index for the diagnosis of cardiofaciocutaneous syndrome

    OpenAIRE

    Kavamura, Maria Ines; Peres, Clovis de Araujo [UNIFESP; Alchorne,Maurício Mota de Avelar; Brunoni, Decio [UNIFESP

    2002-01-01

    Controversy exists concerning the delineation of cardiofaciocutaneous syndrome (CFC). Many authors have attempted to establish syndrome traits for CFC, but to date none are pathognomonic or obligatory. We have created a clinical and objective method, called the CFC index, for CFC diagnosis. This method also differentiates CFC from Noonan syndrome and Costello syndrome, CFC's main differential diagnosis. We propose the use of the CFC index for the confirmation of CFC diagnosis and to different...

  18. Degradation rates of CFC-11, CFC-12 and CFC-113 in anoxic shallow aquifers of Araihazar, Bangladesh.

    Science.gov (United States)

    Horneman, A; Stute, M; Schlosser, P; Smethie, W; Santella, N; Ho, D T; Mailloux, B; Gorman, E; Zheng, Y; van Geen, A

    2008-04-04

    Chlorofluorocarbons CFC-11 (CCl(3)F), CFC-12 (CCl(2)F(2)), and CFC-113 (CCl(2)F-CClF(2)) are used in hydrology as transient tracers under the assumption of conservative behavior in the unsaturated and saturated soil zones. However, laboratory and field studies have shown that these compounds are not stable under anaerobic conditions. To determine the degradation rates of CFCs in a tropical environment, atmospheric air, unsaturated zone soil gas, and anoxic groundwater samples were collected in Araihazar upazila, Bangladesh. Observed CFC concentrations in both soil gas and groundwater were significantly below those expected from atmospheric levels. The CFC deficits in the unsaturated zone can be explained by gas exchange with groundwater undersaturated in CFCs. The CFC deficits observed in (3)H/(3)He dated groundwater were used to estimate degradation rates in the saturated zone. The results show that CFCs are degraded to the point where practically no (CFC-11, CFC-12, or CFC-113 remains in groundwater with (3)H/(3)He ages above 10 yr. In groundwater sampled at our site CFC-11 and CFC-12 appear to degrade at similar rates with estimated degradation rates ranging from approximately 0.25 yr(-1) to approximately 6 yr(-1). Degradation rates increased as a function of reducing conditions. This indicates that CFC dating of groundwater in regions of humid tropical climate has to be carried out with great caution.

  19. Dicty_cDB: CFC155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC155 (Link to dictyBase) - - - Contig-U16295-1 CFC155P (Link to Original site) CFC...155F 577 CFC155Z 583 CFC155P 1160 - - Show CFC155 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-C/CFC155Q.Seq.d/ Representative seq. ID CFC...155P (Link to Original site) Representative DNA sequence >CFC155 (CFC155Q) /CSM/CF/CFC1-C/CFC...lklivyhvki*ialpkd*nvyp lkltgikilhvetvan Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC

  20. Dicty_cDB: CFC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC218 (Link to dictyBase) - - - Contig-U14180-1 CFC218E (Link to Original site) CFC...218F 524 CFC218Z 783 CFC218P 1307 CFC218E 1195 Show CFC218 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-A/CFC218Q.Seq.d/ Representative seq. ID CFC...218E (Link to Original site) Representative DNA sequence >CFC218 (CFC218Q) /CSM/CF/CFC2-A/CFC...*kry* as*rv**ssty*kw*yk*sicfcpswwfvq*iw*pw*lw*s*q*w*c*sig*swrnh*ws crs*ng*ssf***f*ses***tllvkmsnlffgnsp*ryyp

  1. Dicty_cDB: CFC802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC802 (Link to dictyBase) - - - Contig-U16381-1 CFC802P (Link to Original site) CFC...802F 118 CFC802Z 685 CFC802P 803 - - Show CFC802 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-A/CFC802Q.Seq.d/ Representative seq. ID CFC...802P (Link to Original site) Representative DNA sequence >CFC802 (CFC802Q) /CSM/CF/CFC8-A/CFC8...3a: 0.00 m3b: 0.00 m_ : 1.00 72.0 %: nuclear 16.0 %: cytoplasmic 8.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CFC

  2. Dicty_cDB: CFC283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC283 (Link to dictyBase) - - - Contig-U16381-1 CFC283P (Link to Original site) CFC...283F 124 CFC283Z 593 CFC283P 717 - - Show CFC283 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC283Q.Seq.d/ Representative seq. ID CFC...283P (Link to Original site) Representative DNA sequence >CFC283 (CFC283Q) /CSM/CF/CFC2-D/CFC2...1.00 64.0 %: nuclear 28.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CFC

  3. Dicty_cDB: CFC820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC820 (Link to dictyBase) - - - Contig-U16381-1 CFC820P (Link to Original site) CFC...820F 152 CFC820Z 723 CFC820P 875 - - Show CFC820 Library CF (Link to library) Clone ID CFC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-A/CFC820Q.Seq.d/ Representative seq. ID CFC...820P (Link to Original site) Representative DNA sequence >CFC820 (CFC820Q) /CSM/CF/CFC8-A/CFC8...r 24.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CFC

  4. Dicty_cDB: CFC228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC228 (Link to dictyBase) - - - Contig-U16241-1 CFC228P (Link to Original site) CFC...228F 546 CFC228Z 739 CFC228P 1285 - - Show CFC228 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-B/CFC228Q.Seq.d/ Representative seq. ID CFC...228P (Link to Original site) Representative DNA sequence >CFC228 (CFC228Q) /CSM/CF/CFC2-B/CFC...nccnfyfrfscfni*kkticcfklfwxxxr rdlkink* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC

  5. Dicty_cDB: CFC107 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC107 (Link to dictyBase) - - - Contig-U16256-1 CFC107F (Link to Original site) CFC...107F 171 - - - - - - Show CFC107 Library CF (Link to library) Clone ID CFC107 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-A/CFC107Q.Seq.d/ Representative seq. ID CFC10...7F (Link to Original site) Representative DNA sequence >CFC107 (CFC107Q) /CSM/CF/CFC1-A/CFC107Q.Seq.d/ ACTGT...mitochondrial 4.0 %: plasma membrane >> prediction for CFC107 is nuc 5' end seq. ID CFC107F 5' end seq. >CFC

  6. Dicty_cDB: CFC626 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC626 (Link to dictyBase) - - - Contig-U16419-1 CFC626F (Link to Original site) CFC...626F 604 - - - - - - Show CFC626 Library CF (Link to library) Clone ID CFC626 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-B/CFC626Q.Seq.d/ Representative seq. ID CFC62...6F (Link to Original site) Representative DNA sequence >CFC626 (CFC626Q) /CSM/CF/CFC6-B/CFC626Q.Seq.d/ ATTCA... endoplasmic reticulum 8.0 %: nuclear >> prediction for CFC626 is exc 5' end seq. ID CFC626F 5' end seq. >CFC

  7. Dicty_cDB: CFC375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC375 (Link to dictyBase) - - - Contig-U16561-1 CFC375Z (Link... to Original site) - - CFC375Z 787 - - - - Show CFC375 Library CF (Link to library) Clone ID CFC375 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-D/CFC375Q.Seq.d/ Representative seq. ID CFC37...5Z (Link to Original site) Representative DNA sequence >CFC375 (CFC375Q) /CSM/CF/CFC3-D/CFC375Q.Seq.d/ XXXXX...NIENVKTKIQDK* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC375 (CFC375Q) /CSM/CF/CFC

  8. Dicty_cDB: CFC601 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC601 (Link to dictyBase) - - - Contig-U16368-1 CFC601P (Link to Original site) CFC60...1F 557 CFC601Z 566 CFC601P 1123 - - Show CFC601 Library CF (Link to library) Clone ID CFC60...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-A/CFC601Q.Seq.d/ Representative seq. ID CFC60...1P (Link to Original site) Representative DNA sequence >CFC601 (CFC601Q) /CSM/CF/CFC6-A/CFC60... %: vacuolar 4.0 %: mitochondrial 4.0 %: vesicles of secretory system 4.0 %: nuclear >> prediction for CFC60

  9. 76 FR 55424 - CFC-50 Commission

    Science.gov (United States)

    2011-09-07

    ... MANAGEMENT CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Establishment of advisory committee. SUMMARY: The U.S. Office of Personnel Management announces the establishment of the CFC-50... (CFC) to ensure its continued growth and success. The Commission is an advisory committee composed of...

  10. Dicty_cDB: CFC379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC379 (Link to dictyBase) - - - Contig-U16399-1 CFC379P (Link to Original site) CFC...379F 505 CFC379Z 597 CFC379P 1102 - - Show CFC379 Library CF (Link to library) Clone ID CFC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-D/CFC379Q.Seq.d/ Representative seq. ID CFC...379P (Link to Original site) Representative DNA sequence >CFC379 (CFC379Q) /CSM/CF/CFC3-D/CFC...iscssilfrdfke*rfhsfiretnvgystk*kiflys*simyfcfcsww*i*t r*wf*ycssty**skf*s*tsiks*iswistswc*niwwwimvymv*s--- --

  11. Dicty_cDB: CFC395 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC395 (Link to dictyBase) - - - Contig-U15687-1 | Contig-U16343-1 CFC...395P (Link to Original site) CFC395F 213 CFC395Z 477 CFC395P 690 - - Show CFC395 Library CF (Link to library) Clone ID CFC...87-1 | Contig-U16343-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC3-D/CFC...395Q.Seq.d/ Representative seq. ID CFC395P (Link to Original site) Representative DNA sequence >CFC395 (CFC...395Q) /CSM/CF/CFC3-D/CFC395Q.Seq.d/ GTATACGGCCATACTAGGTTGGAAACACATCATCCCGTTCGATCTGATAAGTAAATCGAC

  12. Dicty_cDB: CFC883 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC883 (Link to dictyBase) - - - Contig-U16368-1 CFC883Z (Link... to Original site) - - CFC883Z 202 - - - - Show CFC883 Library CF (Link to library) Clone ID CFC883 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC8-D/CFC883Q.Seq.d/ Representative seq. ID CFC88...3Z (Link to Original site) Representative DNA sequence >CFC883 (CFC883Q) /CSM/CF/CFC8-D/CFC883Q.Seq.d/ XXXXX...lhpllqvalhplpqvvlhhh qlqvqaaxi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC883 (CFC

  13. Dicty_cDB: CFC454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC454 (Link to dictyBase) - - - Contig-U16381-1 CFC454F (Link to Original site) CFC...454F 124 - - - - - - Show CFC454 Library CF (Link to library) Clone ID CFC454 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-C/CFC454Q.Seq.d/ Representative seq. ID CFC45...4F (Link to Original site) Representative DNA sequence >CFC454 (CFC454Q) /CSM/CF/CFC4-C/CFC454Q.Seq.d/ ATTGT...5.12 PSORT - 5' end seq. ID CFC454F 5' end seq. >CFC454F.Seq ATTGTAGTATTTTGTTCATATTCAAATTAAATATCAATACAATTAAA

  14. Dicty_cDB: CFC785 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC785 (Link to dictyBase) - - - - CFC785P (Link to Original site) CFC785F 584 CFC...785Z 501 CFC785P 1085 - - Show CFC785 Library CF (Link to library) Clone ID CFC785 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC...7-D/CFC785Q.Seq.d/ Representative seq. ID CFC785P (Link to... Original site) Representative DNA sequence >CFC785 (CFC785Q) /CSM/CF/CFC7-D/CFC785Q.Seq.d/ ACTTCACAAAAAACAT

  15. Dicty_cDB: CFC764 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC764 (Link to dictyBase) - - - Contig-U16086-1 | Contig-U16524-1 CFC...764P (Link to Original site) CFC764F 303 CFC764Z 393 CFC764P 696 - - Show CFC764 Library CF (Link to library) Clone ID CFC...86-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-C/CFC...764Q.Seq.d/ Representative seq. ID CFC764P (Link to Original site) Representative DNA sequence >CFC764 (CFC...764Q) /CSM/CF/CFC7-C/CFC764Q.Seq.d/ AAATAATTTATCGCTGTGTACAAATATTCATTGAAGATTGTTTAATCATTTTTAATCATA

  16. Dicty_cDB: CFC641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC641 (Link to dictyBase) - - - - CFC641P (Link to Original site) CFC641F 616 CFC...641Z 745 CFC641P 1361 - - Show CFC641 Library CF (Link to library) Clone ID CFC641 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC...6-B/CFC641Q.Seq.d/ Representative seq. ID CFC641P (Link to... Original site) Representative DNA sequence >CFC641 (CFC641Q) /CSM/CF/CFC6-B/CFC641Q.Seq.d/ CTCTCCTTACCATTGA

  17. Dicty_cDB: CFC762 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC762 (Link to dictyBase) - G21744 DDB0216167 Contig-U15409-1 CFC...762P (Link to Original site) CFC762F 538 CFC762Z 612 CFC762P 1150 - - Show CFC762 Library CF (Link to library) Clone ID CFC...Contig-U15409-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-C/CFC...762Q.Seq.d/ Representative seq. ID CFC762P (Link to Original site) Representative DNA sequence >CFC762 (CFC762Q) /CSM/CF/CFC...7-C/CFC762Q.Seq.d/ AAATATTAAACAATTATTCAATTGGAAATTTAAAATCATTTGTGATGAATGTAAAGAAAA TACTGAA

  18. Dicty_cDB: CFC503 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC503 (Link to dictyBase) - - - - CFC503P (Link to Original site) CFC503F 579 CFC...503Z 750 CFC503P 1329 - - Show CFC503 Library CF (Link to library) Clone ID CFC503 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC...5-A/CFC503Q.Seq.d/ Representative seq. ID CFC503P (Link to... Original site) Representative DNA sequence >CFC503 (CFC503Q) /CSM/CF/CFC5-A/CFC503Q.Seq.d/ ATTATTGTTAAAATAA

  19. Dicty_cDB: CFC101 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC101 (Link to dictyBase) - - - Contig-U16381-1 CFC101F (Link to Original site) CFC...101F 131 - - - - - - Show CFC101 Library CF (Link to library) Clone ID CFC101 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC1-A/CFC101Q.Seq.d/ Representative seq. ID CFC10...1F (Link to Original site) Representative DNA sequence >CFC101 (CFC101Q) /CSM/CF/CFC1-A/CFC101Q.Seq.d/ ATTAA...ein update 2009. 5.12 PSORT - 5' end seq. ID CFC101F 5' end seq. >CFC101F.Seq ATTAAATCATTGTAGTATTTTGTTCATATT

  20. Dicty_cDB: CFC142 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC142 (Link to dictyBase) - - - - CFC142P (Link to Original site) CFC142F 622 CFC...142Z 735 CFC142P 1357 - - Show CFC142 Library CF (Link to library) Clone ID CFC142 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC...1-B/CFC142Q.Seq.d/ Representative seq. ID CFC142P (Link to... Original site) Representative DNA sequence >CFC142 (CFC142Q) /CSM/CF/CFC1-B/CFC142Q.Seq.d/ ACACAACACTACAAAA

  1. Dicty_cDB: CFC530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC530 (Link to dictyBase) - - - Contig-U12846-1 CFC530Z (Link... to Original site) - - CFC530Z 701 - - - - Show CFC530 Library CF (Link to library) Clone ID CFC530 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-B/CFC530Q.Seq.d/ Representative seq. ID CFC53...0Z (Link to Original site) Representative DNA sequence >CFC530 (CFC530Q) /CSM/CF/CFC5-B/CFC530Q.Seq.d/ XXXXX...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC530 (CFC

  2. Dicty_cDB: CFC458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC458 (Link to dictyBase) - - - Contig-U16510-1 | Contig-U16524-1 CFC...458P (Link to Original site) CFC458F 166 CFC458Z 389 CFC458P 555 - - Show CFC458 Library CF (Link to library) Clone ID CFC...10-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-C/CFC...458Q.Seq.d/ Representative seq. ID CFC458P (Link to Original site) Representative DNA sequence >CFC458 (CFC...458Q) /CSM/CF/CFC4-C/CFC458Q.Seq.d/ AACTCAGTAATAATAATAATAAAAATAATAACAATAATAAGGAATTATAATCAAATAATA

  3. Dicty_cDB: CFC731 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC731 (Link to dictyBase) - - - Contig-U16264-1 CFC731Z (Link... to Original site) - - CFC731Z 571 - - - - Show CFC731 Library CF (Link to library) Clone ID CFC731 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-B/CFC731Q.Seq.d/ Representative seq. ID CFC73...1Z (Link to Original site) Representative DNA sequence >CFC731 (CFC731Q) /CSM/CF/CFC7-B/CFC731Q.Seq.d/ XXXXX... (CHH351Q) /CSM/CH/CHH3-C/CHH351Q.Seq.d/ 1132 0.0 CHC450 (CHC450Q) /CSM/CH/CHC4-C/CHC450Q.Seq.d/ 1132 0.0 CFC731 (CFC

  4. Global atmospheric chemistry of CFC-123.

    Science.gov (United States)

    Prinn, R G; Golombek, A

    1990-03-01

    THE compound 1,1-dichloro-2,2,2-trifluoroethane (CFC-123), which is potentially usable as a foam-blowing agent in the plastics industry, an aerosol propellant and a refrigerant, has been proposed as an industrial substitute for trichlorofluoromethane (CFC-11), the use of which is increasingly restricted because of its effects on the ozone layer and on climate(1-3). It is expected that CFC-123, although like CFC-11 an absorber of infrared radiation, will be less stable in the atmosphere because of its expected reaction with OH radicals in the troposphere. Using a three-dimensional global model of the atmosphere, we have calculated the chemical destruction rates of CFC-123 by various processes, confirming that the chief sink is destruction by OH radicals below 12 km, which accounts for 88% of its loss. The calculated destruction rate is greatest in the equatorial region below 2 km. The calculated steady-state lifetime of CFC-123 is 1.5 years, based on the best available estimate of the rate constant of the reaction with OH. This lifetime is very much shorter than that of CFC-11, the destruction of which is largely confined to the stratosphere. For equal rates (by mass) of CFC-123 and CFC-11 emission to the atmosphere, the molar content in the atmosphere and the injection rate of chlorine into the stratosphere are, respectively, 48 and 14 times greater for CFC-11 than for CFC-123 in steady-state.

  5. Dicty_cDB: CFC556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC556 (Link to dictyBase) - - - Contig-U16178-1 CFC556Z (Link... to Original site) - - CFC556Z 707 - - - - Show CFC556 Library CF (Link to library) Clone ID CFC556 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC5-C/CFC556Q.Seq.d/ Representative seq. ID CFC55...6Z (Link to Original site) Representative DNA sequence >CFC556 (CFC556Q) /CSM/CF/CFC5-C/CFC556Q.Seq.d/ XXXXX...kalklkiiqs Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC

  6. Dicty_cDB: CFC472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC472 (Link to dictyBase) - G01597 DDB0189699 Contig-U12346-1 CFC...472E (Link to Original site) CFC472F 649 CFC472Z 778 CFC472P 1427 CFC472E 1337 Show CFC472 Library CF (L...ink to library) Clone ID CFC472 (Link to dictyBase) Atlas ID - NBRP ID G01597 dictyBase ID DDB0189699 Link t...o Contig Contig-U12346-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-C/CFC...472Q.Seq.d/ Representative seq. ID CFC472E (Link to Original site) Representative DNA sequence >CFC472 (CFC

  7. Dicty_cDB: CFC223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC223 (Link to dictyBase) - G00185 DDB0190493 Contig-U14174-1 CFC...223E (Link to Original site) CFC223F 622 CFC223Z 722 CFC223P 1344 CFC223E 1190 Show CFC223 Library CF (L...ink to library) Clone ID CFC223 (Link to dictyBase) Atlas ID - NBRP ID G00185 dictyBase ID DDB0190493 Link t...o Contig Contig-U14174-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-A/CFC...223Q.Seq.d/ Representative seq. ID CFC223E (Link to Original site) Representative DNA sequence >CFC223 (CFC

  8. Dicty_cDB: CFC769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC769 (Link to dictyBase) - - - Contig-U16381-1 CFC769F (Link to Original site) CFC...769F 114 - - - - - - Show CFC769 Library CF (Link to library) Clone ID CFC769 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC7-C/CFC769Q.Seq.d/ Representative seq. ID CFC76...9F (Link to Original site) Representative DNA sequence >CFC769 (CFC769Q) /CSM/CF/CFC7-C/CFC769Q.Seq.d/ ACTGT...kktkkk--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFC

  9. Dicty_cDB: CFC647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC647 (Link to dictyBase) - - - Contig-U16287-1 CFC647Z (Link... to Original site) - - CFC647Z 602 - - - - Show CFC647 Library CF (Link to library) Clone ID CFC647 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC6-B/CFC647Q.Seq.d/ Representative seq. ID CFC64...7Z (Link to Original site) Representative DNA sequence >CFC647 (CFC647Q) /CSM/CF/CFC6-B/CFC647Q.Seq.d/ XXXXX...b: 0.00 m_ : 1.00 44.0 %: nuclear 36.0 %: cytoplasmic 8.0 %: cytoskeletal 8.0 %: vacuolar 4.0 %: mitochondrial >> prediction for CFC

  10. Dicty_cDB: CFC438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC438 (Link to dictyBase) - - - Contig-U16397-1 CFC438Z (Link... to Original site) - - CFC438Z 529 - - - - Show CFC438 Library CF (Link to library) Clone ID CFC438 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC4-B/CFC438Q.Seq.d/ Representative seq. ID CFC43...8Z (Link to Original site) Representative DNA sequence >CFC438 (CFC438Q) /CSM/CF/CFC4-B/CFC438Q.Seq.d/ XXXXX...asma membrane 4.0 %: vesicles of secretory system >> prediction for CFC438 is nuc 5' end seq. ID - 5' end se

  11. CFC index for the diagnosis of cardiofaciocutaneous syndrome.

    Science.gov (United States)

    Kavamura, M I; Peres, C A; Alchorne, M M A; Brunoni, D

    2002-09-15

    Controversy exists concerning the delineation of cardiofaciocutaneous syndrome (CFC). Many authors have attempted to establish syndrome traits for CFC, but to date none are pathognomonic or obligatory. We have created a clinical and objective method, called the CFC index, for CFC diagnosis. This method also differentiates CFC from Noonan syndrome and Costello syndrome, CFC's main differential diagnosis. We propose the use of the CFC index for the confirmation of CFC diagnosis and to differentiate CFC from other phenotypically similar genetic conditions, while molecular studies are still in progress. Copyright 2002 Wiley-Liss, Inc.

  12. Stennis Space Center kicks off 2009 CFC emphasis

    Science.gov (United States)

    2009-01-01

    Using American sign language, Greg Crapo, right, director of de l'Ep e Deaf Center Inc. in Biloxi , Miss., helps Shanda Bennett of the Environmental Protection Agency at NASA's John C. Stennis Space Center spell out her name. Bennett is joined by colleague Charles Kennedy during a tour of charitable organization displays for the kickoff of the Stennis portion of the 2009 Combined Federal Campaign emphasis on Oct. 29. The CFC is the world's largest annual workplace charity effort. Contributions to the campaign support organizations providing health and human service benefits throughout the world. Stennis employees give tens of thousands of dollars through the campaign each year, including a $198,000 in gifts in 2008. This year, the Stennis goal is $200,000. For the kickoff, a number of charitable organizations provided displays at Stennis, providing employees an opportunity to see - and choose - where their contributions can be directed.

  13. More on the Noonan-CFC controversy

    Energy Technology Data Exchange (ETDEWEB)

    Neri, G.; Zollino, M. [Universita Cattolica, Rome (Italy)

    1996-10-16

    We read with interest the report by Lorenzetti and Fryn on a Noonan syndrome patient with retinitis pigmentosa, published in this issue of the Journal. We definitely concur with their diagnosis. Actually, the patient has all of those characteristics that we consider distinctive of Noonan syndrome vis-a-vis CFC syndrome, i.e., thick hair (not as sparse and woolly as in CFC syndrome), bushy eyebrows (not sparse or absent, as in CFC syndrome), absence of skin lesions (only dryness is mentioned by the authors), neck webbing (rarely reported in CFC syndrome), and normal intelligence. 7 refs.

  14. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    NARCIS (Netherlands)

    Allin, S. J.; Laube, J. C.; Witrant, E.; Kaiser, J.; McKenna, E.; Dennis, P.; Mulvaney, R.; Capron, E.; Martinerie, P.; Roeckmann, Thomas; Blunier, T.; Schwander, J.; Fraser, P. J.; Langenfelds, R. L.; Sturges, W. T.

    2015-01-01

    The stratospheric degradation of chlorofluorocarbons (CFCs) releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O-3). A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, Laube et al.,

  15. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  16. Dicty_cDB: CFC855 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC855 (Link to dictyBase) - - - Contig-U16255-1 CFC855P (Link... to Original site) CFC855F 619 CFC855Z 696 CFC855P 1315 - - Show CFC855 Library CF (Link to library) Clone ID CFC855 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Acid sequence FWSSCTPSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQCQIPATGGG PATGSAPGQGTSGGTPGSCDKVNCPNGYICT... sequence (All Frames) Frame A: FWSSCTPSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQCQIPATGGG PATGSAPGQGTSGGTPGSCDKVNCPNGYICT

  17. CFC legislation in the European Union

    OpenAIRE

    Cvjetković Cvjetana M.

    2015-01-01

    In this paper the author considers CFC legislation in the Member States of the European Union, and points to the official attitude of the institutions of the European Union toward CFC legislation. Special attention in this paper is focused on Judgment of the Court of Justice of the European Union in the case Cadbury Schweppes. The aim of the paper is to analyze CFC legislation in the Member States in order to determine its basic characteristics, as well as to determine its compatibility with ...

  18. Danske CFC-regler og dobbeltbeskatningsoverenskomster

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver

    2012-01-01

    Artiklen behandler spørgsmålet om, hvorvidt de danske CFC-regler for selskaber er forenelige med Danmarks dobbeltbeskatningsoverenskomster. Analysen baseres bl.a. på kommentarerne til OECD's modeloverenskomst - der gennem årene har undergået en betydelig udvikling i relation til dette spørgsmål...... - samt en række nyere domme fra andre lande. Det konkluderes, at mest taler for, at de danske CFC-regler normalt må anses for at være forenelige med Danmarks dobbeltbeskatningsoverenskomster. Særligt som følge af de danske CFC-reglers brede anvendelsesområde kan det dog ikke helt udelukkes, at de...... gældende danske CFC-regler for selskaber i nogle situationer vil kunne stride mod indgåede dobbeltbeskatningsoverenskomster....

  19. Stable carbon isotope fractionation in the UV photolysis of CFC-11 and CFC-12

    NARCIS (Netherlands)

    Zuiderweg, A.T.|info:eu-repo/dai/nl/304831980; Kaiser, J.; Laube, J.C.; Röckmann, T.|info:eu-repo/dai/nl/304838233; Holzinger, R.|info:eu-repo/dai/nl/337989338

    2012-01-01

    The chlorofluorocarbons CFC-11 (CFCl3) and CFC-12 (CF2Cl2) are stable atmospheric compounds that are produced at the earth’s surface, but removed only at high altitudes in the stratosphere by photolytic reactions. Their removal liberates atomic chlorine that then catalytically destroys stratospheric

  20. Stable carbon isotope fractionation in the UV photolysis of CFC-11 and CFC-12

    NARCIS (Netherlands)

    Zuiderweg, A.T.; Kaiser, J.; Laube, J.C.; Roeckmann, T.; Holzinger, R.

    2011-01-01

    The chlorofluorocarbons CFC-11 (CCl3F) and CFC-12 (CCl2F2) are stable atmospheric compounds that are produced at the earth’s surface, but removed only at high altitudes in the stratosphere, where their removal liberates atomic chlorine that then catalytically destroys stratospheric ozone. For such

  1. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION

    Science.gov (United States)

    The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...

  2. AEROSOL INDUSTRY SUCCESS IN REDUCING CFC PROPELLANT USAGE

    Science.gov (United States)

    Part I of this report discusses the U.S. aerosol industry's experience in converting from chlorofluorocarbon (CFC) propellants to alternative aerosol formulations. Detailed examples of non-CFC formulations are provided for 28 categories of aerosol products. ydrocarbon propellants...

  3. 5 CFR 950.102 - Scope of the Combined Federal Campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Scope of the Combined Federal Campaign... Campaign. (a) The CFC is the only authorized solicitation of employees in the Federal workplace on behalf of charitable organizations. A campaign may be conducted during a period, as determined by the LFCC...

  4. CFC legislation in the European Union

    Directory of Open Access Journals (Sweden)

    Cvjetković Cvjetana M.

    2015-01-01

    Full Text Available In this paper the author considers CFC legislation in the Member States of the European Union, and points to the official attitude of the institutions of the European Union toward CFC legislation. Special attention in this paper is focused on Judgment of the Court of Justice of the European Union in the case Cadbury Schweppes. The aim of the paper is to analyze CFC legislation in the Member States in order to determine its basic characteristics, as well as to determine its compatibility with freedoms guaranteed by the primary law of the European Union, i.e. with Judgment of the Court of Justice of the European Union in the Cadbury Schweppes case.

  5. Dispensation fra CFC-reglerne for selskaber

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver

    2011-01-01

    Artiklen, der er fagfællebedømt, omhandler dispensationsbestemmelsen i SEL § 32, stk. 2, 2-4 pkt, hvorefter Skatterådet kan tillade, at indkomsten i et datterselskab med koncession til at udøve forskellig økonomisk virksomhed ikke skal være omfattet af reglerne om CFC-beskatning. I den forbindels...... analyseres de betingelser, som skal opfyldes for at opnå dispensation på baggrund af nyere administrativ praksis. Der ses på de danske CFC-reglers anvendelsesområde i den henseende....

  6. Switching to CFC-free beclometasone for asthma.

    Science.gov (United States)

    2008-06-01

    Chlorofluorocarbon (CFC) compounds, the traditional propellants in aerosol metered-dose inhalers (MDIs), damage the ozone layer in the atmosphere. Following adoption of the Montreal Protocol on Substances that Deplete the Ozone Layer almost 20 years ago, the UK Government produced a transition strategy to enable CFC-containing MDIs to be phased out as quickly as possible.(1, 2) Hydrofluoroalkanes (HFAs) are now being used as propellants in most MDIs (i.e. CFC-free inhalers). However, there have been particular difficulties in developing CFC-free beclometasone inhalers, as this drug dissolves in the new propellant. There are now two CFC-free beclometasone inhalers available in the UK - Qvar (Teva) and black triangle [see text for formula]Clenil Modulite (Trinity-Chiesi), both licensed for asthma. CFC-containing beclometasone MDIs will become unavailable as stocks run out (within the next year). Here we discuss the issues around switching to the CFC-free beclometasone inhalers.

  7. Deposition and pharmacokinetics of flunisolide delivered from pressurized inhalers containing non-CFC and CFC propellants.

    Science.gov (United States)

    Richards, J; Hirst, P; Pitcairn, G; Mahashabde, S; Abramowitz, W; Nolting, A; Newman, S P

    2001-01-01

    Our objective was to assess the deposition and pharmacokinetics of a novel formulation of flunisolide (Aerobid, Forest Laboratories) in hydrofluoroalkane (HFA) 134a delivered by pressurized metered dose inhaler (pMDI). The design was a two-way crossover investigation in 12 healthy male subjects comparing HFA-134a flunisolide by pMDI versus pMDI plus 50 mL spacer device. Four of these subjects also took part in a two-way crossover investigation comparing chlorofluorocarbon (CFC) flunisolide pMDI versus pMDI plus Aerochamber holding chamber. The imaging technique of gamma scintigraphy was used to quantify total and regional lung deposition of flunisolide. Plasma levels of flunisolide and its major metabolite (6beta-OH flunisolide) were also determined. The spacer and Aerochamber reduced oropharyngeal deposition dramatically for both the HFA and CFC products (mean 59.8 to 14.9% (p CFC product) owing to deposition of part of the dose on the walls of the add-on devices themselves. Lung deposition averaged 22.6 and 40.4% (p CFC formulation delivered via the Aerochamber (mean 23.4%) was higher than that for the CFC pMDI alone (mean 17.0%), but this difference was not statistically significant. Lung deposition expressed as percentage ex-device (delivered) dose averaged 68.3% for HFA pMDI plus spacer and 19.7% for CFC pMDI. Plasma levels of flunisolide were higher for the pMDI plus spacer than for pMDI alone, reflecting higher lung deposition via the spacer, but plasma levels of the 6beta-OH flunisolide metabolite were higher for the pMDI alone as a consequence of higher oropharyngeal deposition. When delivered via the spacer, pulmonary targeting of the flunisolide HFA formulation was improved compared with the CFC formulation, which should benefit patients by providing satisfactory asthma therapy from a much-reduced delivered dose of flunisolide.

  8. Toward assessing the effects of crack front curvature /CFC/.

    Science.gov (United States)

    Swedlow, J. L.; Ritter, M. A.

    1972-01-01

    Consideration of the effect of crack front curvature (CFC) on the K calibration of five special geometries in which CFC occurs. The five cases considered include an elliptical crack in an infinite medium, an internal annular crack in a thick-walled cylinder, a through crack in a flat plate, a part-through crack in a plate, and an irregularly shaped crack in a solid. It is shown that K depends on CFC differently in each case.

  9. Make a Difference in 2015 through the Combined Federal Campaign | Poster

    Science.gov (United States)

    By Andrea Frydl, Contributing Writer With the holiday season comes the generous holiday giving spirit. All federal employees are encouraged to give to the Combined Federal Campaign (CFC), the only authorized solicitation of federal employees in their workplace on behalf of approved charitable organizations. The CFC coordinates the fund-raising efforts of various charitable organizations so that federal employees are solicited in the workplace just once a year and have the opportunity to make contributions through payroll deduction.

  10. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...... will mainly depend on the continued release from PUR foams. Little is known about rates and time frames of the CFC release from foams especially after treatment and disposal of foam containing waste products. The CFC release is mainly controlled by slow diffusion out through the PUR. From the literature...... and by reevaluation of an old reported experiment, diffusion coefficients in the range of 0.05-1.7.10(-14) m(2) s(-1) were found reflecting differences in foam properties and experimental designs. Laboratory experiments studying the distribution of CFC in the foam and the short-term releases after shredding showed...

  11. Simultaneous determination of CFC-11, CFC-12 and CFC-113 in seawater samples using a purge and trap gas-chromatographic system.

    Science.gov (United States)

    Massolo, Serena; Rivaro, Paola; Frache, Roberto

    2009-12-15

    We have optimized the analytical parameters of a homemade instrument for the simultaneous measurement of the chlorofluorocarbons CCl(2)F(2) (CFC-12), CCl(3)F (CFC-11) and C(2)Cl(3)F(3) (CFC-113) in seawater. Seawater samples are flame sealed into 60 ml glass ampoules avoiding any contact with the atmosphere and stored in cold, dark condition until analysis. In the laboratory, after cracking the ampoule in an enclosed chamber filled with ultra-pure nitrogen, the seawater sample is transferred to a stripping chamber, where ultra-pure nitrogen is used to purge the dissolved CFCs from the seawater. The extracted gases are then cryogenically trapped, subsequently the trap is isolated and heated and the CFCs are transferred by a carrier gas stream into a precolumn and then are separated on a gaschromatographic packed column. To separate adequately CFC-12 from N(2)O, during the early part of the chromatographic run, the gas stream passes through a molecular sieve, which is then isolated and backflushed. The CFCs are detected on an electron capture detector ((63)Ni ECD). After a careful choice of the experimental conditions, the performances of the system were evaluated. The detection limits for seawater samples are: 0.0081 pmol kg(-1) for CFC-12, 0.0073 pmol kg(-1) for CFC-11 and 0.0043 pmol kg(-1) for CFC-113. The reproducibility of replicate samples lies within 5% for the three CFCs. The system has been successfully employed for CFC measurements in seawater samples collected in the Ross Sea (Antarctica) in the framework of the Italian Antarctic research project.

  12. Evidence for a decline in the atmospheric accumulation rate of CHClF2 (CFC-22)

    Science.gov (United States)

    Rinsland, Curtis P.; Levine, Joel S.; Johnson, Douglas W.; Goldman, Aaron

    1989-01-01

    CHClF2 (CFC-22) is a promising substitute for atmospheric ozone damaging, fully halogenated hydrocarbons. Atmospheric CFC-22 measurements derived from ground-based solar spectra recorded between December 1980 and May 1988 are reported which show that the CFC-22 total column increased at an average annual exponential rate of 7.8 percent + or - 1.0 percent (2 sigma). Compared with other atmospheric data, these measurements indicate that CFC-22 is increasing at a more rapid rate than either CFC-11 or CFC-12, the two most abundant chlorofluorocarbons, but that the rate of CFC-22 increase is likely to have declined over the past few years.

  13. Release of CFC-11 from disposal of polyurethane foam waste.

    Science.gov (United States)

    Kjeldsen, P; Jensen, M H

    2001-07-15

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations will mainly depend on the continued release from PUR foams. Little is known about rates and time frames of the CFC release from foams especially after treatment and disposal of foam containing waste products. The CFC release is mainly controlled by slow diffusion out through the PUR. From the literature and by reevaluation of an old reported experiment, diffusion coefficients in the range of 0.05-1.7 x 10(-14) m2 s-1 were found reflecting differences in foam properties and experimental designs. Laboratory experiments studying the distribution of CFC in the foam and the short-term releases after shredding showed that about 40% of the CFC is solubilized in the PUR phase, and that up to 10% of the total content will be released within a few weeks if the foam is shredded down to 2-cm sized pieces. For smaller pieces the quick release will be larger. Fifty percent of residual CFC content will be released within 9-300 years from 2-cm pieces based on the range in diffusion coefficients reported. For larger pieces the initial release is insignificant, and the release time frames are much longer than for the shredded foam.

  14. Definitionen af CFC-indkomst og adgangen til dispensation

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver

    2014-01-01

    I artiklen kommenteres to nyere afgørelser omhandlende CFC-reglerne for selskaber. Først behandles Skatterådets afgørelse i SKM2013.649.SR, der bl.a. angik, hvorvidt et udenlandsk datterselskabs indkomst udgjorde CFC-indkomst i form af vederlag for anvendelse af immaterielle aktiver. Derpå omtale...... kendelsen SKM2014.280.LSR, hvori Landsskatteretten - modsat Skatterådet - kom frem til, at betingelserne for dispensation fra CFC-reglerne var opfyldt....

  15. Atmospheric Science and the CFC Industry

    Science.gov (United States)

    Steed, J. M.

    2012-12-01

    Industry involvement with developing atmospheric science and subsequent regulations to protect ozone was unusual. Chlorofluorocarbon manufacturers were research-based businesses accustomed to understanding the science behind product-related issues. When Lovelock's measurements in 1971 implied most of the cumulative production of CFCs remained in the atmosphere, global CFC producers funded academic research to identify natural sinks for the materials. The Fluorocarbon Program Panel (FPP) began in 1972, but changed focus to atmospheric photochemistry following Rowland and Molina's work in 1974. Despite early vociferous opposition, especially by the CFC-using aerosol industry, to any regulations, leaders among the producers worked to build their scientific understanding, expanding FPP funding and launching internal work in modeling and ozone trend analysis. The key first question for industry was not how much depletion might occur, but whether it would occur at all. If so, regardless of the amount, regulations and a major transition would be required in CFC-using industries, and the response would need to be global and prompt. So long as that basic question was in doubt, some businesses and countries would resist the economic cost of action. In the meantime, the producing industry worked to identify potential alternatives and to communicate atmospheric science to the downstream industries. Although the industry science effort was often disparaged as an attack on "real" science, my only assignment when I joined DuPont's Central Research Department in 1979 was to understand and contribute to the science, keeping both the company and our customers informed. Our modeling results were published freely. FPP funding led to better knowledge of the ClO + O rate constant, significantly increasing depletion in model calculations; supported the development of the techniques used to measure in situ atmospheric ClO, so important in later strengthening the case for chlorine

  16. CFC-beskatning og retsmisbrugsbegrebet i EU-retten

    DEFF Research Database (Denmark)

    Michelsen, Aage

    2008-01-01

    /9 2006 i Cadbury Schweppes-sagen (C-196/04 (SU 2006, 333)) om de engelske CFC-beskatningsregler, der blev anset for at være uforenelige med EF-traktatens art. 43 om fri etableringsret. Da de tidligere gældende danske CFC-regler mindede meget om de tidligere gældende engelske CFC-regler, er de danske regler...... blevet ændret ved lov nr. 540 af 6/6 2007 (L 213). CFC-reglers forhold til dobbeltbeskatningsoverenskomster samt de nye danske reglers forenelighed med EU-retten bliver behandlet, herunder betydningen af retsmisbrugsbegrebet i EU-retten. Der rettes i artiklen en kritik af det generelle retsmisbrugsbegreb...

  17. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112, CCl3CClF2 (CFC-112a, CCl3CF3 (CFC-113a, and CCl2FCF3 (CFC-114a

    Directory of Open Access Journals (Sweden)

    M. E. Davis

    2016-07-01

    Full Text Available The potential impact of CCl2FCF3 (CFC-114a and the recently observed CCl2FCCl2F (CFC-112, CCl3CClF2 (CFC-112a, and CCl3CF3 (CFC-113a chlorofluorocarbons (CFCs on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207–323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs, and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years of 63.6 (61.9–64.7, 51.5 (50.0–52.6, 55.4 (54.3–56.3, and 105.3 (102.9–107.4 for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs were estimated to be 4260 (CFC-112, 3330 (CFC-112a, 3650 (CFC-113a, and 6510 (CFC-114a for the 100-year time horizon.

  18. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  19. Molecular evolution of the EGF-CFC protein family.

    Science.gov (United States)

    Ravisankar, V; Singh, Taran P; Manoj, Narayanan

    2011-08-15

    The epidermal growth factor-Cripto-1/FRL-1/Cryptic (EGF-CFC) proteins, characterized by the highly conserved EGF and CFC domains, are extracellular membrane associated growth factor-like glycoproteins. These proteins are essential components of the Nodal signaling pathway during early vertebrate embryogenesis. Homologs of the EGF-CFC family have also been implicated in tumorigenesis in humans. Yet, little is known about the mode of molecular evolution in this family. Here we investigate the origin, extent of conservation and evolutionary relationships of EGF-CFC proteins across the metazoa. The results suggest that the first appearance of the EGF-CFC gene occurred in the ancestor of the deuterostomes. Phylogenetic analysis supports the classification of the family into distinct subfamilies that appear to have evolved through lineage-specific duplication and divergence. Site-specific analyses of evolutionary rate shifts between the two major mammalian paralogous subfamilies, Cripto and Cryptic, reveal critical amino acid sites that may account for the observed functional divergence. Furthermore, estimates of functional divergence suggest that rapid change of evolutionary rates at sites located mainly in the CFC domain may contribute towards distinct functional properties of the two paralogs. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Absorption coefficients of CFC-11 and CFC-12 needed for atmospheric remote sensing and global warming studies

    Science.gov (United States)

    Varanasi, Prasad

    1992-01-01

    Spectral absorption coefficients k(v) in the atmospheric window are reported for CFC-11 and CFC-12. Data obtained with a grating spectrometer are compared with NCAR cross sections and measurements of k(v) made with a tunable diode laser spectrometer at various temperature-pressure combinations representing tangent heights or layers in the atmosphere are presented. The results are suitable for atmospheric remote sensing and global warming studies.

  1. Validation of ACE-FTS measurements of CFC-11, CFC-12, and HCFC-22 using ground-based FTIR spectrometers

    Science.gov (United States)

    Kolonjari, F.; Walker, K. A.; Mahieu, E.; Batchelor, R. L.; Bernath, P. F.; Boone, C.; Conway, S. A.; Dan, L.; Griffin, D.; Harrett, A.; Kasai, Y.; Kagawa, A.; Lindenmaier, R.; Strong, K.; Whaley, C.

    2013-12-01

    Satellite datasets can be an effective global monitoring tool for long-lived compounds in the atmosphere. The Atmospheric Chemistry Experiment (ACE) is a mission on-board the Canadian satellite SCISAT-1. The primary instrument on SCISAT-1 is a high-resolution infrared Fourier transform spectrometer (ACE-FTS) which is capable of measuring a range of gases including key chlorofluorocarbon (CFC) and hydrochlorofluorocarbon (HCFC) species. These families of species are of interest because of their significant contribution to anthropogenic ozone depletion and to global warming. To assess the quality of data derived from satellite measurements, validation using other data sources is essential. Ground-based Fourier transform infrared (FTIR) spectrometers are particularly useful for this purpose. In this study, five FTIR spectrometers located at four sites around the world are used to validate the CFC-11 (CCl3F), CFC-12 (CCl2F2), and HCFC-22 (CHClF2) retrieved profiles from ACE-FTS measurements. These species are related because HCFC-22 was the primary replacement for CFC-11 and CFC-12 in refrigerant and propellant applications. The FTIR spectrometers used in this study record solar absorption spectra at Eureka (Canada), Jungfraujoch (Switzerland), Poker Flat (USA), and Toronto (Canada). The retrieval of CFC-11, CFC-12, and HCFC-22 are not standard products for many of these instruments, and as such, a harmonization of retrieval parameters between the sites has been conducted. The retrievals of these species from the FTIR spectra are sensitive from the surface to approximately 20 km, while the ACE-FTS profiles extend from approximately 6 to 30 km. For each site, partial column comparisons between coincident measurements of the three species and a validation of the observed trends will be discussed.

  2. Non-CFC metered dose inhalers: the patent landscape.

    Science.gov (United States)

    Bowman, P A; Greenleaf, D

    1999-09-10

    There have been many patent applications to the European Patent Office over the past decade involving the transition of pressurised metered dose inhalers from the CFCs to non-CFC propellants. In addition to those where formulations are changed, there are those relating to specific drugs or drug classes, processes of manufacture and modifications to the container/closure system. Many of these have been opposed, usually on the grounds of obviousness. However, due to the length of time for the opposition process and the fact that there are few non-CFC pressurised inhalers on the market yet, the complete picture of which patents are valid has yet to unfold.

  3. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION

    Science.gov (United States)

    The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...

  4. INVESTIGATION OF POSSIBLE USES OF CFC/HALON CHEMICALS

    Science.gov (United States)

    The report documents an investigation of the possibility of alternate uses for surplus chlorofluorocarbon (CFC)/halon chemicals as they are replaced in their traditional service roles. hese uses may be beneficial new products or substances that are nonhazardous to the environment...

  5. Survey of coolant options of a monolithic CFC divertor

    Energy Technology Data Exchange (ETDEWEB)

    Merola, M. (Commission of the European Communities, Joint Research Centre, Institute for Advanced Materials, TP 750, 21020 Ispra (Vatican City State, Holy See) (Italy)); Matera, R. (Commission of the European Communities, Joint Research Centre, Institute for Advanced Materials, TP 750, 21020 Ispra (Vatican City State, Holy See) (Italy))

    1994-06-01

    Different coolant options for a monolithic CFC divertor are examined. Helium gas, HB-40 organic liquid and some liquid metals seem to be viable solutions. The thermal performances of the divertor concept are presented as well as a list of possible advantages and a brief cost evaluation. ((orig.))

  6. Campaigns Matter

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Pedersen, Rasmus Tue

    2014-01-01

    Election campaigns are more than simple competitions for votes; they also represent an opportunity for voters to become politically knowledgeable and engaged. Using a large-scale web panel (n≈5,000), we track the development of political knowledge, internal efficacy and external efficacy among...... voters during the 2011 Danish parliamentary election campaign. Over the course of the campaign, the electorate’s political knowledge increases, and these gains are found across genders, generations and educational groups, narrowing the knowledge gap within the electorate. Furthermore, internal...... and the external efficacy increase over the course of the campaign, with gains found across different demographic groups, particularly narrowing the gaps in internal efficacy. The news media play a crucial role, as increased knowledge and efficacy are partly driven by media use, although tabloids actually decrease...

  7. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2010-02-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters have been retrieved from a large number of cruises and collected into a new database called CARINA (CARbon IN the Atlantic. These data have been merged into three sets of files, one for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The first part of the CARINA database consists of three files, one for each CARINA region, containing the original, non-adjusted cruise data sets, including data quality flags for each measurement. These data have then been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the second part of the CARINA data product. This consists of three files, one for each CARINA region, which contain adjustments to the original data values based on recommendations from the CARINA QC procedures, along with calculated and interpolated values for some missing parameters.

    Here we present an overview of the QC of the CFC data for the AMS region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of data from some cruises, while other data were flagged to be of questionable quality, which excluded them from the final data product.

  8. Cardiofaciocutaneous (CFC) syndrome associated with muscular coenzyme Q10 deficiency.

    Science.gov (United States)

    Aeby, A; Sznajer, Y; Cavé, H; Rebuffat, E; Van Coster, R; Rigal, O; Van Bogaert, P

    2007-10-01

    The cardiofaciocutaneous (CFC) syndrome is characterized by congenital heart defect, developmental delay, peculiar facial appearance with bitemporal constriction, prominent forehead, downslanting palpebral fissures, curly sparse hair and abnormalities of the skin. CFC syndrome phenotypically overlaps with Noonan and Costello syndromes. Mutations of several genes (PTPN11, HRAS, KRAS, BRAF, MEK1 and MEK2), involved in the mitogen-activated protein kinase (MAPK) pathway, have been identified in CFC-Costello-Noonan patients. Coenzyme Q10 (CoQ10), a lipophilic molecule present in all cell membranes, functions as an electron carrier in the mitochondrial respiratory chain, where it transports electrons from complexes I and II to complex III. CoQ10 deficiency is a rare treatable mitochondrial disorder with various neurological (cerebellar ataxia, myopathy, epilepsy, mental retardation) and extraneurological (cardiomyopathy, nephropathy) signs that are responsive to CoQ10 supplementation. We report the case of a 4-year-old girl who presented a CFC syndrome, confirmed by the presence of a pathogenic R257Q BRAF gene mutation, together with a muscular CoQ10 deficiency. Her psychomotor development was severely impaired, hindered by muscular hypotonia and ataxia, both improving remarkably after CoQ10 treatment. This case suggests that there is a functional connection between the MAPK pathway and the mitochondria. This could be through the phosphorylation of a nuclear receptor essential for CoQ10 biosynthesis. Another hypothesis is that K-Ras, one of the proteins composing the MAPK pathway, might be recruited into the mitochondria to promote apoptosis. This case highlights that CoQ10 might contribute to the pathogenesis of CFC syndrome.

  9. Nordic Seas and Arctic Ocean CFC data in CARINA

    Science.gov (United States)

    Jeansson, E.; Olsson, K. A.; Tanhua, T.; Bullister, J. L.

    2010-02-01

    Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters have been retrieved from a large number of cruises and collected into a new database called CARINA (CARbon IN the Atlantic). These data have been merged into three sets of files, one for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS), the Atlantic (ATL) and the Southern Ocean (SO). The first part of the CARINA database consists of three files, one for each CARINA region, containing the original, non-adjusted cruise data sets, including data quality flags for each measurement. These data have then been subject to rigorous quality control (QC) in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the second part of the CARINA data product. This consists of three files, one for each CARINA region, which contain adjustments to the original data values based on recommendations from the CARINA QC procedures, along with calculated and interpolated values for some missing parameters. Here we present an overview of the QC of the CFC data for the AMS region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4). The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of data from some cruises, while other data were flagged to be of questionable quality, which excluded them from the final data product.

  10. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  11. Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions

    Science.gov (United States)

    Laube, Johannes C.; Hanif, Norfazrin Mohd; Martinerie, Patricia; Gallacher, Eileen; Fraser, Paul J.; Langenfelds, Ray; Brenninkmeijer, Carl A. M.; Schwander, Jakob; Witrant, Emmanuel; Wang, Jia-Lin; Ou-Yang, Chang-Feng; Gooch, Lauren J.; Reeves, Claire E.; Sturges, William T.; Oram, David E.

    2016-12-01

    Chlorofluorocarbons (CFCs) are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4). Of particular interest here is the differentiation between CFC-114 (CClF2CClF2) and its asymmetric isomeric form CFC-114a (CF3CCl2F) as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S), Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn) enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt) between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in international climate

  12. Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions

    Directory of Open Access Journals (Sweden)

    J. C. Laube

    2016-12-01

    Full Text Available Chlorofluorocarbons (CFCs are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4. Of particular interest here is the differentiation between CFC-114 (CClF2CClF2 and its asymmetric isomeric form CFC-114a (CF3CCl2F as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S, Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in

  13. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  14. Platinum complexes having redox-active PPh2C[triple bond]CFc and/or C[triple bond]CFc as terminal or bridging ligands.

    Science.gov (United States)

    Díez, Alvaro; Lalinde, Elena; Teresa Moreno, M; Sánchez, Sergio

    2009-05-14

    A series of heteronuclear-Pt(ii) complexes containing ferrocenylethynyl units linked directly (Pt-C[triple bond]CFc) or through a phosphorous atom (Pt-PPh(2)C[triple bond]CFc) to the platinum center is reported. The reaction of derivative [cis-Pt(R(F))(2)(PPh(2)C[triple bond]CFc)(2)] (R(F) = C(6)F(5)) with the solvate complex [cis-Pt(R(F))(2)(thf)(2)] leads to the formation of an asymmetrical heteronuclear diplatinum complex [{Pt(R(F))(2)(mu-1kappaP:2eta(2)-PPh(2)C[triple bond]CFc)(2)}Pt(R(F))(2)] having the "cis-Pt(R(F))(2)" fragment coordinated to the triple bonds of both ferrocenylethynylphosphine units, while treatment of [cis-Pt(C[triple bond]CFc)(2)(PPh(2)C[triple bond]CR)(2)] (R = Fc , Ph , tBu ) with the same solvate [cis-Pt(R(F))(2)(thf)(2)], affords double ferrocenylacetylide-bridged diplatinum systems [{Pt(PPh(2)C[triple bond]CR)(2)(mu-eta(1):eta(2)-C[triple bond]CFc)(2)}Pt(R(F))(2)] . The solid-state structures of [cis/trans-Pt(R(F))(2)(PPh(2)C[triple bond]CFc)(2)] /, [cis-Pt(R(F))(2)(PPh(2)C[triple bond]CFc)(tht)] (tht = tetrahydrothiophene), [{Pt(R(F))(2)(mu-1kappaP:2eta(2)-PPh(2)C[triple bond]CFc)(2)}Pt(R(F))(2)] and [{Pt(PPh(2)C[triple bond]CtBu)(2)(mu-eta(1):eta(2)-C[triple bond]CFc)(2)}Pt(R(F))(2)] have been determined by X-ray diffraction methods. The electronic spectra and the electrochemical behaviour of all monoplatinum derivatives are discussed, showing a different extent of interaction between the remote ferrocenyl groups when they belong to PPh(2)C[triple bond]CFc or C[triple bond]CFc ligands. For the diplatinum systems and , containing bridging (kappaP:eta(2)-PPh(2)C[triple bond]CFc ) or (eta(1):eta(2)-C[triple bond, length as m-dash]CFc ) ligands, their electrochemical properties were also compared with the parent precursors.

  15. Stratospheric Ozone in the Post-CFC Era

    Science.gov (United States)

    Li, F.; Stolarski, R. S.; Newman, P. A.

    2009-01-01

    Vertical and latitudinal changes in the stratospheric ozone in the post-chlorofluorocarbon (CFC) era are investigated using simulations of the recent past and the 21st century with a coupled chemistry-climate model. Model results reveal that, in the 2060s when the stratospheric halogen loading is projected to return to its 1980 values, the extratropical column ozone is significantly higher than that in 1975-1984, but the tropical column ozone does not recover to 1980 values. Upper and lower stratospheric ozone changes in the post-CFC era have very different patterns. Above 15 hPa ozone increases almost latitudinally uniformly by 6 Dobson Unit (DU), whereas below 15 hPa ozone decreases in the tropics by 8 DU and increases in the extratropics by up to 16 DU. The upper stratospheric ozone increase is a photochemical response to greenhouse gas induced strong cooling, and the lower stratospheric ozone changes are consistent with enhanced mean advective transport due to a stronger Brewer-Dobson circulation. The model results suggest that the strengthening of the Brewer-Dobson circulation plays a crucial role in ozone recovery and ozone distributions in the post-CFC era.

  16. CFC rules in the context of the proposed CCCTB directive

    Directory of Open Access Journals (Sweden)

    Veronika Sobotková

    2011-01-01

    Full Text Available In the proposal for a Council Directive on a Common Consolidated Corporate Tax Base (CCCTB there have been introduced a specific anti-abuse provisions, CFC rules. These rules are aimed at tax evasions and tax avoidance. The basic principle is the protection of the tax base against erosion through practices of artificial income shifting. Generally, CFC rules prevent tax avoidance in a state of a shareholder by denying the deferred taxation of profits generated by its controlled company, which is a resident in a tax preference jurisdiction. Even thought the CCCTB directive would be aided easier and low-costs cross-border business as well as it would be restricted the harmful tax competition there are questions whether it is advisable to introduce these rules into such system of the CCCTB, whether these rules are compatible with the CCCTB and whether it is regulated properly. So, the focus of this paper rests on the interaction of the proposed CCCTB directive with existing CFC rules in the European Union. The paper deals with pros and cons, economic and legal perspectives these rules in the context of the proposed CCCTB directive.

  17. Repeated CFC sections at the Greenwich Meridian in the Weddell Sea

    Science.gov (United States)

    Klatt, Olaf; Roether, Wolfgang; Hoppema, Mario; Bulsiewicz, Klaus; Fleischmann, Uli; Rodehacke, Christian; Fahrbach, Eberhard; Weiss, Ray F.; Bullister, John L.

    2002-04-01

    Repeated observations of the tracer chlorofluorocarbon-11 (CFC-11) for a section along the Greenwich Meridian from Antarctica (70°S) to about 50°S are presented for the period 1984-1998. The CFC sections display a highly persistent pattern. A middepth CFC minimum in the central Weddell Sea is bounded laterally by elevated levels of dissolved CFCs at the southern margin of the Weddell Basin and by a column of elevated CFC concentrations around 55°S near to the northern margin. Part of the latter column covers waters of the Antarctic Circumpolar Current, which indicates that a moderate portion of these waters was ventilated in the Weddell Sea. Deep CFC maxima adjoining the southern and northern margins of the Weddell Basin indicate advective cores of recently ventilated waters. The southern core supports previous notions of deep water import into the Weddell Sea from the east. For all deep and bottom waters, the portions ventilated on the CFC timescale (~50 years) are small. Effective initial CFC saturations for these portions are estimated to be between 60 and 70%, using in part new data from off the Filchner-Ronne Ice Shelf. For various CFC features along the section (mostly advective cores), ventilated fractions and mean ages of these fractions were obtained (with error limits). The procedure was to fit an age distribution of a prescribed form to CFC-11 time series for these features, constructed from the various realizations of the CFC section. The ages are between 3 and 19 years, and the ventilated fractions range between 6 and 23%, indicating a rather limited ventilation of the interior Weddell Sea subsurface layer waters on the CFC timescale. It is shown that the concurrent CFC-12 data provide little additional information. The work demonstrates a high information content of repeated tracer observations and encourages similar approaches also in other ocean regions.

  18. Clinical manifestations in patients with SOS1 mutations range from Noonan syndrome to CFC syndrome.

    Science.gov (United States)

    Narumi, Yoko; Aoki, Yoko; Niihori, Tetsuya; Sakurai, Masahiro; Cavé, Hélène; Verloes, Alain; Nishio, Kimio; Ohashi, Hirofumi; Kurosawa, Kenji; Okamoto, Nobuhiko; Kawame, Hiroshi; Mizuno, Seiji; Kondoh, Tatsuro; Addor, Marie-Claude; Coeslier-Dieux, Anne; Vincent-Delorme, Catherine; Tabayashi, Koichi; Aoki, Masashi; Kobayashi, Tomoko; Guliyeva, Afag; Kure, Shigeo; Matsubara, Yoichi

    2008-01-01

    Noonan syndrome (NS) and cardio-facio-cutaneous (CFC) syndrome are autosomal dominant disorders characterized by heart defects, facial dysmorphism, ectodermal abnormalities, and mental retardation. There is a significant clinical overlap between NS and CFC syndrome, but ectodermal abnormalities and mental retardation are more frequent in CFC syndrome. Mutations in PTPN11 and KRAS have been identified in patients with NS and those in KRAS, BRAF and MAP2K1/2 have been identified in patients with CFC syndrome, establishing a new role of the RAS/MAPK pathway in human development. Recently, mutations in the son of sevenless gene (SOS1) have also been identified in patients with NS. To clarify the clinical spectrum of patients with SOS1 mutations, we analyzed 24 patients with NS, including 3 patients in a three-generation family, and 30 patients with CFC syndrome without PTPN11, KRAS, HRAS, BRAF, and MAP2K1/2 (MEK1/2) mutations. We identified two SOS1 mutations in four NS patients, including three patients in the above-mentioned three-generation family. In the patients with a CFC phenotype, three mutations, including a novel three amino-acid insertion, were identified in one CFC patient and two patients with both NS and CFC phenotypes. These three patients exhibited ectodermal abnormalities, such as curly hair, sparse eyebrows, and dry skin, and two of them showed mental retardation. Our results suggest that patients with SOS1 mutations range from NS to CFC syndrome.

  19. Enhanced SMAD1 Signaling Contributes to Impairments of Early Development in CFC-iPSCs.

    Science.gov (United States)

    Han, Kyu-Min; Kim, Seung-Kyoon; Kim, Dongkyu; Choi, Jung-Yun; Im, Ilkyun; Hwang, Kyu-Seok; Kim, Cheol-Hee; Lee, Beom Hee; Yoo, Han-Wook; Han, Yong-Mahn

    2015-05-01

    Cardio-facio-cutaneous (CFC) syndrome is a developmental disorder caused by constitutively active ERK signaling manifesting mainly from BRAF mutations. Little is known about the role of elevated ERK signaling in CFC syndrome during early development. Here, we show that both SMAD1 and ERK signaling pathways may contribute to the developmental defects in CFC syndrome. Induced pluripotent stem cells (iPSCs) derived from dermal fibroblasts of a CFC syndrome patient (CFC-iPSCs) revealed early developmental defects in embryoid body (EB) development, β-catenin localization, and neuronal differentiation. Both SMAD1 and ERK signalings were significantly activated in CFC-iPSCs during EB formation. Most of the β-catenin was dissociated from the membrane and preferentially localized into the nucleus in CFC-EBs. Furthermore, activation of SMAD1 signaling recapitulated early developmental defects in wild-type iPSCs. Intriguingly, inhibition of SMAD1 signaling in CFC-iPSCs rescued aberrant EB morphology, impaired neuronal differentiation, and altered β-catenin localization. These results suggest that SMAD1 signaling may be a key pathway contributing the pathogenesis of CFC syndrome during early development. © 2015 AlphaMed Press.

  20. Atmospheric histories and emissions of chlorofluorocarbons CFC-13 (CClF3, ΣCFC-114 (C2Cl2F4, and CFC-115 (C2ClF5

    Directory of Open Access Journals (Sweden)

    M. K. Vollmer

    2018-01-01

    Full Text Available Based on observations of the chlorofluorocarbons CFC-13 (chlorotrifluoromethane, ΣCFC-114 (combined measurement of both isomers of dichlorotetrafluoroethane, and CFC-115 (chloropentafluoroethane in atmospheric and firn samples, we reconstruct records of their tropospheric histories spanning nearly 8 decades. These compounds were measured in polar firn air samples, in ambient air archived in canisters, and in situ at the AGAGE (Advanced Global Atmospheric Gases Experiment network and affiliated sites. Global emissions to the atmosphere are derived from these observations using an inversion based on a 12-box atmospheric transport model. For CFC-13, we provide the first comprehensive global analysis. This compound increased monotonically from its first appearance in the atmosphere in the late 1950s to a mean global abundance of 3.18 ppt (dry-air mole fraction in parts per trillion, pmol mol−1 in 2016. Its growth rate has decreased since the mid-1980s but has remained at a surprisingly high mean level of 0.02 ppt yr−1 since 2000, resulting in a continuing growth of CFC-13 in the atmosphere. ΣCFC-114 increased from its appearance in the 1950s to a maximum of 16.6 ppt in the early 2000s and has since slightly declined to 16.3 ppt in 2016. CFC-115 increased monotonically from its first appearance in the 1960s and reached a global mean mole fraction of 8.49 ppt in 2016. Growth rates of all three compounds over the past years are significantly larger than would be expected from zero emissions. Under the assumption of unchanging lifetimes and atmospheric transport patterns, we derive global emissions from our measurements, which have remained unexpectedly high in recent years: mean yearly emissions for the last decade (2007–2016 of CFC-13 are at 0.48 ± 0.15 kt yr−1 (> 15 % of past peak emissions, of ΣCFC-114 at 1.90 ± 0.84 kt yr−1 (∼ 10 % of peak emissions, and of CFC-115 at 0.80 ± 0.50

  1. CFC-11, CFC-12 and HCFC-22 ground-based remote sensing FTIR measurements at Réunion Island and comparisons with MIPAS/ENVISAT data

    Directory of Open Access Journals (Sweden)

    M. Zhou

    2016-11-01

    Full Text Available Profiles of CFC-11 (CCl3F, CFC-12 (CCl2F2 and HCFC-22 (CHF2Cl have been obtained from Fourier transform infrared (FTIR solar absorption measurements above the Saint-Denis (St Denis and Maïdo sites at Réunion Island (21° S, 55° E with low vertical resolution. FTIR profile retrievals are performed by the well-established SFIT4 program and the detail retrieval strategies along with the systematic/random uncertainties of CFC-11, CFC-12 and HCFC-22 are discussed in this study. The FTIR data of all three species are sensitive to the whole troposphere and the lowermost stratosphere, with the peak sensitivity between 5 and 10 km. The ground-based FTIR data have been compared with the collocated Michelson Interferometer for Passive Atmospheric Sounding (MIPAS/ENVISAT data and found to be in good agreement: the observed mean relative biases and standard deviations of the differences between the smoothed MIPAS and FTIR partial columns (6–30 km are (−4.3 and 4.4 %, (−2.9 and 4.6 % and (−0.7 and 4.8 % for CFC-11, CFC-12 and HCFC-22, respectively, which are within the combined error budgets from both measurements. The season cycles of CFC-11, CFC-12 and HCFC-22 from FTIR measurements and MIPAS data show a similar variation: concentration is highest in February–April and lowest in August–October. The trends derived from the combined St Denis and Maïdo FTIR time series are −0.86 ± 0.12 and 2.84 ± 0.06 % year−1 for CFC-11 and HCFC-22, respectively, for the period 2004 to 2016, and −0.76 ± 0.05 % year−1 for CFC-12 for 2009 to 2016. These measurements are consistent with the trends observed by the National Oceanic and Atmospheric Administration (NOAA Global Monitoring Division's (GMD Halocarbons & other Atmospheric Trace Species Group (HATS measurements at Samoa (14.2° S, 170.5° W for CFC-11 (−0.87 ± 0.04 % year−1, but slightly weaker for HCFC-22 (3.46 ± 0.05 % year−1 and

  2. CFC-11, CFC-12 and HCFC-22 ground-based remote sensing FTIR measurements at Réunion Island and comparisons with MIPAS/ENVISAT data

    Science.gov (United States)

    Zhou, Minqiang; Vigouroux, Corinne; Langerock, Bavo; Wang, Pucai; Dutton, Geoff; Hermans, Christian; Kumps, Nicolas; Metzger, Jean-Marc; Toon, Geoff; De Mazière, Martine

    2016-11-01

    Profiles of CFC-11 (CCl3F), CFC-12 (CCl2F2) and HCFC-22 (CHF2Cl) have been obtained from Fourier transform infrared (FTIR) solar absorption measurements above the Saint-Denis (St Denis) and Maïdo sites at Réunion Island (21° S, 55° E) with low vertical resolution. FTIR profile retrievals are performed by the well-established SFIT4 program and the detail retrieval strategies along with the systematic/random uncertainties of CFC-11, CFC-12 and HCFC-22 are discussed in this study. The FTIR data of all three species are sensitive to the whole troposphere and the lowermost stratosphere, with the peak sensitivity between 5 and 10 km. The ground-based FTIR data have been compared with the collocated Michelson Interferometer for Passive Atmospheric Sounding (MIPAS/ENVISAT) data and found to be in good agreement: the observed mean relative biases and standard deviations of the differences between the smoothed MIPAS and FTIR partial columns (6-30 km) are (-4.3 and 4.4 %), (-2.9 and 4.6 %) and (-0.7 and 4.8 %) for CFC-11, CFC-12 and HCFC-22, respectively, which are within the combined error budgets from both measurements. The season cycles of CFC-11, CFC-12 and HCFC-22 from FTIR measurements and MIPAS data show a similar variation: concentration is highest in February-April and lowest in August-October. The trends derived from the combined St Denis and Maïdo FTIR time series are -0.86 ± 0.12 and 2.84 ± 0.06 % year-1 for CFC-11 and HCFC-22, respectively, for the period 2004 to 2016, and -0.76 ± 0.05 % year-1 for CFC-12 for 2009 to 2016. These measurements are consistent with the trends observed by the National Oceanic and Atmospheric Administration (NOAA) Global Monitoring Division's (GMD) Halocarbons & other Atmospheric Trace Species Group (HATS) measurements at Samoa (14.2° S, 170.5° W) for CFC-11 (-0.87 ± 0.04 % year-1), but slightly weaker for HCFC-22 (3.46 ± 0.05 %) year-1 and stronger for CFC-12 (-0.60 ± 0.02 % year-1).

  3. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2016-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) aboard the European satellite Envisat have been retrieved from versions MIPAS/4.61 to MIPAS/4.62 and MIPAS/5.02 to MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon-borne cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS-STRatospheric aircraft (MIPAS-STR), the satellite-borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS), as well as the ground-based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (full resolution, FR: July 2002-March 2004) and were used to validate MIPAS CFC-11 and CFC-12 products during that time, as well as profiles from the Improved Limb Atmospheric Spectrometer, ILAS-II. In general, we find that MIPAS shows slightly higher values for CFC-11 at the lower end of the profiles (below ˜ 15 km) and in a comparison of HATS ground-based data and MIPAS measurements at 3 km below the tropopause. Differences range from approximately 10 to 50 pptv ( ˜ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11 and is not as obvious in the relative differences between MIPAS and any of the comparison instruments. Differences at the lower end of the profile (below ˜ 15 km) and in

  4. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11

    Science.gov (United States)

    The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...

  5. Prediction of future disposal of end-of-life refrigerators containing CFC-11.

    Science.gov (United States)

    Yazici, Burcu; Can, Zehra S; Calli, Baris

    2014-01-01

    The objective of this study was to predict the number of refrigerators containing CFC-11 blown isolation foam and the amount of CFC-11 banked in these refrigerators. By using a Weibull-based survival function, the number of CFC-11 containing and still-functioning refrigerators was estimated to be approximately 1.6 million in 2013 in Turkey. In order to determine the amount of CFC-11 in the isolation foam of these refrigerators, polyurethane (PU) foam samples were taken from a refrigerator manufactured in 1993 and the quantity of CFC-11 was analyzed by a GC-MS. It was determined that 113-195 mg CFC-11/g PU remains in the PU foam depending on the location such as door, sides, top and bottom. Knowing that a mid-sized refrigerator contains 4 kg PU on average, the total amount of PU foam to be disposed of is 6344 tons when the CFC-11 containing refrigerators in Turkey become obsolete in the near future. Furthermore, 717-1237 tons of CFC-11 are expected to be banked in the PU foam of these refrigerators which will exert an equivalent amount of ozone depleting potential (ODP). In addition, the global warming potential will vary between 3.4 and 5.9 million tons of CO2. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Ronald H. Brown Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Section A16S_2005 (11 January - 24 February, 2005)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-08-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb 14C system parameters performed during the A16S_2005 cruise, which took place from January 11 to February 24, 2005, aboard research vessel (R/V) Ronald H. Brown under the auspices of the National Oceanic and Atmospheric Administration (NOAA). The R/V Ronald H. Brown departed Punta Arenas, Chile, on January 11, 2005, and ended its cruise in Fortaleza, Brazil, on February 24, 2005. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and the National Science Foundation as part of the CLIVAR/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 121 stations. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), fugacity of CO2 (fCO2), total alkalinity (TALK), pH, dissolved organic carbon (DOC), CFC, 14C, hydrographic, and other chemical measurements. The R/V Ronald H. Brown A16S_2005 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  7. Absence of PTPN11 mutations in 28 cases of cardiofaciocutaneous (CFC) syndrome.

    Science.gov (United States)

    Ion, Andra; Tartaglia, Marco; Song, Xiaoling; Kalidas, Kamini; van der Burgt, Ineke; Shaw, Adam C; Ming, Jeffrey E; Zampino, Giuseppe; Zackai, Elaine H; Dean, John C S; Somer, Mirja; Parenti, Giancarlo; Crosby, Andrew H; Patton, Michael A; Gelb, Bruce D; Jeffery, Steve

    2002-10-01

    CFC (cardiofaciocutaneous) syndrome (MIM 115150) has been considered by several authors to be a more severe expression of Noonan syndrome. Affected patients present with congenital heart defects, cutaneous abnormalities, Noonan-like facial features and severe psychomotor developmental delay. We have recently demonstrated that Noonan syndrome can be caused by missense mutations in PTPN11(MIM 176876), a gene that encodes the non-receptor protein tyrosine phosphatase SHP-2. In this report, we have evaluated the possible involvement of mutations in PTPN11 in CFC syndrome. A cohort of 28 CFC subjects rigorously assessed as having CFC based on OMIM diagnostic criteria was examined for mutations in the PTPN11 coding sequence by using DHPLC analysis. The results showed no abnormalities in the coding region of the PTPN11 gene in any CFC patient, nor any evidence of major deletions within the gene suggesting that mutations in other gene(s) are responsible for this syndrome.

  8. Cytosine arabinoside reduces the numbers of granulocyte macrophage colony forming cells (GM-CFC) and high proliferative potential colony forming cells (HPP-CFC) in vivo in mice.

    Science.gov (United States)

    Teleka, Stanley; Chijuwa, Alexander; Senga, Edward; Chisi, John E

    2011-12-01

    Cytosine arabinoside (Ara-C) is an S-phase specific cytotoxic drug used in the treatment of malignancies. It is converted to Cytosine Arabinoside triphosphate (Ara-CTP) in the cell. Cytosine Arabinoside triphosphate, reversibly displaces deoxy cytidine triphosphate from DNA polymerase for incorporation into DNA. This process leads to cell death. To investigate the in vivo effects of Ara-C on the Granulocyte Macrophage Colony Forming Cells (GM-CFC) and High Proliferative Potential Colony Forming Cells (HPP-CFC) respectively in mice. Ara-C (150mg/kg) was administered intraperitoneally (i.p) once to mice and bone marrow cells sampled on days 1, 3 and 6. Ara-C reduced the numbers of both GM-CFC and HPP-CFC in the bone marrow. HPP-CFCs were initially more sensitive to Ara-C treatment than GM-CFCs. In the six days after treatment the effect on GM-CFC persisted, while there was a partial recovery in the number of HPP-CFCs. It is possible that Ara-C disturbs the stem cells niche by damaging the stromal cells of the bone marrow microenvironment. This would result in derangement of HPP-CFC proliferation.

  9. Structural insights into the interaction between the Cripto CFC domain and the ALK4 receptor.

    Science.gov (United States)

    Calvanese, Luisa; Saporito, Angela; Oliva, Romina; D' Auria, Gabriella; Pedone, Carlo; Paolillo, Livio; Ruvo, Menotti; Marasco, Daniela; Falcigno, Lucia

    2009-03-01

    The protein Cripto is the founding member of the extra-cellular EGF-CFC growth factors, which are composed of two adjacent cysteine-rich domains: the EGF-like and the CFC. Members of the EGF-CFC family play key roles in embryonic development and are also implicated in tumourigenesis. Cripto is highly over-expressed in many tumours, while it is poorly detectable in normal tissues. Although both Cripto domains are involved in its tumourigenic activity, the CFC domain appears to play a crucial role. Indeed, through this domain, Cripto interferes with the onco-suppressive activity of Activins, either by blocking the Activin receptor ALK4 or by antagonising proteins of the TGF-beta family. We have undertaken the chemical synthesis and the structural characterisation of human CFC Cripto domain. Using a combined NMR and computational approach, supported by binding studies by SPR, we have investigated the molecular basis of the interaction between h-CFC and ALK4. Binding studies indicate that the synthetic h-CFC interacts with the ALK4 receptor with a K(D) in micro M range, whereas it does not recognise the ActRIIB receptor. The NMR study shows that the h-CFC overall topology is determined by the presence of three disulfide bridges and that residues H120 and W124 are located between the first strand and the first loop with the side chains externally exposed. A model of the CFC-ALK4 complex has also been obtained by molecular docking and shows that all residues indicated by prior mutagenesis studies can contribute to the ALK4-CFC interaction at the protein-protein interface.

  10. Organizational Campaigning

    DEFF Research Database (Denmark)

    Hertel, Frederik

    2015-01-01

    This conference paper will explore the difference between communicating changes and changing communication. Based on a case study in which a manager applies two quite different approaches to organizational communication in order to change the organization he is leading. The first and failing...... approach will in be named: organizational campaigning and means (e.g. Kotter, 2012, p. 9 and Clegg, Kornberger & Pitsis, 2009) that the manager takes control with communication and communication cannels in order to ensure successful organizational changes. Since the changes were not succeeding the approach...... is replaced with a new approach which will be named organizing communication. During the case analysis we will see that this change in approach not only change the managers perception of communication but also his perception of the organization he is leading....

  11. Teaching Health Campaigns by Doing Health Campaigns

    Science.gov (United States)

    Neuberger, Lindsay

    2017-01-01

    Courses: Health Campaigns, Health Communication,Communication Campaigns, Public Relations Campaigns, Persuasion. Objectives: Students will demonstrate their ability to work effectively both individually and in teams to apply "health communication" theory to emerging, practical, on-campus health issues via formative research, multimodal…

  12. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  13. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  14. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  15. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  16. Field Campaign Guidelines

    Energy Technology Data Exchange (ETDEWEB)

    Voyles, J. W. [DOE ARM Climate Research Facility, Washington, DC (United States); Chapman, L. A. [DOE ARM Climate Research Facility, Washington, DC (United States)

    2015-12-01

    This document establishes a common set of guidelines for the Atmospheric Radiation Measurement (ARM) Climate Research Facility for planning, executing, and closing out field campaigns. The steps that guide individual field campaigns are described in the Field Campaign Tracking System and are specifically tailored to meet the scope of each field campaign.

  17. Dating groundwater with trifluoromethyl sulfurpentafluoride (SF 5CF3), sulfur hexafluoride (SF6), CF 3Cl (CFC-13), and CF2Cl2 (CFC-12)

    Science.gov (United States)

    Busenberg, E.; Plummer, L.N.

    2008-01-01

    [1] A new groundwater dating procedure using the transient atmospheric signal of the environmental tracers SF5CF3, CFC-13, SF6, and CFC-12 was developed. The analytical procedure determines concentrations of the four tracers in air and water samples. SF 5CF3 and CFC-13 can be used to date groundwaters in some environments where the CFCs and SF6 have previously failed because these new tracers have increasing atmospheric input functions, no known terrigenic source, and are believed to be stable under reducing conditions. SF5CF3 has a dating range from 1970 to modern; the mixing ratio (mole fraction) in North American air has increased from the detection limit of 0.005 parts per trillion (ppt) to the 2006 mole fraction of about 0.16 ppt. No evidence was found for degradation of SF5CF3 in laboratory anaerobic systems. The solubility of SF5CF3 was measured in water from 1 to 35??C. Groundwater samples that contained large amounts of terrigenic SF6 did not contain terrigenic SF 5CF3. CFC-13 is a trace atmospheric gas with a dating range in groundwater of about 1965 to modem. CFC-13 has been used primarily in very low-temperature refrigeration; thus groundwater environments are less likely to be contaminated with nonatmospheric sources as compared to other widely used CFCs. Because of the low solubility of SF5CF3 and CFC-13 in water, an excess air correction must be applied to the apparent ages. The new dating procedure was tested in water samples from wells and springs from Maryland, Virginia, and West Virginia.

  18. Moving from CFC aerosol to HFA aerosol or dry powder inhalers: what do patients think?

    Science.gov (United States)

    Hartung, Thomas K; Allbutt, Helen; Dewar, Maria; Innes, J Alastair; Crompton, Graham K

    2002-01-01

    Environmentally friendly hydrofluoroalkane (HFA) pressurised metered-dose inhalers are currently being marketed to replace chlorofluorocarbon (CFC)-driven devices. It is uncertain whether these new formulations with different properties are acceptable to patients. Similarly, switching a patient to a dry powder inhaler (DPI) carries the risk of non-acceptance. One hundred patients with obstructive airway disease on regular CFC aerosol inhaler medication underwent a standardised, structured interview. During the interview patients were asked to use a new HFA aerosol inhaler and three DPIs in random order. Patients' notions were recorded. Most patients (96) agreed to change from their CFC to the HFA inhaler, of those, only 12 did so with some reservation. Properties (taste, user-friendliness, design) of the HFA inhaler were rated favourably. DPIs represented an acceptable alternative to aerosol inhalers. In fact, 57 patients preferred a DPI over the HFA inhaler. Not all powder devices were equally acceptable. Replacing the CFC inhaler with patients' preferred alternative devices resulted in a more than 3-fold increase in costs. Concerns about the acceptability of reformulated CFC-free aerosol inhalers are ill founded. However, if given the choice, many patients prefer a DPI over the HFA inhaler. The transition offers an opportunity to review patients' current treatment and the proficiency of their inhaling technique. Moving to CFC-free inhalers will have revenue implications. Copyright 2002 S. Karger AG, Basel

  19. PTPN11 mutations are not responsible for the Cardiofaciocutaneous (CFC) syndrome.

    Science.gov (United States)

    Kavamura, M I; Pomponi, M G; Zollino, M; Lecce, R; Murdolo, M; Brunoni, D; Alchorne, M M A; Opitz, J M; Neri, G

    2003-01-01

    Cardiofaciocutaneous (CFC) syndrome is a multiple congenital anomalies/mental retardation syndrome characterized by congenital heart defects, characteristic facial appearance, short stature, ectodermal abnormalities and mental retardation. It was described in 1986, and to date is of unknown genetic etiology. All reported cases are sporadic, born to non-consanguineous parents and have apparently normal chromosomes. Noonan and Costello syndromes remain its main differential diagnosis. The recent finding of PTPN11 missense mutations in 45-50% of the Noonan patients studied with penetrance of almost 100% and the fact that in animals mutations of this gene cause defects of semilunar valvulogenesis, made PTPN11 mutation screening in CFC patients a matter of interest. We sequenced the entire coding region of the PTPN11 gene in ten well-characterised CFC patients and found no base changes. We also studied PTPN11 cDNA in our patients and demonstrated that there are no interstitial deletions either. The genetic cause of CFC syndrome remains unknown, and PTPN11 can be reasonably excluded as a candidate gene for the CFC syndrome, which we regard as molecular evidence that CFC and Noonan syndromes are distinct genetic entities.

  20. Distribution and ventilation of water masses in the western Ross Sea inferred from CFC measurements

    Science.gov (United States)

    Rivaro, Paola; Ianni, Carmela; Magi, Emanuele; Massolo, Serena; Budillon, Giorgio; Smethie, William M.

    2015-03-01

    During the CLIMA Project (R.V. Italica cruise PNRA XVI, January-February 2001), hydrographic and chlorofluorocarbons (CFCs) observations were obtained, particularly in the western Ross Sea. Their distribution demonstrated water mass structure and ventilation processes in the investigated areas. In the surface waters (AASW) the CFC saturation levels varied spatially: CFCs were undersaturated in all the areas (range from 80 to 90%), with the exception of few stations sampled near Ross Island. In particular, the Terra Nova Bay polynya, where high salinity shelf water (HSSW) is produced, was a low-saturated surface area (74%) with respect to CFCs. Throughout most of the shelf area, the presence of modified circumpolar deep water (MCDW) was reflected in a mid-depth CFC concentration minima. Beneath the MCDW, CFC concentrations generally increased in the shelf waters towards the seafloor. We estimated that the corresponding CFCs saturation level in the source water region for HSSW was about 68-70%. Waters with high CFC concentrations were detected in the western Ross Sea on the down slope side of the Drygalski Trough, indicating that AABW was being supplied to the deep Antarctic Basin. Estimates of ventilation ages depend strongly on the saturation levels. We calculated ventilation ages using the saturation level calibrated tracer ratio, CFC11/CFC12. We deduced a mean residence time of the shelf waters of about 6-7 years between the western Ross Sea source and the shelf break.

  1. Political Campaign Manual

    OpenAIRE

    Peter W Jones

    2004-01-01

    This manual is geared toward a campaign that is grassroots and democratic, actively engaging citizens and campaign volunteers. Such a campaign is ecological in its use of resources as well as in its policy positions. A people's campaign is one in which means and ends are harmoniously interwoven: the conduct of the campaign is fully reflective of the values and political positions of the candidate. It shows its commitment to social justice through inclusion of diverse citizens in its deliberat...

  2. Global three-dimensional model calculations of the budgets and present-day atmospheric lifetimes of CF2ClCFCl2 (CFC-113) and CHClF2 (CFC-22)

    Science.gov (United States)

    Golombek, Amram; Prinn, Ronald G.

    1989-01-01

    The annual percentage increases in concentrations of the chlorofluorocarbons CFC-113 (an industrial solvent) and CFC-22 (a refrigerant) are the highest among major chlorofluorocarbons in the atmosphere today. The present-day atmospheric lifetimes for these species are computed using a global three-dimensional dynamical-chemical model. The present-day lifetimes of both are long (15.5 years for CFC-22 and 136 or 195 years for CFC-113, depending on assumed O2 absorption cross sections), underscoring the need to decrease their emissions in order to minimize their future role in ozone destruction and greenhouse warming.

  3. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  4. SIMULATION OF PERFORMANCE OF CHLORINE-FREE FLURORINATED ETHERS AND FLUORINATED HYDROCARBONS TO REPLACE CFC-11 AND CFC-114 IN CHILLERS

    Science.gov (United States)

    The paper discusses simulation of the performance of chlorine-free fluorinated ethers and fluorinated hydrocarbons as potential long-term replacements for CFC-11 and -114. Modeling has been done with in-house refrigeration models based on the Carnahan-Starling-DeSantis Equation o...

  5. The "Know Stroke" Campaign

    Science.gov (United States)

    ... Current Issue Past Issues Special Section The "Know Stroke" Campaign Past Issues / Summer 2007 Table of Contents ... campaign for the U.S. Hispanic community. 1 Know Stroke A stroke occurs when the blood supply to ...

  6. Collision Repair Campaign

    Science.gov (United States)

    The Collision Repair Campaign targets meaningful risk reduction in the Collision Repair source category to reduce air toxic emissions in their communities. The Campaign also helps shops to work towards early compliance with the Auto Body Rule.

  7. PERBANDINGAN IMPLEMENTASI ADVERTISING CAMPAIGN

    OpenAIRE

    Francisca Hanna , Febrianti

    2013-01-01

    Advertising campaign merupakan serangkaian bentuk iklan melalui berbagai media dan berpusat pada satu tema dalam satu waktu. Tujuan utama advertising campaign adalah menyampaikan pesan dalam suatu tema yang diluncurkan kepada masyarakat sehingga tema tersebut menjadi ciri khas produk. Peluncuran tema campaign oleh Coca Cola dan Pepsi yang merupakan rival dalam kategori beverage merupakan obyek dari penelitian ini. Kesuksesan sebuah tema advertising campaign dilihat dengan menggunakan paramet...

  8. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  9. Diversity: A Corporate Campaign

    Science.gov (United States)

    Akiyama, Diana D.

    2008-01-01

    In this article, the author calls for a "campaign" because she believes there is a need to build upon the successes of diversity initiatives with renewed commitment, in much the same way as capital campaigns build upon past successes and refocus campuses on their work. Just as a capital campaign invests in financial stability by stimulating…

  10. Reformulation of Stmerin(®) D CFC formulation using HFA propellants.

    Science.gov (United States)

    Murata, Saburo; Izumi, Takashi; Ito, Hideki

    2013-01-01

    Stmerin(®) D was reformulated using hydrofluoroalkanes (HFA-134a and HFA-227) as alternative propellants instead of chlorofluorocarbons (CFCs), where the active ingredients were suspended in mixed CFCs (CFC-11/CFC-12/CFC-114). Here, we report the suspension stability and spray performance of the original CFC formulation and a reformulation using HFAs. We prepared metered dose inhalers (MDI) using HFAs with different surfactants and co-solvents, and investigated the effect on suspension stability by visual testing. We found that the drug suspension stability was poor in both HFAs, but was improved, particularly for HFA-227, by adding a middle chain fatty acid triglycerides (MCT) to the formulation. However, the vapor pressure of HFA-227 is higher than a CFC mixture and this increased the fine particle dose (FPD). Spray performance was adjusted by altering the actuator configuration, and the performance of different actuators was tested by cascade impaction. We found the spray performance could be controlled by the configuration of the actuator. A spray performance comparable to the original formulation was obtained with a 0.8 mm orifice diameter and a 90° cone angle. These results demonstrate that the reformulation of Stmerin(®) D using HFA-227 is feasible, by using MCT as a suspending agent and modifying the actuator configuration.

  11. Chlorofluorocarbons (CFC's): Regulation and replacement. (Latest citations from the PIRA Ppackaging, Paper, Printing, and Publishing, and Nonwovens abstracts database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The bibliography contains citations concerning chlorofluorocarbons (CFC's), and efforts to find substitute materials in response to the need to lessen the environmental impact of CFC on the ozone layer, as agreed to in the international Montreal Protocol. CFC alternatives are expected to be used as aerosol propellants, blowing agents, refrigerants, fire extinguishants, and solvents. References to the effects of CFC on ozone are found in separate bibliographies. (Contains 250 citations and includes a subject term index and title list.)

  12. Substance Requirements for Entities Located in a Harmful Tax Jurisdiction under CFC Rules and the EU Freedom of Establishment

    NARCIS (Netherlands)

    Smit, Daniël

    2014-01-01

    The author considers the minimum level of substance EU Member States may require in light of the freedom of establishment when designing and applying CFC rules, as well as the extent to which CFC rules may be justified by the mere fact that the foreign controlled company benefits from a harmful tax

  13. Øvrige værnsreglers betydning ved dansk CFC-beskatning

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver

    2014-01-01

    I artiklen analyseres spørgsmålet om, hvorvidt de forskellige værnsregler i dansk skattelovgivning også skal finde anvendelse ved udarbejdelsen af de opgørelser, som skal foretages i henhold til reglerne om CFC-beskatning. Spørgsmålet har givet anledning til overvejelser i såvel litteraturen som i...... anvendelse ved opgørelsen af et CFC-selskabs indkomst, medmindre det specifikt fremgår af den pågældende regel, dens lovforarbejder eller lignende, at reglen ikke er tiltænkt at skulle finde anvendelse i relation til CFC-selskaber....

  14. 40 CFR Appendix F to Subpart B of... - Standard for Recover-Only Equipment That Extracts a Single, Specific Refrigerant Other Than CFC...

    Science.gov (United States)

    2010-07-01

    ... That Extracts a Single, Specific Refrigerant Other Than CFC-12 or HFC-134a F Appendix F to Subpart B of... Refrigerant Other Than CFC-12 or HFC-134a Foreword These specifications are for equipment that recover, but does not recycle, any single, specific automotive refrigerant other than CFC-12 or HFC-134a, including...

  15. A Political Campaign Strategy and Campaign Theme : How to Win a Political Campaign

    OpenAIRE

    河村, 直幸; Kawamura, Naoyuki

    2004-01-01

    The aim of this research paper is to introduce a political campaign strategy. A political campaign should do on a scientific system and needs effective strategy. Before political campaign begin, a candidate and its campaigner needs to analyze election district and sample voter opinion. An election campaign needs campaign theme. The creation of campaign theme needs careful and elaborate planning. A style of campaign varies according to incumbent or challenger. The developing of an effective po...

  16. Colony forming cell (CFC) assay for human hematopoietic cells.

    Science.gov (United States)

    Sarma, Nayan J; Takeda, Akiko; Yaseen, Nabeel R

    2010-12-18

    Human hematopoietic stem/progenitor cells are usually obtained from bone marrow, cord blood, or peripheral blood and are used to study hematopoiesis and leukemogenesis. They have the capacity to differentiate into lymphoid and myeloid lineages. The colony forming cell (CFC) assay is used to study the proliferation and differentiation pattern of hematopoietic progenitors by their ability to form colonies in a semisolid medium. The number and the morphology of the colonies formed by a fixed number of input cells provide preliminary information about the ability of progenitors to differentiate and proliferate. Cells can be harvested from individual colonies or from the whole plate to further assess their numbers and differentiation states using flow cytometry and morphologic evaluation of Giemsa-stained slides. This assay is useful for assessing myeloid but not lymphoid differentiation. The term myeloid in this context is used in its wider sense to encompass granulocytic, monocytic, erythroid, and megakaryocytic lineages. We have used this assay to assess the effects of oncogenes on the differentiation of primary human CD34+ cells derived from peripheral blood. For this purpose cells are transduced with either control retroviral construct or a construct expressing the oncogene of interest, in this case NUP98-HOXA9. We employ a commonly used retroviral vector, MSCV-IRES-GFP, that expresses a bicistronic mRNA that produces the gene of interest and a GFP marker. Cells are pre-activated by growing in the presence of cytokines for two days prior to retroviral transduction. After another two days, GFP+ cells are isolated by fluorescence-activated cell sorting (FACS) and mixed with a methylcellulose-containing semisolid medium supplemented with cytokines and incubated till colonies appear on the surface, typically 14 days. The number and morphology of the colonies are documented. Cells are then removed from the plates, washed, counted, and subjected to flow cytometry and

  17. Strategic Positioning and Campaigning

    OpenAIRE

    Glazer, Amihai

    1998-01-01

    Data from U.S. presidential elections show that most third parties take extreme positions rather than positions between those of the major parties. This and other phenomena are explained with an extension of the Downsian model of elections. When parties choose not only positions, but also choose among which voters to campaign, then a small party may choose an extreme position to reduce the effectiveness of campaigns against it, and to induce a big party to campaign against another big party, ...

  18. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  19. Switching from CFC to HFA Inhalers: What NPs and Their Patients Need to Know.

    Science.gov (United States)

    Velsor-Friedrich, Barbara; Militello, Lisa Kinsella; Zinn, Kelly K; DeWolff, Darla K

    2009-10-01

    The aim of this article is to provide nurse practitioners with a better understanding of the transition from chlorofluorocarbon (CFC) to hydrofluoralkane (HFA) metered-dose inhalers (MDIs). The authors discuss the differences in these products' propellants; the proper use, cost, and efficacy of the HFA inhalers; and the implications of the switch for NPs and for their patients with asthma.

  20. Absence of PTPN11 mutations in 28 cases of cardiofaciocutaneous (CFC) syndrome.

    NARCIS (Netherlands)

    Ion, A.; Tartaglia, M.; Song, X.; Kalidas, K.; Burgt, C.J.A.M. van der; Shaw, A.; Ming, J.E.; Zampino, G.; Zackai, E.H.; Dean, J.; Somer, M.; Parenti, G.; Crosby, A.; Patton, M.A.; Gelb, B.D.; Jeffery, S.

    2002-01-01

    CFC (cardiofaciocutaneous) syndrome (MIM 115150) has been considered by several authors to be a more severe expression of Noonan syndrome. Affected patients present with congenital heart defects, cutaneous abnormalities, Noonan-like facial features and severe psychomotor developmental delay. We have

  1. Functional redundancy of EGF-CFC genes in epiblast and extraembryonic patterning during early mouse embryogenesis.

    Science.gov (United States)

    Chu, Jianhua; Shen, Michael M

    2010-06-01

    During early mouse embryogenesis, multiple patterning and differentiation events require the activity of Nodal, a ligand of the transforming growth factor-beta (TGFbeta) family. Although Nodal signaling is known to require activity of EGF-CFC co-receptors in many contexts, it has been unclear whether all Nodal signaling in the early mouse embryo is EGF-CFC dependent. We have investigated the double null mutant phenotypes for the EGF-CFC genes Cripto and Cryptic, which encode co-receptors for Nodal, and have found that they have partially redundant functions in early mouse development. Expression of Cripto and Cryptic is non-overlapping prior to gastrulation, since Cripto is expressed solely in the epiblast whereas Cryptic is expressed in the primitive endoderm of the late blastocyst and the visceral endoderm after implantation. Despite these non-overlapping expression patterns, Cripto; Cryptic double mutants display severe defects in epiblast, extraembryonic ectoderm, and anterior visceral endoderm (AVE), resulting in phenotypes that are highly similar to those of Nodal null mutants. Our results indicate that both Cripto and Cryptic function non-cell-autonomously during normal development, and that most if not all Nodal activity in early mouse embryogenesis is EGF-CFC-dependent. Copyright 2010 Elsevier Inc. All rights reserved.

  2. COMPARISON OF CFC-114 AND HFC-236EA PERFORMANCE IN SHIPBOARD VAPOR COMPRESSION SYSTEMS

    Science.gov (United States)

    The report gives results of a comparison of the performance of two refrigerants - 1,1,1,2,3,3-hexafluoropropane (HFC-236ea) and 1,2-dichloro-tetrafluoroethane (CFC-114) - in shipboard vapor compression refrigeration systems. (NOTE: In compliance with the Montreal Protocol and Dep...

  3. IDENTIFYING AND EVALUATING ALTERNATIVES TO CFC-114 FOR NAVY SHIPBOARD CHILLERS

    Science.gov (United States)

    The paper outlines EPA's role in investigating alternatives to replace the chlorofluorocarbon CFC-114 (1,1,2,2-tetrafluorodichloroethane) as the refrigerant in retrofitted Navy shipboard chillers. The isomers HFC-236ea (1,1,1,2,3,3-hexafluoropropane) and HFC-236fa (1,1,1,3,3,3-he...

  4. Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G., E-mail: gaelle.chevet@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Martin, E., E-mail: martin@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Camus, G., E-mail: camus@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Herb, V., E-mail: herb@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Schlosser, J., E-mail: jacques.schlosser@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Escourbiac, F., E-mail: frederic.escourbiac@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Missirlian, M., E-mail: marc.missirlian@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France)

    2011-10-01

    The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.

  5. CNS imaging is a key diagnostic tool in the evaluation of patients with CFC syndrome: two cases and literature review.

    Science.gov (United States)

    Papadopoulou, Eleftheria; Sifakis, Stavros; Sol-Church, Katia; Klein-Zighelboim, Eva; Stabley, Deborah L; Raissaki, Maria; Gripp, Karen W; Kalmanti, Maria

    2011-03-01

    Cardio-facio-cutaneous (CFC) syndrome is characterized by a variable degree of cognitive impairment, and multiple congenital anomalies including characteristic facies, cardiac, and ectodermal abnormalities. CFC syndrome is caused by mutations in the genes BRAF, MEK1, or MEK2. Here we provide a follow-up report on two patients presenting distinct facial appearance and other features of the syndrome, and we present the first molecular evidence of paternal origin for a CFC-causing germline mutation. Brain imaging revealed a lipoma of the corpus callosum and periventricular leukoencephalopathy as well as a hypoplastic corpus callosum, and defects in myelinization, in each patient, respectively. A review of the literature showed that, although non-specific, ventriculomegaly, hydrocephalus, and cortical atrophy represent the most frequent imaging findings of brain anomalies in CFC syndrome. CNS abnormalities are significant diagnostic features of CFC syndrome and a brain MRI is recommended in individuals diagnosed with CFC or suspected of having CFC syndrome. Copyright © 2011 Wiley-Liss, Inc.

  6. Absence of 12q21.2q22 deletions and subtelomeric rearrangements in cardiofaciocutaneous (CFC) syndrome patients.

    Science.gov (United States)

    Kavamura, M I; Zollino, M; Lecce, R; Murdolo, M; Brunoni, D; Alchorne, M M A; Opitz, J M; Neri, G

    2003-06-01

    Recent publications described two patients with a CFC-like phenotype and the same deletion of chromosome region 12q21.2q22 [Rauen et al., 2000, 2002]. The patients did not have the classical CFC phenotype and presented other signs not usually seen in CFC patients: the first patient had hydrocephalus, and the second, a history of olygohydramnios, normal stature, pyloric stenosis, cutaneous syndactyly of toes and bilateral transverse palmar creases. In order to verify if classic CFC patients with normal chromosomes in conventional preparations have microdeletions within the 12q21.2q22 chromosome region, we performed FISH analysis using 12 BAC probes to screen this area. The average interval between the probes was of approximately 1 Mb. No deletions were found in any of the 17 classical CFC patients we examined. We conclude that the region 12q21.2q22 is not a candidate region for CFC syndrome and that the patients described by Rauen et al. [2000, 2002] probably have a different condition, i.e., an aneuploidy syndrome, with some phenotypic resemblance to the CFC syndrome. To further evaluate the possibility of other chromosome imbalances, we performed a subtelomeric analysis, by FISH technique, of all chromosomes, and did not find any subtelomeric rearrangements. Copyright 2003 Wiley-Liss, Inc.

  7. The 1971 Literacy Campaign.

    Science.gov (United States)

    Hall, Budd L., Ed.

    Results of a study of the campaigns to eliminate illiteracy in five districts of Tanzania are reported. Using case study methods, researchers from the Institute of Adult Education followed a common outline in collecting data from the Mafia, Ukerewe, Masasi, Kilimanjaro, and Pare Districts regarding their literacy campaigns. The outline was 1.…

  8. EGF-CFC proteins are essential coreceptors for the TGF-β signals Vg1 and GDF1

    Science.gov (United States)

    Cheng, Simon K.; Olale, Felix; Bennett, James T.; Brivanlou, Ali H.; Schier, Alexander F.

    2003-01-01

    The TGF-β signals Nodal, Activin, GDF1, and Vg1 have been implicated in mesoderm induction and left-right patterning. Nodal and Activin both activate Activin receptors, but only Nodal requires EGF-CFC coreceptors for signaling. We report that Vg1 and GDF1 signaling in zebrafish also depends on EGF-CFC proteins, but not on Nodal signals. Correspondingly, we find that in Xenopus Vg1 and GDF1 bind to and signal through Activin receptors only in the presence of EGF-CFC proteins. These results establish that multiple TGF-β signals converge on Activin receptor/EGF-CFC complexes and suggest a more widespread requirement for coreceptors in TGF-β signaling than anticipated previously. PMID:12514096

  9. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  10. Chick CFC controls Lefty1 expression in the embryonic midline and nodal expression in the lateral plate.

    Science.gov (United States)

    Schlange, T; Schnipkoweit, I; Andrée, B; Ebert, A; Zile, M H; Arnold, H H; Brand, T

    2001-06-15

    Members of the EGF-CFC family of proteins have recently been implicated as essential cofactors for Nodal signaling. Here we report the isolation of chick CFC and describe its expression pattern, which appears to be similar to Cfc1 in mouse. During early gastrulation, chick CFC was asymmetrically expressed on the left side of Hensen's node as well as in the emerging notochord, prechordal plate, and lateral plate mesoderm. Subsequently, its expression became confined to the heart fields, notochord, and posterior mesoderm. Implantation experiments suggest that chick CFC expression in the lateral plate mesoderm is dependent on BMP signaling, while in the midline its expression depends on an Activin-like signal. The asymmetric expression domain within Hensen's node was not affected by application of FGF8, Noggin, or Shh antibody. Implantation of cells expressing human or mouse CFC2, or chick CFC on the right side of Hensen's node randomized heart looping without affecting expression of genes involved in left-right axis formation, including SnR, Nodal, Car, or Pitx2. Application of antisense oligodeoxynucleotides to the midline of Hamburger-Hamilton stage 4-5 embryos also randomized heart looping, but in contrast to the overexpression experiments, antisense oligodeoxynucleotide treatment resulted in bilateral expression of Nodal, Car, Pitx2, and NKX3.2, whereas Lefty1 expression in the midline was transiently lost. Application of the antisense oligodeoxynucleotides to the lateral plate mesoderm abolished Nodal expression. Thus, chick CFC seems to have a dual function in left-right axis formation by maintaining Nodal expression in the lateral plate mesoderm and controlling expression of Lefty1 expression in the midline territory. Copyright 2001 Academic Press.

  11. Results of the JET real-time disruption predictor in the ITER-like wall campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Jesús, E-mail: jesus.vega@ciemat.es [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Dormido-Canto, Sebastián [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); López, Juan M. [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Murari, Andrea [Consorzio RFX, Associazione EURATOM/ENEA per la Fusione, Padua (Italy); Ramírez, Jesús M. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Moreno, Raúl [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Ruiz, Mariano [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Alves, Diogo [Associação EURATOM/IST, Instituto de Plasmas e Fusão Nuclear – Laboratório Associado, Instituto Superior Técnico, P-1049-001 Lisboa (Portugal); Felton, Robert [EURATOM/CCFE Fusion Association, Culham Science Center, Abingdon, Oxon OX14 3DB (United Kingdom)

    2013-10-15

    Highlights: •JET real-time disruption predictor with metallic wall 991 discharges analyzed. •Predictor training has been carried out with JET C wall data. •Success, false alarm and missed alarm rates are 98.4%, 0.9% and 1.6%, respectively. •Alarms are triggered in average 426 ms before the disruption. -- Abstract: The impact of disruptions in JET became even more important with the replacement of the previous Carbon Fiber Composite (CFC) wall with a more fragile full metal ITER-like wall (ILW). The development of robust disruption mitigation systems is crucial for JET (and also for ITER). Moreover, a reliable real-time (RT) disruption predictor is a pre-requisite to any mitigation method. The Advance Predictor Of DISruptions (APODIS) has been installed in the JET Real-Time Data Network (RTDN) for the RT recognition of disruptions. The predictor operates with the new ILW but it has been trained only with discharges belonging to campaigns with the CFC wall. 7 real-time signals are used to characterize the plasma status (disruptive or non-disruptive) at regular intervals of 32 ms. After the first 3 JET ILW campaigns (991 discharges), the success rate of the predictor is 98.36% (alarms are triggered in average 426 ms before the disruptions). The false alarm and missed alarm rates are 0.92% and 1.64%.

  12. [Generation of high proliferative potential hematopoietic progenitor cells from embryonic stem cell-derived BL-CFC].

    Science.gov (United States)

    Yao, Hui-Yu; Liu, Bing; Yuan, Ye; Mao, Ning

    2003-08-01

    The blast colony-forming cells (BL-CFC), which are detected within embryoid bodies derived from embryonic stem cells (ES cells) differentiated for 2.5-3.5 days, have dual-potential of differentiation to hematopoietic and endothelial cells. In this investigation the culture method of BL-CFC was established and colony forming assay, immunofluorescent technique as well as nested RT-PCR was employed to identify the differentiation capacity of adherent and nonadherent cells derived from individual blast colony. The results showed that the adherent cells could intake DiI-Ac-LDL and expressed the endothelium-specific surface markers including CD31, UEA-I and VE-cadherin. In addition, nonadherent cells were capable of developing primitive or/and definitive hematopoiesis potential. High proliferative potential colony-forming cells (HPP-CFC) bearing self-renewal capacity was found in 20% of BL-CFC. It is concluded that BL-CFC derived from embryonic stem cells can generate high proliferative potential hematopoietic progenitor cells. However, the whether BL-CFC can reconstitute the adult bone marrow hematopoiesis in long-term remains to be further determined.

  13. The CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto. Functional and structural insights through disulfide structure analysis.

    Science.gov (United States)

    Foley, Susan F; van Vlijmen, Herman W T; Boynton, Raymond E; Adkins, Heather B; Cheung, Anne E; Singh, Juswinder; Sanicola, Michele; Young, Carmen N; Wen, Dingyi

    2003-09-01

    The disulfide structure of the CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto protein was determined by a combination of enzymatic and chemical fragmentation, followed by chromatographic separation of the fragments, and characterization by mass spectrometry and N-terminal sequencing. These studies showed that Cys115 forms a disulfide bond with Cys133, Cys128 with Cys149, and Cys131 with Cys140. Protein database searching and molecular modeling revealed that the pattern of disulfide linkages in the CFC domain of Cripto is the same as that in PARS intercerebralis major Peptide C (PMP-C), a serine protease inhibitor, and that the EGF-CFC domains of Cripto are predicted to be structurally homologous to the EGF-VWFC domains of the C-terminal extracellular portions of Jagged 1 and Jagged 2. Biochemical studies of the interactions of ALK4 with the CFC domain of Cripto by fluorescence-activated cell sorter analysis indicate that the CFC domain binds to ALK4 independent of the EGF domain. A molecular model of the CFC domain of Cripto was constructed based on the nuclear magnetic resonance structure of PMP-C. This model reveals a hydrophobic patch in the domain opposite to the presumed ALK4 binding site. This hydrophobic patch may be functionally important for the formation of intra or intermolecular complexes.

  14. Life of Pennzane and 815Z-Lubricated Instrument Bearings Cleaned with Non-CFC Solvents

    Science.gov (United States)

    Loewenthal, Stuart H.; Jones, William R., Jr.; Predmore, Roamer E.

    1999-01-01

    Life tests were conducted on instrument scanner ball bearings cleaned with 3 types of non-ozone depleting solvents and compared with those cleaned with a conventional CFC-113 (Freon) solvent. The test bearings were lubricated with the standard space oil (Bray 815Z, Fomblin Z25) and a more recent synthetic space oil (Pennzane 2001). Lives with replacement solvents equaled or exceeded those obtained with CFC-113 baseline, indicating that alternate cleaning solvents were acceptable. Pennzane lubricated bearings enjoyed a significant life advantage (>5X) over those lubricated with Bray 815Z oil in these oscillatory gimbal bearing tests. Many of the Pennzane bearings are still exhibiting acceptable torque traces after more than 25,000 hr of test.

  15. CFC substitutes for refrigeration engineering. FCKW-Substitute fuer die Kaeltetechnik

    Energy Technology Data Exchange (ETDEWEB)

    Henrici, R. (Hoechst AG, Forschung und Entwicklung Chemikalien, Frankfurt am Main (Germany))

    1993-12-01

    The international attempts ot protect the earth atmosphere have accelerated the world-wide search for CFC substitutes. Enormous efforts have been undertaken in the last few years to solve the problems occurring with new refrigerants and to find suitable lubricants. The article discusses the following subjects: Requirements on future refrigerants, effects on the ''greenhouse problem'', toxicological properties, problems in practical application, trends of development, refrigerant mixtures, conversion of older plants, recycling of refrigerants. (SR)

  16. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  17. The Use of HFC (CFC Free) Processes at the NASA Stennis Space Center

    Science.gov (United States)

    Ross, Richard H.

    1997-01-01

    The search for ozone depleting alternative chemicals was heightened when, in 1990, the more than 65 countries that had signed the Montreal Protocol agreed to phase out completely by the year 2000. In 1992, then-president Bush advanced this date for the United States to January l, 1996. In 1991, it was realized that the planned phase out and eventual elimination of ozone depleting chemicals imposed by the Montreal Protocol and the resulting Clean Air Act (CAA) amendments would impact the cleaning and testing of aerospace hardware at the NASA Stennis Space Center. Because of this regulation, the Test & Engineering Sciences Laboratory has been working on solvent conversion studies to replace CFC-113. Aerospace hardware and test equipment used in rocket propulsion systems require extreme cleanliness levels to function and maintain their integrity. Because the cleanliness of aerospace hardware will be affected by the elimination of CFC-113; alternate cleaning technologies, including the use of fluoridated solvents have been studied as potential replacements. Several aqueous processes have been identified for cleaning moderately sized components. However, no known aqueous alternative exists for cleaning and validating T&ME and complex geometry based hardware. This paper discusses the choices and the methodologies that were used to screen potential alternatives to CFC-113.

  18. Development of CFC-Free Cleaning Processes at the NASA White Sands Test Facility

    Science.gov (United States)

    Beeson, Harold; Kirsch, Mike; Hornung, Steven; Biesinger, Paul

    1995-01-01

    The NASA White Sands Test Facility (WSTF) is developing cleaning and verification processes to replace currently used chlorofluorocarbon-113- (CFC-113-) based processes. The processes being evaluated include both aqueous- and solvent-based techniques. The presentation will include the findings of investigations of aqueous cleaning and verification processes that are based on a draft of a proposed NASA Kennedy Space Center (KSC) cleaning procedure. Verification testing with known contaminants, such as hydraulic fluid and commonly used oils, established correlations between nonvolatile residue and CFC-113. Recoveries ranged from 35 to 60 percent of theoretical. WSTF is also investigating enhancements to aqueous sampling for organics and particulates. Although aqueous alternatives have been identified for several processes, a need still exists for nonaqueous solvent cleaning, such as the cleaning and cleanliness verification of gauges used for oxygen service. The cleaning effectiveness of tetrachloroethylene (PCE), trichloroethylene (TCE), ethanol, hydrochlorofluorocarbon-225 (HCFC-225), tert-butylmethylether, and n-Hexane was evaluated using aerospace gauges and precision instruments and then compared to the cleaning effectiveness of CFC-113. Solvents considered for use in oxygen systems were also tested for oxygen compatibility using high-pressure oxygen autoignition and liquid oxygen mechanical impact testing.

  19. Kinetic characterization of Aspergillus niger chitinase CfcI using a HPAEC-PAD method for native chitin oligosaccharides.

    Science.gov (United States)

    van Munster, Jolanda M; Sanders, Peter; ten Kate, Geralt A; Dijkhuizen, Lubbert; van der Maarel, Marc J E C

    2015-04-30

    The abundant polymer chitin can be degraded by chitinases (EC 3.2.1.14) and β-N-acetyl-hexosaminidases (EC 3.2.1.52) to oligosaccharides and N-acetyl-glucosamine (GlcNAc) monomers. Kinetic characterization of these enzymes requires product quantification by an assay method with a low detection limit, preferably compatible with the use of native, non-labeled substrates. Here we report a quantitative HPAEC-PAD method that allows fast separation of chitin oligosaccharides (COS) ranging from (GlcNac)1-6 at detection limits of 1-3 pmol and a linear range of 5-250 pmol. Quantification under intra- and interday precision conditions was performed with 2.1-5.4% relative standard deviation (RSD) and 1.2-10.3% RSD, respectively. This method was successfully used for the determination of the kinetic parameters of the Aspergillus niger chitinase CfcI with native COS. CfcI was recently shown to release GlcNAc from the reducing end of COS, a new activity for fungal chitinases. A Carbohydrate Binding Module of family 18 (CBM18) is inserted in the CfcI catalytic domain. Site directed mutagenesis was used to assess the functionality of this CfcI-CBM18: four of its key amino acids were replaced by glycine residues, yielding CfcISYNF. Comparison of the kinetic parameters of CfcI and CfcISYNF confirmed that this CBM18 is functionally involved in catalysis. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Japanese respond to campaign.

    Science.gov (United States)

    1994-08-01

    A unique campaign launched by JOICFP in August 1993 had by the end of June 1994 netted US $41,200 to support activities of the integrated Project (IP) in developing countries. Under the campaign, the public, institutions, organizations, and businesses have been sending in used prepaid cards for sale to collectors in Japan and abroad. Prepaid cards are widely used throughout Japan for phones, subways, railways and highways. Nippon Telegraph and Telephone Corporation (NTT) alone issues 20 million cards annually. The campaign, which has been widely featured in the media, has proved effective for drawing attention to JOICFP and to population and family planning issues. Gaining the understanding of the Japanese public about population issues has grown in importance since the government's announcement of the new Global Issues Initiative (GII). Word about the campaign was carried by radio, television, newspapers, and magazines nationwide. The number of cards sent in escalated with the attention. By the end of June, JOICFP had received around 700,000 cards, of which 550,000 have been exchanged for cash. The funds generated by the card sales have been allocated to support grassroots IP activities and encourage the self-reliance of projects in China, Ghana, Guatemala, Nepal, Tanzania, and Zambia. Responses to the campaign have come from individuals as well as local governments, hospitals, enterprises, and educational institutions. Many of these have initiated their own card-collection system and information-dissemination activities to support JOICFP. Over 5000 different organizations are now collaborating with JOICFP for the campaign, including Tenmaya Department Store in Okayama City.

  1. INTEGRATED ADVERTISING CAMPAIGN

    Directory of Open Access Journals (Sweden)

    Adina Claudia NEAMŢU

    2010-06-01

    Full Text Available Campaign and especially advertising campaign represents one of the variables of the marketing mix, an important one, being difficult to separate its contribution from the one of the other elements. Irrespective of the specific object that is behind an advertising company, the investment will be retrieved only if the right information is transmitted to the right persons in the right way. This is difficult to accomplish if the advertising responsible in that firm do not understand appropriately: the market nature; the product nature; the distribution channels nature; the communication channels nature – available advertising supports and their features

  2. New computer security campaign

    CERN Multimedia

    Alizée Dauvergne

    2010-01-01

    A new campaign is taking shape to promote computer security. The slogan “SEC_RITY is not complete without U!” reminds users of the importance of their contribution. The campaign kicks off on 10 June with a public awareness day in the Council Chamber.   The new campaign, organised by CERN’s computer security team, will focus on prevention and involving the user. “This is an education and awareness-raising campaign for all users at CERN,” explains Stefan Lueders, in charge of computer security. “Every day, we register thousands of computer attacks against CERN: there are attempts to tamper with web pages, hack into user accounts, take over servers, and much more. A successful attack could mean confidential user information being divulged, services being interrupted or data being lost. It could even affect operations at CERN. Another factor is the damage that a successful attack could inflict on the Organization’s reputation. &...

  3. The EXILL campaign

    Indian Academy of Sciences (India)

    G de France et al produced from spontaneous fission sources or other production means to perform their prompt spectroscopy. In this paper we shall describe the EXILL campaign which took place recently at the research reactor of the Institut Laue Langevin (ILL), Grenoble, to perform such studies. The set-up was also used ...

  4. Campaign Finance: Reporter Guide

    Science.gov (United States)

    Wieder, Ben

    2014-01-01

    Campaign finance might seem like the exclusive province of political reporters, but there are many good reasons why authors should be paying attention--both in races for education positions and in other key races at the local, state, and federal levels with implications for education. Basic math is a necessary skill and familiarity with a…

  5. Twitter and political campaigning

    NARCIS (Netherlands)

    Vergeer, M.R.M.

    2015-01-01

    The use of Twitter by politicians, parties, and the general audience in politics, particularly during election campaigns, has become an extremely popular research field almost overnight. Even though Twitter, a medium that emerged early in 2006 – the first tweet was posted on 21 March 2006 by Jack

  6. Campaign Country Going Green?

    DEFF Research Database (Denmark)

    Poulsen, Bo

    2017-01-01

    justification. This paper finally discusses the reason for this greening of government initiated Danish energy saving campaigns, which is seen as an indirect result of the 1987 UN report, Our Common Future. The 1988 general election in Denmark led to the formation of a new center-right government coalition...

  7. The Eurosprite 2005 campaign

    DEFF Research Database (Denmark)

    Arnone, Enrico; Berg, Peter; Boberg, Fredrik

    2008-01-01

    and southwestern Germany. Low-light video cameras are used to register the events. Simultaneously, meteorological observations and continuous recordings of electromagnetic emissions in the VLF-ELF-ULF range and of infrasound are carried out. During the Eurosprite 2005 campaign, two camera systems were operated...

  8. BLOOD DONORS CAMPAIGN

    CERN Multimedia

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion Sanguine of Geneva will be held at CERN on Tuesday 13 March 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  9. BLOOD DONORS CAMPAIGN

    CERN Multimedia

    2001-01-01

    A blood donors campaign, organized by the Centre de Transfusion d'Annemasse will be held at CERN on Tuesday 14 November 2001 in restaurant nr 2, from 9.00 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  10. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2002-01-01

    Tuesday 19 March 2002 in restaurant nr 2, from 9.00 to 16.30 hrs A blood donors campaign, organized by the Centre de Transfusion sanguine of Geneva If you already have a card giving your blood group, please bring this with you.

  11. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2002-01-01

    Wednesday 13 November 2002 in restaurant nr 2, from 8.30 to 16.30 hrs will be held a blood donors campaign, organized by the Etablissement de Transfusion de Haute-Savoie If you already have a card giving your blood group, please bring this with you.

  12. BLOOD DONORS CAMPAIGN

    CERN Document Server

    2000-01-01

    A blood donors campaign, organized by the Établissement de Transfusion de Rhône-Alpes will be held at CERN on Tuesday 14 November 2000 in restaurant nr 2, from 8.30 to 16.30 hrs If you already have a card giving your blood group, please bring this with you.

  13. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system.

  14. Interference of chlorofluorocarbon (CFC)-containing inhalers with measurements of volatile compounds using selected ion flow tube mass spectrometry.

    Science.gov (United States)

    Epton, Michael J; Ledingham, Katherine; Dummer, Jack; Hu, Wan-Ping; Rhodes, Bronwen; Senthilmohan, Senti T; Scotter, Jennifer M; Allardyce, Randall; Cook, Julie; Swanney, Maureen P

    2009-02-01

    Selected ion flow tube mass spectrometry (SIFT-MS) is a sensitive technique capable of measuring volatile compounds (VCs) in complex gas mixtures in real time; it is now being applied to breath analysis. We investigated the effect of inhalers containing chlorofluorocarbons (CFCs) on the detection and measurement of haloamines in human breath. SIFT-MS mass scans (MS) and selected ion monitoring (SIM) scans were performed on three healthy non-smoking volunteers before and after inhalation of the following medications: Combiventtrade mark metered-dose inhaler (MDI) (CFC-containing); Ventolintrade mark MDI (CFC-free); Atroventtrade mark MDI (CFC-free), Beclazonetrade mark MDI (CFC-containing); Duolintrade mark nebuliser. In addition, the duration of the persistence of the mass/charge ratios was measured for 20 h. Inhalers containing CFCs generated large peaks at m/z 85, 87, 101, 103 and 105 in vitro and in vivo, consistent with the predicted product ions of CFCs 12, 114 and 11. No such peaks were seen with Duolintrade mark via nebuliser, or CFC-free MDIs. We conclude that measurement of VCs, such as haloamines, with product ions of similar m/z values to the ions found for CFCs would be significantly affected by the presence of CFCs in inhalers. This issue needs to be accounted for prior to the measurement of VCs in breath in people using inhalers containing CFCs. Copyright 2009 John Wiley & Sons, Ltd.

  15. Long-term validation of ESA operational retrieval (version 6.0) of MIPAS Envisat vertical profiles of methane, nitrous oxide, CFC11, and CFC12 using balloon-borne observations and trajectory matching

    Science.gov (United States)

    Engel, Andreas; Bönisch, Harald; Schwarzenberger, Tim; Haase, Hans-Peter; Grunow, Katja; Abalichin, Jana; Sala, Stephan

    2016-03-01

    MIPAS-Envisat is a satellite-borne sensor which measured vertical profiles of a wide range of trace gases from 2002 to 2012 using IR emission spectroscopy. We present geophysical validation of the MIPAS-Envisat operational retrieval (version 6.0) of N2O, CH4, CFC-12, and CFC-11 by the European Space Agency (ESA). The geophysical validation data are derived from measurements of samples collected by a cryogenic whole air sampler flown to altitudes of up to 34 km by means of large scientific balloons. In order to increase the number of coincidences between the satellite and the balloon observations, we applied a trajectory matching technique. The results are presented for different time periods due to a change in the spectroscopic resolution of MIPAS in early 2005. Retrieval results for N2O, CH4, and CFC-12 show partly good agreement for some altitude regions, which differs for the periods with different spectroscopic resolution. The more recent low spectroscopic resolution data above 20 km altitude show agreement with the combined uncertainties, while there is a tendency of the earlier high spectral resolution data set to underestimate these species above 25 km. The earlier high spectral resolution data show a significant overestimation of the mixing ratios for N2O, CH4, and CFC-12 below 20 km. These differences need to be considered when using these data. The CFC-11 results from the operation retrieval version 6.0 cannot be recommended for scientific studies due to a systematic overestimation of the CFC-11 mixing ratios at all altitudes.

  16. Campaign for Tobacco Free Kids

    Science.gov (United States)

    ... Convenience Stores Not Your Grandfather's Cigar Global Marlboro Campaign YOUTH INITIATIVES Kick Butts Day Taking Down Tobacco ... Advocacy Incubator draws on lessons from tobacco control campaigns in over 50 countries to provide training and ...

  17. GRIP CAMPAIGN REPORTS V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GRIP Campaign Reports dataset consists of various reports filed by scientists during the GRIP campaign which took place 8/15/2010 - 9/30/2010; however, several...

  18. GRIP CAMPAIGN REPORTS V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GRIP Campaign Reports dataset consists of various reports filed by the scientists during the GRIP campaign which took place 8/15/2010 - 9/30/2010; however...

  19. Inoculation in Political Campaign Communication.

    Science.gov (United States)

    Pfau, Michael; Burgoon, Michael

    1988-01-01

    Posits a strategy of resistance to the influence of attack messages in political campaigns. Finds that political campaign messages can be designed to inoculate supporters of candidates against subsequent attack messages of opposing candidates. (MS)

  20. Ventilation of the Arctic Ocean: Mean ages and inventories of anthropogenic CO2 and CFC-11

    Science.gov (United States)

    Tanhua, Toste; Jones, E. Peter; Jeansson, Emil; JutterströM, Sara; Smethie, William M.; Wallace, Douglas W. R.; Anderson, Leif G.

    2009-01-01

    The Arctic Ocean constitutes a large body of water that is still relatively poorly surveyed because of logistical difficulties, although the importance of the Arctic Ocean for global circulation and climate is widely recognized. For instance, the concentration and inventory of anthropogenic CO2 (Cant) in the Arctic Ocean are not properly known despite its relatively large volume of well-ventilated waters. In this work, we have synthesized available transient tracer measurements (e.g., CFCs and SF6) made during more than two decades by the authors. The tracer data are used to estimate the ventilation of the Arctic Ocean, to infer deep-water pathways, and to estimate the Arctic Ocean inventory of Cant. For these calculations, we used the transit time distribution (TTD) concept that makes tracer measurements collected over several decades comparable with each other. The bottom water in the Arctic Ocean has CFC values close to the detection limit, with somewhat higher values in the Eurasian Basin. The ventilation time for the intermediate water column is shorter in the Eurasian Basin (˜200 years) than in the Canadian Basin (˜300 years). We calculate the Arctic Ocean Cant inventory range to be 2.5 to 3.3 Pg-C, normalized to 2005, i.e., ˜2% of the global ocean Cant inventory despite being composed of only ˜1% of the global ocean volume. In a similar fashion, we use the TTD field to calculate the Arctic Ocean inventory of CFC-11 to be 26.2 ± 2.6 × 106 moles for year 1994, which is ˜5% of the global ocean CFC-11 inventory.

  1. The articulation of transnational campaigns

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2011-01-01

    The article traces the complex series of relations that are constitutive of transnational campaigning through empirical research, focusing on political campaigning critical of the WTO's General Agreement on Trade-in-Services. Applying the methodology of post-structuralist discourse theory...... to both situate transnational campaigns within the context of other political phenomena - characterised by collective action - whilst highlighting the historically-contingent communicative devices central to the ‘transnational' character of such campaigns....

  2. [Influence of changing from chlorofluorocarbon (CFC)-beclomethasone dipropionate (BDP) to hydrofluoroalkane (HFA)-BDP on pulmonary function in asthmatic children].

    Science.gov (United States)

    Yoshida, Yukinori; Inoue, Toshishige; Nishikido, Tomoki; Kameda, Makoto; Takamatu, Isamu; Doi, Satoru

    2007-12-01

    The discontinuation of chlorofluorocarbon- beclomethasone dipropionate (CFC-BDP) products has made it necessary to switch to hydrofluoroalkane (HFA)-BDP. We studied the influence of the changing from CFC-BDP to HFA-BDP on pulmonary function in asthmatic children. In twenty asthmatic children (mean: 10.5 years of age) who were clinically well-controlled with CFC-BDP for longer than 6 months, CFC-BDP was switched to HFA-BDP, at half the dose of CFC-BDP. We examined the changes in spirometric parameters at 3-6 months after the switch. FEV1.0% ([FEV1.0/FVC]x100) and %V50 ([V50 measured/V50 predicted]x100) were significantly improved (FEV1.0%: pre 81.7+/-4.7-->post 84.1+/-4.1 [ppost74.4+/-11.3 [pCFC-BDP (former 2.8+/-0.9 years, latter 5.2+/-2.4 years [pCFC-BDP. The changing from CFC-BDP to HFA-BDP showed the improvement of lung function in a part of asthmatic children. We should keep in mind that there are some differences of efficacy among the inhaled corticosteroid products. The long-term anti-inflammatory medication should be adjusted to normalize the pulmonary function on the basis of the degree of airway inflammation.

  3. Cranial fasciitis of childhood (CFC): an unusual clinical case of a rare disease.

    Science.gov (United States)

    Zavras, Niki; Poddighe, Dimitri

    2017-09-13

    Cranial fasciitis of childhood (CFC) is a very uncommon tumour of the scalp, which is almost exclusively observed in the first years of life. It is a benign proliferation of fibroblasts, but its rapid growth rate may resemble a malignant disease. This disease may be suspected from clinical and radiological features, but a definitive diagnosis may be achieved only by pathological examination. We report a case whose onset was in late childhood and whose clinical and radiological characteristics were atypical. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  4. Internet Explorers: the online campaign

    NARCIS (Netherlands)

    Wall, M.; Sudulich, M.L.; Gallagher, M.; Marsh, M.

    2011-01-01

    The idea of an ‘internet election’ was initially put forward in 1997. However, there is little evidence to date that online campaigning has supplanted more traditional campaign practices. This is particularly true of Irish campaigns, which are hardware-rich affairs characterised by substantial

  5. The Sprite 2003 Campaign

    DEFF Research Database (Denmark)

    Neubert, T.; Laursen, S.; Rasmussen, I. L.

    2003-01-01

    During the northern hemisphere summer of 2003, from July 18 to September 18, a sprite observation campaign was conducted with measurements from Southern Europe, coordinated with measurements from the magnetically conjugate region in South Africa. The goal of the campaign was to investigate...... the electromagnetic signatures of sprite emissions, their effect on the ionosphere above, and possible effects of the relativistic acceleration process manifested in the magnetically conjugate hemisphere. Measurements in Europe included optical video imaging from a remotely controlled, semi-automatic, camera system...... located at the Observatoire Midi Pyrenee, in the Pyrenee mountains in Southern France, and ELF-HF electromagnetic observations from several locations. The observations in South Africa included kHz time-resolution measurements of optical emissions taken by an array of 6 photometers and VLF electromagnetic...

  6. Safety of Atrovent(®) CFC-free inhaler: respiratory events reported from an observational cohort study in England.

    Science.gov (United States)

    Osborne, Vicki; Layton, Deborah; Fogg, Carole; Tong, Edward; Shakir, Saad A W

    2017-10-09

    The aim of the study was to identify any unexpected clinical events associated with starting the new CFC-free formulation of Atrovent(®) MDI in general practice in England. An active surveillance cohort study was conducted with a focus on selected clinical events, including respiratory symptoms, in past users of Atrovent(®) CFC MDI ('switchers') and Atrovent(®) naïve users. Incidence density rate ratios (with 99% confidence intervals) for events occurring in the first 3 months of exposure (risk period-ID1-3 ) compared to 3 months prior to starting treatment (reference period-IDR ) were calculated. The cohort consisted of 13 211 patients (median age 70 years, 50.1% female; 63.5% prior users of Atrovent(®) CFC MDI ('switchers')). Common respiratory events occurred at higher rates after starting treatment than before for switchers, for example lower respiratory tract infection (LRTI) [ID1 /IDR = 1.45 (99% CI: 1.17, 1.81)] and worsening asthma [ID1 /IDR = 1.58 (99% CI: 1.00, 2.51)]. Of these events only LRTI was significant for Atrovent(®) naïve patients [ID1 /IDR = 1.42 (99% CI: 1.04, 1.95)]. The results of this study suggest effect modification of risk as a result of prior Atrovent(®) CFC MDI use. Overall, Atrovent(®) CFC-free MDI appeared to be reasonably well tolerated in the immediate postmarketing period and the safety profile appeared similar to that of the CFC formulation. © 2017 Royal Pharmaceutical Society.

  7. Safety Campaign Continues

    CERN Multimedia

    2002-01-01

    If you see this poster, stop and read it! This is the third poster produced by TIS Division as part of its information campaign on health and safety in the workplace. It provides statistics on occupational accidents at CERN. You will see that, as in the rest of Europe, falls, slips and trips continue to be the main cause of accident. So, eyes open and take care! For more information : http://safety.cern.ch/

  8. The Movember campaign

    DEFF Research Database (Denmark)

    Thomsen, Frederik B; Mikkelsen, Marta K; Hansen, Rikke B

    2016-01-01

    AIMS: The aims of the present study were to investigate referral patterns and the diagnosis of prostate cancer (PCa) before and after the Movember campaign was initiated in Denmark. METHODS: All men (n=2817) referred to the Department of Urology at Frederiksberg Hospital with suspicion of having....../100.000 in the Movember period (RR 1.25 [95% CI 1.16-1.35]). In contrast to what we anticipated, there was no increase in referral in the months following the campaign. The incidence rates of men diagnosed with PCa and low-risk PCa were similar in the Movember period and the pre-Movember period (PCa: RR 1.08 [0.......97-1.21]; low-risk PCa: RR 1.29 [0.98-1.73]). CONCLUSIONS: After the initiation of the Movember campaign a significant decline in the PSA level at referral and an increase in the number of patients referred under suspicion of PCa was observed; however, only minor differences in referral patterns and PCa...

  9. The Compatibility of Swedish CFC-legislation with article 43 EC : A case study of an Advance Ruling

    OpenAIRE

    Pettersson, Markus

    2006-01-01

    Most states within the EU have some kind of CFC-legislation that allows the state in question to tax its residents for gains accrued within foreign companies that they control. CFC-legislations are usually said to counteract tax avoidance and they generally target only income of companies in low tax regimes. Such tax regimes are however not only found in pure tax havens. Some of the member states of the EU have set up preferential tax regimes, often limited to foreign financial offshore activ...

  10. Strategic campaigns and redistributive politics

    DEFF Research Database (Denmark)

    Schultz, Christian

    2007-01-01

    The article investigates strategic, informative campaigning by two parties when politics concern redistribution. Voters are uncertain about whether parties favour special groups. Parties will target campaigns on groups where most votes are gained by informing about policies. In equilibrium......, campaigning will be most intensive in groups where the uncertainty is largest and where voters are most mobile, most likely to vote, most receptive to campaigns and relatively uninformed initially. These groups will become more informed about policy. Parties will therefore gain more votes by treating...... these groups well so these groups will gain from strategic campaigning. Welfare effects are assessed...

  11. VELETA 2002 Field Campaign.

    Science.gov (United States)

    Alados-Arboledas, L.; Veleta2002 Team

    2003-04-01

    Depletion of the Earth's ozone layer is considered responsible of an increase in the solar ultraviolet irradiance incoming at surface level (WMO, 1998). For this reason, it is important to know the amount of ultraviolet radiation received by plants and animal organisms to evaluate the potential impact of increased UV radiation on biological systems. During recent years several studies has investigated the differences in UV radiation between places located at different altitude. Depending on the choice of the experimental area altitudinal gradients in erythemal UV have been reported ranging from 0.08 to 0.40 at different regions. Rather high altitudinal gradients were obtained when the studies have been undertaken at sites with important tropospheric pollution or when snow cover was present in the high-level sites. In this sense, it seems of interest to study these altitudinal gradients including comprehensive observations of the environmental conditions relevant to the incoming UV irradiance in order to separate the different contributions to this altitudinal effect. This paper presents the field campaign VELETA2002 (eValuation of the Effects of eLevation and aErosols on the ultravioleT rAdiation), developed during the month of July 2002 in the area of Sierra Nevada (Spain). This field campaign was designed to obtain experimental data on elevation and atmospheric aerosol effects on the solar ultraviolet irradiance. For this purpose a set of radiometers and spectroradiometers has been installed at both slopes of Sierra Nevada Massif, from coastal to inland locations. The field stations include Motril, a coastal location at sea level, Pitres (1200 m a.s.l.) located in the South slope of Sierra Nevada Massif, the Veleta Peak (3398 m a.s.l.), Las Sabinas (2200 m a.s.l.) located on the north slope of the mountain range and Armilla (680 m a.s.l.) located in the valley. The principal feature of the locations is that they provide a strong altitudinal gradient considering

  12. How campaigns polarize the electorate

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2015-01-01

    The minimal effect theory of campaign studies stipulates that intense political competition during campaigns assures and reinforces the initial party choice of the electorate. We find that this reinforcement is two-fold. During the campaign, the party preference of the voters’ in-group party...... increases while the party preference of the voters’ out-group parties decreases. Voters’ preference for their most preferred party (MPP) increases during the election campaign, while their preference for their least liked party decreases during the campaign (LPP). Across parties voters experience...... an increase in their preference for their most preferred party and a decrease for their least liked party as the campaign progresses. These trends show that the political campaign polarizes the electorate by increasing the affective distance between in-group party and out-group party preferences, thereby...

  13. Campaigning and Contestation

    DEFF Research Database (Denmark)

    Schwartz, Sander Andreas

    2015-01-01

    This article is a critical study of the Facebook pages of politicians as public spheres using Dahlberg’s notion of contestation. A method is implemented inspired by qualitative content analysis and including focus groups in order to study citizen comments on eight main political candidates......’ Facebook pages during the 2011 Danish election campaign. An analytical framework is presented that conceptualizes the particular platform as a dinner party, with a dinner table, a host, and the invited guests. The dinner party exhibits the interplay between these elements and how they limit the option...

  14. Immunization campaigns in the UK.

    Science.gov (United States)

    Noakes, K; Salisbury, D

    2006-01-01

    A mass immunization campaign is a rapid vaccination intervention across age groups as opposed to provision through routine vaccination at a specified age attainment. Some countries use campaigns routinely as they have experience that shows that in their health systems higher coverage can be reached through campaigns than by routine service provision. Whilst many industrialized and non-industrialized countries have introduced new vaccines into their routine programme, the UK is unusual in deliberately doing this via campaigns. A number of mass immunization campaigns have been implemented in the UK, either integrated into the routine immunization programme such as the annual influenza immunization campaign; as a catch-up campaign alongside the introduction of a new vaccine into the routine vaccination schedule (MMR, Haemophilus influenzae b, Meningococcal C conjugate vaccine); or as a one-off campaign, to boost immunity in a particular age group, without introducing the vaccination into the schedule routinely at that age (Haemophilus influenzae b). Campaigns require intense planning at national and local level with leadership to achieve proper management. Although the components of an immunization campaign can be described separately--strategic planning, vaccine supply, communication and surveillance; for a programme to be successful integrated planning is essential.

  15. Effects of HFA- and CFC-beclomethasone dipropionate on the bronchial response to methacholine (MCh) in mild asthma.

    Science.gov (United States)

    Micheletto, Claudio; Guerriero, Massimo; Tognella, Silvia; Dal Negro, Roberto W

    2005-07-01

    Metered inhalers using chlorofluorocarbon (CFC) propellents have been gradually replaced by new devices that use hydrofluoroalkanes (HFAs) as their propellents, which are less harmful to the environment. This reformulation led to a substantial improvement of the previous technologies applied to inhalation devices and of the physical characteristics of drugs delivered. In particular, inhaled corticosteroids, such as beclomethasone dipropionate (BDP) which is of fundamental importance in the long-term management of bronchial asthma, took advantage of this reformulation. Unlike the preparation beclomethasone dipropionate and chlorofluorocarbon (BDP-CFC) which was a suspension, that of beclomethasone dipropionate and a hydrofluoroalkane (BDP-HFA) is a solution and produces an aerosol with a mean aerodynamic particle size of 1.1 microm, which is much smaller than the particle size of 3.5-4.0 microm, obtained with the BDP-CFC. The particles of BDP-HFA can then deposit in the lungs in a larger amount, and particularly in the more peripheral airways where the inflammatory process starts in the case of bronchial asthma. A 12-week use of BDP-HFA ensured a significant better control of the bronchial response to methacholine (MCh) than the corresponding use of BDP-CFC for the same duration. The therapeutic performance of BDP-HFA proved much higher and allowed the substantial reduction of the therapeutic daily dose for the clinical asthma management, being the increased and more peripheral deposition of BDP-HFA is presumed to play a crucial role.

  16. CFC (Comment-First-Coding)--A Simple yet Effective Method for Teaching Programming to Information Systems Students

    Science.gov (United States)

    Sengupta, Arijit

    2009-01-01

    Programming courses have always been a difficult part of an Information Systems curriculum. While we do not train Information Systems students to be developers, understanding how to build a system always gives students an added perspective to improve their system design and analysis skills. This teaching tip presents CFC (Comment-First-Coding)--a…

  17. Cyber-campaigning in Denmark

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller; Kosiara-Pedersen, Karina

    2014-01-01

    We set out to analyze the application and effect of cyber-campaigning among candidates at the 2011 Danish general election campaign in order to provide hard evidence on whether new technologies are electorally decisive, or whether traditional off-line campaigning still makes sense. First, both web...... sites and Facebook sites are popular among candidates but other features such as blogs, feeds, newsletter, video uploads, SMS and twitter are used by less than half the candidates. Second, only age and possibly education seem to matter when explaining the uptake of cyber-campaigning. The prominent...... candidates are not significantly more likely to use cyber-campaigning tools and activities. Third, the analysis of the effect of cyber-campaigning shows that the online score has an effect on the inter-party competition for personal votes, but it does not have a significant effect when controlling for other...

  18. The Effect of Political Campaigns

    DEFF Research Database (Denmark)

    Hansen, Kasper Møller

    Abstract There are many somewhat competing models for measuring political campaign effects. This paper discusses six types of campaign effects. 1) The civic engagement effect that argues people will learn and become more political engaged due to the campaign. 2) The priming studies argue...... that campaigns affect what issues the voters evaluate the parties and leaders on and sequentially their vote. 3) The minimal effect models argue that campaigns only mobilize existing prepositions and voters only seek to confirm their intermediated vote choice. 4) The memory based models argue that the vote...... between the theoretical considerations and empirical data. Finally, the paper presents how these models are operationalized in the questionnaires and experiments of the project Online Panel of Electoral Campaigning (OPEC). The paper is part of a five years research project, OPEC, which is set out...

  19. The Sprite 2005 Observation Campaign

    DEFF Research Database (Denmark)

    Chanrion, Olivier Arnaud; Crosby, Norma; Armone, Enrico

    2007-01-01

    and outreach programmes for the young scientists hired. Educational activities were based on the following elements: national PhD programmes, activities at CAL and other meetings, a dedicated summer school, and two European sprite observational campaigns. The young scientists were strongly involved...... in the latter and, as an example, the "EuroSprite2005" observational campaign is presented in detail. Some of the young scientists participated in the instrument set-up, others in the campaign logistics, some coordinated the observations, and others gathered the results to build a catalogue. During the four......-month duration of this campaign, all of them took turns in operating the system and making their own night observations. The ongoing campaign activities were constantly advertised and communicated via an Internet blog. In summary the campaign required all the CAL young scientists to embark on experimental work...

  20. Ventilation time and anthropogenic CO2 in the South China Sea based on CFC-11 measurements

    Science.gov (United States)

    Huang, Peng; Zhang, Miming; Cai, Minggang; Ke, Hongwei; Deng, Hengxiang; Li, Wenquan

    2016-10-01

    The South China Sea (SCS) is the largest semi-enclosed marginal sea in Southeast Asia, and is bounded by the Asian continent, Philippine Archipelago, and Great Sunda Islands. Due to the wide shelves on its northwestern and southern ends as well as the presence of numerous islets, atolls and reefs, the average depth of the SCS is only 1350 m. In this study we used measurements of the transient tracer CFC-11 from the SCS to calculate ventilation time-scales and the concentration of anthropogenic CO2 (Cant) based on the transit time distribution. The CFC-11 concentrations decreased consistently with depth and the deep and bottom water in the SCS had a CFC-11 value close to the detection limit (0.01 pmol kg-1 or 0.5 ppt). The ventilation times (mean ages) for the deep and bottom water column were 500-600 years, and based on the mean age profiles the southern part of the intermediate SCS water was older than the northern part. The ventilation time distribution was in agreement with the existence of mean annual cyclonic circulation in the SCS. The mean column inventory of Cant in the northern SCS was 28.9 mol C m-2 (error range (ER): 22.8-35.6 mol C m-2), while in the southern SCS it was 28.4 mol m-2 (ER: 21.9-35.2 molCm-2). The total Cant inventory was estimated to be 1 Pg C (ER: 0.8-1.3 Pg C, referenced to the year 2011), suggesting that the SCS stores less Cant then the adjacent seas. The vertical diffusivity was estimated to be 2-4.6×10-4 m2 s-1 in the SCS based on the "transient steady state". The upwelling was estimated as 13-34 myr-1. The high diffusivity was probably due to the strong internal tide, while the strong upwelling was due to the persistent counterclockwise (cyclonic) circulation.

  1. Assessing the applicability of global CFC and SF(6) input functions to groundwater dating in the UK.

    Science.gov (United States)

    Darling, W G; Gooddy, D C

    2007-11-15

    Chlorofluorocarbons (CFCs) and sulphur hexafluoride (SF(6)) are increasingly being used to date recent groundwater components. While these trace gases are generally well-mixed in the atmosphere, there is evidence that local atmospheric excesses (LAEs) exist in some areas of the world, primarily associated with urbanisation and thereby affecting the interpretation of data derived from groundwater studies. Since the soil acts as a low-pass filter for atmospheric trace gas fluctuations, the possible existence of LAEs in the UK has been investigated by measuring the mixing ratios of CFC-11, CFC-12 and SF(6) in soil gases from sites within the UK's two largest cities (London and Birmingham) and a smaller urban area, Bristol. While there was some evidence of excesses, most of the measured mixing ratios for CFC-12 and SF(6) were less than 10% above the current northern hemisphere atmospheric mixing ratio (NH-AMR) values. CFC-11 was more variable, but usually less than 20% above the NH-AMR value. Surface waters were also investigated as possible short-term archives of trace-gas information but were much less consistent in performance. While the lack of significant current LAEs for SF(6) can justifiably be extrapolated to past decades, different global emission patterns mean that this is much harder to justify for the CFCs. Nevertheless, in the absence of further evidence it is concluded that the use of CFC and SF(6) input functions based on the NH-AMR curves is generally justified for the UK, with the proviso that urban groundwater investigations should not rely on the CFCs as age tracers.

  2. Conflict Termination in Counterterrorist Campaigns

    National Research Council Canada - National Science Library

    Garrison, Brian

    2004-01-01

    .... In the Global War on Terror, this challenge is exacerbated as operational planners must design counterterrorist campaigns that simultaneously consider the elusive nature of transnational terrorist...

  3. X-ray micro-laminography for the ex situ analysis of W-CFC samples retrieved from JET ITER-like wall

    Science.gov (United States)

    Tiseanu, I.; Craciunescu, T.; Lungu, M.; Dobrea, C.; Contributors, JET

    2016-02-01

    x-ray micro-laminography was qualified and implemented as a complementary solution for the 3D microstructural analysis of tungsten coated carbon-fibre reinforced carbon (W/CFC) samples retrieved from JET ITER-like wall. As expected, the W layers spatially correlate with the morphology of the CFC substrate. Three main cases were distinguished; (i) tungsten layers coated parallel to PAN fibre bundles tend to have a quasi-continuous, weakly waved surface (waves amplitude CFC substrate. These W particles, sized of 20-40 μm, are always found in the large gaps located between the fibre bundles perpendicular to the coated surface.

  4. Surviving Sepsis Campaign

    DEFF Research Database (Denmark)

    Rhodes, Andrew; Evans, Laura E; Alhazzani, Waleed

    2017-01-01

    OBJECTIVE: To provide an update to "Surviving Sepsis Campaign Guidelines for Management of Sepsis and Septic Shock: 2012". DESIGN: A consensus committee of 55 international experts representing 25 international organizations was convened. Nominal groups were assembled at key international meetings......, and to formulate recommendations as strong or weak, or best practice statement when applicable. RESULTS: The Surviving Sepsis Guideline panel provided 93 statements on early management and resuscitation of patients with sepsis or septic shock. Overall, 32 were strong recommendations, 39 were weak recommendations...... of care have relatively weak support, evidence-based recommendations regarding the acute management of sepsis and septic shock are the foundation of improved outcomes for these critically ill patients with high mortality....

  5. Surviving Sepsis Campaign

    DEFF Research Database (Denmark)

    Rhodes, Andrew; Evans, Laura E; Alhazzani, Waleed

    2017-01-01

    OBJECTIVE: To provide an update to "Surviving Sepsis Campaign Guidelines for Management of Sepsis and Septic Shock: 2012." DESIGN: A consensus committee of 55 international experts representing 25 international organizations was convened. Nominal groups were assembled at key international meetings......, and to formulate recommendations as strong or weak, or best practice statement when applicable. RESULTS: The Surviving Sepsis Guideline panel provided 93 statements on early management and resuscitation of patients with sepsis or septic shock. Overall, 32 were strong recommendations, 39 were weak recommendations...... of care have relatively weak support, evidence-based recommendations regarding the acute management of sepsis and septic shock are the foundation of improved outcomes for these critically ill patients with high mortality....

  6. The Ocean Literacy Campaign

    Science.gov (United States)

    Schoedinger, S. E.; Strang, C.

    2008-12-01

    "Ocean Literacy is an understanding of the ocean's influence on you and your influence on the ocean." This simple statement captures the spirit of a conceptual framework supporting ocean literacy (COSEE et al., 2005). The framework comprises 7 essential principles and 44 fundamental concepts an ocean literate person would know (COSEE et al., 2005). The framework is the result of an extensive grassroots effort to reach consensus on (1) a definition for ocean literacy and (2) an articulation of the most important concepts to be understood by ocean-literate citizen (Cava et al., 2005). In the process of reaching consensus on these "big ideas" about the ocean, what began as a series of workshops has emerged as a campaign "owned" by an ever-expanding community of individuals, organizations and networks involved in developing and promoting the framework. The Ocean Literacy Framework has provided a common language for scientists and educators working together and serves as key guidance for the ocean science education efforts. This presentation will focus on the impact this Ocean Literacy Campaign has had to date as well as efforts underway to provide additional tools to enable educators and educational policy makers to further integrate teaching and learning about the ocean and our coasts into formal K-12 education and informal education. COSEE, National Geographic Society, NOAA, College of Exploration (2005). Ocean Literacy: The Essential Principles of Ocean Sciences Grades K-12, a jointly published brochure, URL: http://www.coexploration.org/oceanliteracy/documents/OceanLitChart.pdf Cava, F., S. Schoedinger , C. Strang, and P. Tuddenham (2005). Science Content and Standards for Ocean Literacy: A Report on Ocean Literacy, URL: http://www.coexploration.org/oceanliteracy/documents/OLit2004-05_Final_Report.pdf.

  7. polio supplementary immunization campaign evaluation

    African Journals Online (AJOL)

    2013-08-20

    Aug 20, 2013 ... is the process of sharing information with the community about polio eradication activities, the polio immunization campaign and why it is important [5.]. In this evaluation, more than three-fourth of the families knew the campaign before the vaccination team visited their houses. Meaning that, majority of the ...

  8. Complex Contagion of Campaign Donations

    CERN Document Server

    Traag, V A

    2016-01-01

    Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50 000 elites and examine how connectivity among previous donors reinforces contagion. We find the diffusion of donations to be driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the via...

  9. Solar Energy Campaign. 2008 Norwegian student-based web campaign

    Energy Technology Data Exchange (ETDEWEB)

    Randall, Scott

    2009-07-01

    Student research campaigns (forskningskampanjer) have been an annual event in connection to Research Days (Forskningsdagene) since 2003 in Norway. The campaigns invite students from all over the country to participate in a common scientific research event, always connected to a special environmentally related theme - for example Air Quality in the Classroom (2003), Pollution along Roads (2004), Bacteria in Drinking Water (2005), and The Rain Check (2006). The year 2008, as with previous years, was overshadowed by the topic of climate change, and the specific role of humans. The research campaign theme for 2008 fit well into this focus: the potential benefits of solar energy as an alternative energy source. The campaign also was aligned with the Research Days theme of alternative energy sources and technologies. The campaign included the hands-on activity of assembling a solar panel and taking measurements with the device to determine efficiency, as well as a questionnaire to record the results and ask deeper questions regarding alternative energy and climate change. The results gained from data analysis of the campaign show that students were able to gain maximum efficient solar power from the devices they constructed, which gave them a solid understanding of solar power technology. Analysis of the campaign questionnaire in regards to the activity shows that students believe that solar energy should be better utilized as an energy source in Norway. (Also in Norwegian OR 24/2009). (Author)

  10. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) 1deg Lat Zonal Fourier Coefficients V007 (H3ZFCCFC11) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  11. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) 1deg Lat Zonal Fourier Coefficients V007 (H3ZFCCFC11) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  12. Cardio-facio-cutaneous syndrome phenotype in an individual with an interstitial deletion of 12q: identification of a candidate region for CFC syndrome.

    Science.gov (United States)

    Rauen, K A; Cotter, P D; Bitts, S M; Cox, V A; Golabi, M

    2000-07-31

    We report on a 19-month-old girl who presented with the phenotype of cardio-faciocutaneous (CFC) syndrome including characteristic minor facial anomalies, cardiac defect, ectodermal anomalies, and developmental delay. Cytogenetic analysis showed the presence of an interstitial deletion of one chromosome 12, del(12)(q21.2q22), confirmed by fluorescence in situ hybridization with chromosome band specific probes. Controversy exists as to whether CFC and Noonan syndrome (NS) are distinct disorders, a contiguous gene syndrome, or allelic variants. The identification of the del(12) in this patient, in a region distinct from the putative NS locus, supports the view that CFC is a genetically distinct condition from NS. In addition, this implicates the region 12q21.2-->4q22 as a candidate region for the gene(s) causing CFC syndrome.

  13. The DIAMET campaign

    Science.gov (United States)

    Vaughan, G.

    2012-04-01

    DIAMET (DIAbatic influences on Mesoscale structures in ExTratropical storms) is a joint project between the UK academic community and the Met Office. Its focus is on understanding and predicting mesoscale structures in synoptic-scale storms, and in particular on the role of diabatic processes in generating and maintaining them. Such structures include fronts, rain bands, secondary cyclones, sting jets etc, and are important because much of the extreme weather we experience (e.g. strong winds, heavy rain) comes from such regions. The project conducted two field campaigns in the autumn of 2011, from September 14 - 30 and November 24 - December 14, based around the FAAM BAe146 aircraft with support from ground-based radar and radiosonde measurements. Detailed modelling, mainly using the Met Office Unified model, supported the planning and interpretation of these campaigns. This presentation will give a brief overview of the campaigns. Both in September and November-December the weather regime was westerly, with a strong jet stream directed across the Atlantic. Three IOPs were conducted in September, to observe a convective band ahead of an upper-level trough, waves on a long trailing cold front, and a warm conveyor belt associated with a secondary cyclone. In November-December six IOPs were conducted, to observe frontal passages and high winds. This period was notable for a number of very strong windstorms passing across the north of the UK, and gave us an opportunity to examine bent-back warm fronts in the southern quadrant of these storms where the strongest winds are found. The case studies fell into two basic patterns. In the majority of cases, dropsonde legs at high level were used to obtain a cross-section of winds and thermodynamic structure (e.g. across a front), followed by in situ legs at lower levels (generally where the temperature was between 0 and -10°) to examine microphysical processes, especially ice multiplication and the extent of supercooled water

  14. Interleukin-6 (IL-6) and low O(2) concentration (1%) synergize to improve the maintenance of hematopoietic stem cells (pre-CFC).

    Science.gov (United States)

    Kovacević-Filipović, Milica; Petakov, Marijana; Hermitte, Francis; Debeissat, Christelle; Krstić, Aleksandra; Jovcić, Gordana; Bugarski, Dijana; Lafarge, Xavier; Milenković, Pavle; Praloran, Vincent; Ivanović, Zoran

    2007-07-01

    Low O(2) concentration (1%) favors the self-renewal of hematopoietic stem cells and inhibits committed progenitors (CFC). Since IL-6 influences both stem cells and committed progenitors at 20% O(2), we studied its effects in cultures at 1% O(2). The pre-CFC activity in Lin- population of mouse bone marrow was analyzed following 10 days of serum-free culture in medium (LC1) supplemented with IL-3 with and without IL-6, at 20 and 1% O(2) and phenotypic differentiation and proliferative history monitored. The IL-6 receptor expression and initiation of VEGF-A synthesis were also investigated. At 20% O(2), the effects of IL-6 on pre-CFC were negligible but effects on CFC were apparent; conversely, at 1% O(2), the IL-6 enhances activity of pre-CFC but not of CFC. Unlike at 20% O(2), at 1% O(2) a subpopulation of cells remained Lin- in spite of extensive proliferation. However, the absolute number of Lin- cells, did not correlate with pre-CFC activity. A relative increase in VEGF transcripts at 1% O(2) in presence of IL-3 alone was enhanced by the addition of IL-6. IL-6 enhanced pre-CFC activity at 1% O(2) and this was correlated to the induction of VEGF. These data reinforce the concept that physiologically low oxygenation of bone marrow is a regulator of stem cell maintenance. Since the 20% O(2) does not exist in tissues in vivo, further studies in vitro at lower O(2) concentrations should revise our knowledge relating to cytokine effects on stem and progenitor cells.

  15. Modelling of steady state erosion of CFC actively water-cooled mock-up for the ITER divertor

    Science.gov (United States)

    Ogorodnikova, O. V.

    2008-04-01

    Calculations of the physical and chemical erosion of CFC (carbon fibre composite) monoblocks as outer vertical target of the ITER divertor during normal operation regimes have been done. Off-normal events and ELM's are not considered here. For a set of components under thermal and particles loads at glancing incident angle, variations in the material properties and/or assembly of defects could result in different erosion of actively-cooled components and, thus, in temperature instabilities. Operation regimes where the temperature instability takes place are investigated. It is shown that the temperature and erosion instabilities, probably, are not a critical point for the present design of ITER vertical target if a realistic variation of material properties is assumed, namely, the difference in the thermal conductivities of the neighbouring monoblocks is 20% and the maximum allowable size of a defect between CFC armour and cooling tube is +/-90° in circumferential direction from the apex.

  16. CFCI3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime and Uncertainty

    Science.gov (United States)

    Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2014-01-01

    CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations

  17. Assessment of the Potential of CFC (Calcium hydroxide Flagyl Ciprofloxacin) for the Rapid Disinfection of Resilon and Gutta-Percha.

    Science.gov (United States)

    Hamza, Mariam Omer Bin; Gufran, Khalid; Baroudi, Kusai

    2015-10-01

    Obturating materials exposed to the dental operating environment has been shown to be contaminated, making rapid chair side disinfection mandatory to ensure the sterility of the root canals. The purpose of this study was to investigate the effectiveness of CFC (combination of Calcium hydroxide, Flagyl and Ciprofloxacin) for the rapid disinfection of Gutta-percha and Resilon cones. Seventy new Gutta-percha and Resilon cones were randomly selected, contaminated with Enterococcus faecalis and divided into 4 group according to the irrigant used for disinfection {Group I: 5.25% Sodium Hypochlorite (NaOCl), Group II: MTAD, Group III: 2% Chlorhexidine (CHX), Group IV: CFC (a combination of Calcium hydroxide, Flagyl and Ciprofloxacin)}. All the samples were placed in a centrifuge tube with BHI broth after being washed with sterile water. The samples were then incubated for 7 days at 37(o)C. Samples were randomly plated on Mac Conkey agar plate and the colony count was recorded and the observations were drawn. A 5.25% NaOCl required 1 minute exposure for effective disinfection of all the samples. MTAD could eliminate E.faecalis from gutta-percha samples in 30 seconds whereas it required 1 minute of exposure for Resilon cones. Both 2% CHX and CFC could not disinfect the samples with 1 minute exposure and a minimum of 5 minute exposure was required. A 5.25% NaOCl and Biopure MTAD required less chair side time to disinfect all the samples effectively when compared with 2% CHX and CFC.

  18. Awareness of the ozone layer and acceptance of a new CFC-free metered dose inhaler among asthmatic patients.

    Science.gov (United States)

    Liam, C K; Lim, K H

    1998-08-01

    University of Malaya Medical Centre, Kuala Lumpur, Malaysia. To assess the awareness of the ozone layer and the acceptance of the new non-chlorofluorocarbon (CFC) propellant hydrofluoroalkane 134a salbutamol pressurised metered dose inhaler (MDI) Airomir among asthmatic patients. A total of 113 consecutive asthmatic patients aged 12 years and above from the out- and in-patient services of the hospital were interviewed using a questionnaire. Sixty-five per cent of the patients were aware of the existence of the ozone layer, 23% that CFCs play a role in ozone depletion, and only 10% that current MDIs contained CFCs. All the patients felt that pressurised MDIs should be made CFC-free after they had considered the role of CFCs in the destruction of the ozone layer. Eighty-one per cent of 94 patients who preferred the Airomir inhaler over a multi-dose dry powder inhaler for administering bronchodilator medications were willing to switch to the new inhaler once it became available on the market. Awareness of the damaging effect of CFCs on the ozone layer among asthmatic patients would encourage them to change to an ozone-friendly, CFC-free pressurised MDI.

  19. About the Collision Repair Campaign

    Science.gov (United States)

    EPA developed the Collision Repair Campaign to focus on meaningful risk reduction in the Collision Repair source sector to complement ongoing community air toxics work and attain reductions at a faster rate.

  20. What influences crowdfunding campaign success.

    OpenAIRE

    Drabløs, Christian

    2015-01-01

    Master thesis Business Administration- University of Agder, 2015 Crowdfunding is a recently emerged market for entrepreneurs; it represents a new and growing source of potential capital. The potential crowdfunding is starting to reach it potential, and has beginning to go mainstream. There is a gap in the research on crowdfunding and within the field of what separates a successful campaign from a failed one. To explore the variables influencing crowdfunding campaign this paper ...

  1. What influences crowdfunding campaign success.

    OpenAIRE

    Drabløs, Christian

    2015-01-01

    Crowdfunding is a recently emerged market for entrepreneurs; it represents a new and growing source of potential capital. The potential crowdfunding is starting to reach it potential, and has beginning to go mainstream. There is a gap in the research on crowdfunding and within the field of what separates a successful campaign from a failed one. To explore the variables influencing crowdfunding campaign this paper looks into academic articles, the crowdfunding platforms, general...

  2. Complex Contagion of Campaign Donations.

    Directory of Open Access Journals (Sweden)

    Vincent A Traag

    Full Text Available Money is central in US politics, and most campaign contributions stem from a tiny, wealthy elite. Like other political acts, campaign donations are known to be socially contagious. We study how campaign donations diffuse through a network of more than 50,000 elites and examine how connectivity among previous donors reinforces contagion. We find that the diffusion of donations is driven by independent reinforcement contagion: people are more likely to donate when exposed to donors from different social groups than when they are exposed to equally many donors from the same group. Counter-intuitively, being exposed to one side may increase donations to the other side. Although the effect is weak, simultaneous cross-cutting exposure makes donation somewhat less likely. Finally, the independence of donors in the beginning of a campaign predicts the amount of money that is raised throughout a campaign. We theorize that people infer population-wide estimates from their local observations, with elites assessing the viability of candidates, possibly opposing candidates in response to local support. Our findings suggest that theories of complex contagions need refinement and that political campaigns should target multiple communities.

  3. High-performance, non-CFC-based thermal insulation: Gas filled panels

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, B.T.; Arasteh, D.; Selkowitz, S.

    1992-04-01

    Because of the forthcoming phase-out of CFCs and to comply with the more stringent building and appliance energy-use standards, researchers in industry and in the public sector are pursuing the development of non-CFC-based, high-performance insulation materials. This report describes the results of research and development of one alternative insulation material: highly insulating GFPs. GFPs insulate in two ways: by using a gas barrier envelope to encapsulate a low-thermal-conductivity gas or gas mixture (at atmospheric pressure), and by using low-emissivity baffles to effectively eliminate convective and radiative heat transfer. This approach has been used successfully to produce superinsulated windows. Unlike foams or fibrous insulations, GFPs are not a homogeneous material but rather an assembly of specialized components. The wide range of potential applications of GFPs (appliances, manufactured housing, site-built buildings, refrigerated transport, and so on) leads to several alternative embodiments. While the materials used for prototype GFPs are commercially available, further development of components may be necessary for commercial products. With the exception of a description of the panels that were independently tested, specific information concerning panel designs and materials is omitted for patent reasons; this material is the subject of a patent application by Lawrence Berkeley Laboratory.

  4. Remplacement des composés fluorocarbonés (CFC) Bilan actuel du projet

    CERN Document Server

    Pirollet, B

    2001-01-01

    Le fonctionnement des différents accélérateurs du CERN nécessite l'utilisation de machines frigorifiques. Ces dernières servent à extraire l'énergie au sein des détecteurs ou des racks électroniques. Un parc de plusieurs dizaines de groupes frigorifiques a été aussi constitué depuis les débuts du CERN. Ces unités utilisent pour la plupart des fluides fluorocarbonés (CFC). L'impact de ces gaz sur l'environnement a été démontré dès 1976. Depuis, divers protocoles visant à réglementer la production et l'usage de tels fluides ont été établis. Afin d'être en conformité avec les diverses législations en vigueur, le CERN a mis en place un projet visant à substituer ces fluides dans toutes les installations. Le but de ce document est de dresser le bilan actuel du projet et d'en présenter les évolutions futures.

  5. Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)

    Science.gov (United States)

    Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian

    2013-01-01

    NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.

  6. Dielectrophoretic isolation and detection of cfc-DNA nanoparticulate biomarkers and virus from blood.

    Science.gov (United States)

    Sonnenberg, Avery; Marciniak, Jennifer Y; McCanna, James; Krishnan, Rajaram; Rassenti, Laura; Kipps, Thomas J; Heller, Michael J

    2013-04-01

    Dielectrophoretic (DEP) microarray devices allow important cellular nanoparticulate biomarkers and virus to be rapidly isolated, concentrated, and detected directly from clinical and biological samples. A variety of submicron nanoparticulate entities including cell free circulating (cfc) DNA, mitochondria, and virus can be isolated into DEP high-field areas on microelectrodes, while blood cells and other micron-size entities become isolated into DEP low-field areas between the microelectrodes. The nanoparticulate entities are held in the DEP high-field areas while cells are washed away along with proteins and other small molecules that are not affected by the DEP electric fields. DEP carried out on 20 μL of whole blood obtained from chronic lymphocytic leukemia patients showed a considerable amount of SYBR Green stained DNA fluorescent material concentrated in the DEP high-field regions. Whole blood obtained from healthy individuals showed little or no fluorescent DNA materials in the DEP high-field regions. Fluorescent T7 bacteriophage virus could be isolated directly from blood samples, and fluorescently stained mitochondria could be isolated from biological buffer samples. Using newer DEP microarray devices, high-molecular-weight DNA could be isolated from serum and detected at levels as low as 8-16 ng/mL. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Tungsten coating by ATC plasma spraying on CFC for WEST tokamak

    Science.gov (United States)

    Firdaouss, M.; Desgranges, C.; Hernandez, C.; Mateus, C.; Maier, H.; Böswirth, B.; Greuner, H.; Samaille, F.; Bucalossi, J.; Missirlian, M.

    2017-12-01

    In the field of fusion experiments using a tokamak, the plasma facing components (PFC) are the closest object to the hot plasma. Due to the plasma-wall interaction, the material composing the PFC may enter the plasma and disturb the experiments. In the past, the main material for PFC was carbon (CFC, graphite), while the future reactors like ITER will be fully metallic, in particular tungsten. The Tore Supra tokamak has been transformed in an x-point divertor fusion device within the frame of the WEST (W (tungsten) Environment in Steady-state Tokamak) project in order to have plasma conditions close to those expected in ITER. The PFC other than the divertor has been coated with W to transform Tore Supra into a fully metallic environment. Different coating techniques have been selected for different kind of PFC. This paper gives an overview on the coating process used for the antennae protection limiter, the associated validation programme and concludes on the adequacy of the W coating with the WEST experimental programme requirements and gives perspectives on the development to be pursued.

  8. Awareness campaigns: experience in Mexico.

    Science.gov (United States)

    Hernández Tepichin, G

    2000-02-18

    The current total of AIDS cases in Mexico is 37,000 of which 86% have occurred in men. The major route of transmission is sexual. The campaign to prevent AIDS has fallen into four phases, and has now been extended to other sexually transmitted diseases, including hepatitis B. The first phase (1985-1989) was based around question and answer brochures, which increased awareness but did not remove misconceptions. A mass media campaign addressed these misconceptions and stressed preventive measures. The campaign was halted by opposition to the promotion of condom use on the grounds that it encouraged promiscuity. The second phase (1989-1992) used more conservative messages, but these were too obscure and failed to reach the target audience. A poster campaign using popular lottery characters was widely accepted. In the third phase (1992-1994), a combination of messages was targeted at different populations, including parents and women, and general public sympathy for social support for people with AIDS was encouraged. In the fourth phase (1996-2000), a mass media campaign was aimed at teenagers, with parents and teachers as support groups. The campaign was widened to include HBV infection, and posters and brochures for teenagers were produced. These are distributed as part of a collaboration with non-governmental organizations providing sex education. The private medical sector is being encouraged to provide facilities for hepatitis B vaccination. So far the campaign has only been established in Mexico City, but it is hoped that this will be extended nationwide. Hepatitis B vaccination has been recently included in the National Immunization Programme for infants in the first year of life and it is officially recommended for at-risk populations.

  9. Atmospheric lifetimes, infrared absorption spectra, radiative forcings and global warming potentials of NF3 and CF3CF2Cl (CFC-115

    Directory of Open Access Journals (Sweden)

    A. Totterdill

    2016-09-01

    Full Text Available Fluorinated compounds such as NF3 and C2F5Cl (CFC-115 are characterised by very large global warming potentials (GWPs, which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry–climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21 years and (492 ± 22 years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.

  10. Clinical comparability between the CFC and HFA budesonide pressurised metered-dose inhalers in paediatric patients with asthma: a randomised controlled trial.

    Science.gov (United States)

    Escribano, A; Tutuncu, A; Löhr, I; Carlholm, M; Polanowski, T

    2006-06-01

    To evaluate the efficacy and tolerability of a novel hydrofluoroalkane (HFA) pressurised metered dose inhaler (pMDI) formulation of budesonide (Pulmicort) versus the conventional chlorofluorocarbon (CFC) pMDI formulation in paediatric patients with asthma. This was a Phase III, multicentre, 12-week, double-blind, randomised, parallel-group study involving children (6-12 years of age) with mild to moderate asthma. Patients received either budesonide HFA pMDI or budesonide CFC pMDI 200 mug twice daily, with or without a spacer (NebuChamber/Nebunette). Primary efficacy endpoint: mean percentage change in forced expiratory volume in 1 second (FEV(1)) from baseline to week 12. Secondary efficacy endpoints included changes in FEV(1) per cent of predicted normal, forced vital capacity, morning and evening peak expiratory flow rate, asthma symptoms and use of rescue medication. A total of 159 patients received treatment (HFA 77, CFC 82). For mean percentage change in FEV(1) from baseline to week 12, the difference between the treatments (CFC pMDI - HFA pMDI) was -3.1% (95% confidence interval [CI] -8.0% to 1.8%) for the full analysis set and was not affected by spacer use. The upper CI was CFC pMDI.

  11. Atmospheric lifetimes, infrared absorption spectra, radiative forcings and global warming potentials of NF3 and CF3CF2Cl (CFC-115)

    Science.gov (United States)

    Totterdill, Anna; Kovács, Tamás; Feng, Wuhu; Dhomse, Sandip; Smith, Christopher J.; Gómez-Martín, Juan Carlos; Chipperfield, Martyn P.; Forster, Piers M.; Plane, John M. C.

    2016-09-01

    Fluorinated compounds such as NF3 and C2F5Cl (CFC-115) are characterised by very large global warming potentials (GWPs), which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry-climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21) years and (492 ± 22) years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.

  12. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools. © 2016 The Authors Journal of Microscopy © 2016 Royal Microscopical Society.

  13. Safety campaigns. TIS Launches New Safety Information Campaign

    CERN Multimedia

    2001-01-01

    Need to start a new installation and worried about safety aspects? Or are you newly responsible for safety matters in a CERN building? Perhaps you're simply interested in how to make the working environment safer for yourself and your colleagues. Whatever the case, a new information campaign launched by TIS this week can help. The most visible aspects of the new campaign will be posters distributed around the Laboratory treating a different subject each month. The Web site - http://safety.cern.ch/ - which provides all safety related information. But these are not the only aspects of the new campaign. Members of the TIS/GS group, whose contact details can be found on the safety web site, are available to give information and advice on a one-to-one basis at any time. The campaign's launch has been timed to coincide with European Safety Week, organized by the European Agency for Safety and Health at Work and the subject treated in the first posters is safety inspection. This particular topic only concerns thos...

  14. 75 FR 43395 - Campaign Travel

    Science.gov (United States)

    2010-07-26

    ...On December 7, 2009, the Commission published in the Federal Register final rules implementing the provision of the Honest Leadership and Open Government Act governing campaign travel on noncommercial aircraft. This document announces the effective date of amendments made by those final rules to Commission regulations pertaining to travel by and on behalf of publicly funded presidential candidates.

  15. Advanced Fuels Campaign 2012 Accomplishments

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2012-11-01

    The Advanced Fuels Campaign (AFC) under the Fuel Cycle Research and Development (FCRD) program is responsible for developing fuels technologies to support the various fuel cycle options defined in the DOE Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. The fiscal year 2012 (FY 2012) accomplishments are highlighted below. Kemal Pasamehmetoglu is the National Technical Director for AFC.

  16. Keep Your Campaign Aim True

    Science.gov (United States)

    Collins, Mary Ellen

    2009-01-01

    Asking constituents to rally around a cause and make stretch gifts when they're already suffering unprecedented hits to their personal finances sounds more like a fool's errand than a best practice in fundraising. The economic crisis has added a tricky new aspect to operating in campaign mode, but savvy fundraisers haven't given up, scaled back,…

  17. Recharge and Topographical Controls on Groundwater Circulation in Shallow Crystalline Rock Aquifers revealed by CFC-based Age Data

    Science.gov (United States)

    Kolbe, T.; Abbott, B. W.; Marçais, J.; Thomas, Z.; Aquilina, L.; Labasque, T.; Pinay, G.; De Dreuzy, J. R.

    2016-12-01

    Groundwater transit time and flow path are key factors controlling nitrogen retention and removal capacity at the catchment scale (Abbott et al., 2016), but the relative importance of hydrogeological and topographical factors in determining these parameters remains uncertain (Kolbe et al., 2016). To address this unknown, we used numerical modelling techniques calibrated with CFC groundwater age data to quantify transit time and flow path in an unconfined aquifer in Brittany, France. We assessed the relative importance of parameters (aquifer depth, porosity, arrangement of geological layers, and permeability profile), hydrology (recharge rate), and topography in determining characteristic flow distances (Leray et al., 2016). We found that groundwater flow was highly local (mean travel distance of 350 m) but also relatively old (mean CFC age of 40 years). Sensitivity analysis revealed that groundwater travel distances were not sensitive to geological parameters within the constraints of the CFC age data. However, circulation was sensitive to topography in lowland areas where the groundwater table was close to the land surface, and to recharge rate in upland areas where water input modulated the free surface of the aquifer. We quantified these differences with a local groundwater ratio (rGW-LOCAL) defined as the mean groundwater travel distance divided by the equivalent surface distance water would have traveled along the land surface. Lowland rGW-LOCAL was near 1, indicating primarily topographic controls. Upland rGW-LOCALwas 1.6, meaning the groundwater recharge area was substantially larger than the topographically-defined catchment. This ratio was applied to other catchments in Brittany to test its relevance in comparing controls on groundwater circulation within and among catchments. REFERENCES Abbott et al., 2016, Using multi-tracer inference to move beyond single-catchment ecohydrology. Earth-Science Reviews. Kolbe et al., 2016, Coupling 3D groundwater modeling

  18. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Technical progress report, 1 April 1995--30 June 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.; Amrane, K.

    1995-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The AirConditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  19. Transferência de tecnologia na lavoura arrozeira gaúcha : uma análise do Projeto CFC

    OpenAIRE

    Paulo Antonio Jung de Moura Jardim

    2005-01-01

    O Projeto CFC é uma iniciativa de transferência de tecnologia em lavouras de arroz irrigado e está sendo executado simultaneamente no Rio Grande do Sul e na Venezuela. Seu principal propósito é o aumento de produtividade, diminuindo a lacuna de rendimento existente entre as lavouras atuais e o potencial produtivo da cultura obtido em áreas experimentais. Para tanto, está se usando um sistema híbrido de transferência de tecnologia de manejo para altas produtividades. Este sistema inclui o trab...

  20. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  1. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  2. Tritium retention measurements by accelerator mass spectrometry and full combustion of W-coated and uncoated CFC tiles from the JET divertor

    Science.gov (United States)

    Stan-Sion, C.; Bekris, N.; Kizane, G.; Enachescu, M.; Likonen, J.; Halitovs, M.; Petre, A.; contributors, JET

    2016-04-01

    Accelerator mass spectrometry (AMS) and the full combustion method (FCM) followed by liquid scintillation counting were applied to quantitatively determine the tritium retention in the tungsten-coated carbon fibre composites (CFC), in comparison to uncoated CFC tiles from the JET divertor. The tiles were adjacent and exposed to plasma operations between 2007 and 2009. The tritium depth profiles are showing that the tritium retention on the W-coated tile was reduced by a factor of 13.5 in comparison to the uncoated tile whereas the bulk tritium concentration is approximately the same for both tiles.

  3. Heart Health: The Heart Truth Campaign 2009

    Science.gov (United States)

    ... Bar Home Current Issue Past Issues Cover Story Heart Health The Heart Truth Campaign 2009 Past Issues / Winter 2009 Table ... one of the celebrities supporting this year's The Heart Truth campaign. Both R&B singer Ashanti (center) ...

  4. News Media Framing of Negative Campaigning

    DEFF Research Database (Denmark)

    Pedersen, Rasmus Tue

    2014-01-01

    News media coverage of election campaigns is often characterized by use of the strategic game frame and a focus on politicians’ use of negative campaigning. However, the exact relationship between these two characteristics of news coverage is largely unexplored. This article theorizes that consumer...... demand and norms of journalistic independence might induce the news media outlets to cover negative campaigning with a strategic game frame. A comprehensive content analysis based on several newspaper types, several election campaigns, and several different measurements of media framing confirms...... that news coverage of negative campaigning does apply the strategic game frame to a significantly larger degree than articles covering positive campaigning. This finding has significant implications for campaigning politicians and for scholars studying campaign and media effects....

  5. Translating CFC-based piston ages into probability density functions of ground-water age in karst

    Science.gov (United States)

    Long, Andrew J.; Putnam, L.D.

    2006-01-01

    Temporal age distributions are equivalent to probability density functions (PDFs) of transit time. The type and shape of a PDF provides important information related to ground-water mixing at the well or spring and the complex nature of flow networks in karst aquifers. Chlorofluorocarbon (CFC) concentrations measured for samples from 12 locations in the karstic Madison aquifer were used to evaluate the suitability of various PDF types for this aquifer. Parameters of PDFs could not be estimated within acceptable confidence intervals for any of the individual sites. Therefore, metrics derived from CFC-based apparent ages were used to evaluate results of PDF modeling in a more general approach. The ranges of these metrics were established as criteria against which families of PDFs could be evaluated for their applicability to different parts of the aquifer. Seven PDF types, including five unimodal and two bimodal models, were evaluated. Model results indicate that unimodal models may be applicable to areas close to conduits that have younger piston (i.e., apparent) ages and that bimodal models probably are applicable to areas farther from conduits that have older piston ages. The two components of a bimodal PDF are interpreted as representing conduit and diffuse flow, and transit times of as much as two decades may separate these PDF components. Areas near conduits may be dominated by conduit flow, whereas areas farther from conduits having bimodal distributions probably have good hydraulic connection to both diffuse and conduit flow. ?? 2006 Elsevier B.V. All rights reserved.

  6. Challenges and opportunities for dietary campaigns

    DEFF Research Database (Denmark)

    Bech-Larsen, Tino; Aschemann-Witzel, Jessica; Verbeke, Wim

    2013-01-01

    The objective of our research was to explore and discuss the challenges and opportunities inherent to the management of public healthy eating campaigns. The discussion is based on a study of campaign managers’ perceptions of nine successfully implemented European healthy eating campaigns. Based...... influence the targets, the development of credible and emotive messages and relationships with media and public institutions....

  7. Weaving the Web into Your Campaign

    Science.gov (United States)

    Broman, Claudia

    2009-01-01

    Like anything else, there are good fundraising campaign Web sites and bad fundraising campaign Web sites. The author took a closer look at fundraising campaign sites to see if her intuitive judgments about these could be translated into a logical, research-supported set of best practices. She set up a study that gauged the ease of use and…

  8. Tracer (18O, 3H, 3H/3He, CFC and SF6) and hydrochemistry to elucidate processes and mean residence times in porous aquifers in the South-East of Austria (Grazer and Leibnitzer Feld)

    Science.gov (United States)

    Kralik, M.; Humer, F.; Darling, G.; Sültenfuß, J.; Wyhlidal, S.

    2012-04-01

    The European Water Framework Directive requires the surface and groundwater bodies in the EU to be back to good quality conditions by 2015. To elucidate the mean residence time (MRT), the recharge area and the potential source of contaminations in particular monitoring wells a combination of several tracers has to be applied at least over one year to answer these questions with confidence. For the implementation of this goal it is necessary that any measures to improve groundwater quality show an impact depending on the MRT. The two groundwater bodies "Grazer Feld" and "Leibnitzer Feld" in the southern part of Styria, Austria stretch out along the river Mur in the N - S direction and covers an area of 166 and 103 km2. The porous aquifer of 10 - 20 m (Grazer Feld) of 6 - 10 m (Leibnitzer Feld) thickness consists of sandy gravel and boulders. In both groundwater bodies are about 2/3 of the aquifer is covered by loam of variable thickness. The depth to water varies between 2 - 20 and 2 - 8 m, respectively. The mean precipitation rate is 900 mm/a. The groundwater runs more or less along the river Mur with a small gradient. The northern part of the Grazer Feld groundwater body is dominated by the urban structure of the city of Graz. The southern part and the groundwater body Leibnitzer Feld is impacted intensively by agricultural use. Due to the extensive agricultural use it contains high concentrations of nitrate and pesticides and shows other hydrochemical changes caused by urbanisation and industrial use. In 33 monitoring wells delta oxygen-18 was analysed four times during one year within the framework of the Austrian hydrochemical groundwater monitoring system. During one campaign 3H, 3H/3He, CFCs and SF6 was analysed in all wells. In addition, the same methods were applied on depth-resolved groundwater samples at selected wells (Kralik et al. 2011). The results of the 3H-input and 3H/3He-models support in both groundwater bodies the rapid water circulation (<5

  9. The STOP the Bleeding Campaign.

    Science.gov (United States)

    Rossaint, Rolf; Bouillon, Bertil; Cerny, Vladimir; Coats, Timothy J; Duranteau, Jacques; Fernández-Mondéjar, Enrique; Filipescu, Daniela; Hunt, Beverley J; Komadina, Radko; Maegele, Marc; Nardi, Giuseppe; Neugebauer, Edmund; Ozier, Yves; Riddez, Louis; Schultz, Arthur; Vincent, Jean-Louis; Spahn, Donat R

    2013-04-26

    According to the World Health Organization, traumatic injuries worldwide are responsible for over 5 million deaths annually. Post-traumatic bleeding caused by traumatic injury-associated coagulopathy is the leading cause of potentially preventable death among trauma patients. Despite these facts, awareness of this problem is insufficient and treatment options are often unclear. The STOP the Bleeding Campaign therefore aims to increase awareness of the phenomenon of post-traumatic coagulopathy and its appropriate management by publishing European guidelines for the management of the bleeding trauma patient, by promoting and monitoring the implementation of these guidelines and by preparing promotional and educational material, organising activities and developing health quality management tools. The campaign aims to reduce the number of patients who die within 24 hours after arrival in the hospital due to exsanguination by a minimum of 20% within the next 5 years.

  10. The STOP the Bleeding Campaign

    Science.gov (United States)

    2013-01-01

    According to the World Health Organization, traumatic injuries worldwide are responsible for over 5 million deaths annually. Post-traumatic bleeding caused by traumatic injury-associated coagulopathy is the leading cause of potentially preventable death among trauma patients. Despite these facts, awareness of this problem is insufficient and treatment options are often unclear. The STOP the Bleeding Campaign therefore aims to increase awareness of the phenomenon of post-traumatic coagulopathy and its appropriate management by publishing European guidelines for the management of the bleeding trauma patient, by promoting and monitoring the implementation of these guidelines and by preparing promotional and educational material, organising activities and developing health quality management tools. The campaign aims to reduce the number of patients who die within 24 hours after arrival in the hospital due to exsanguination by a minimum of 20% within the next 5 years. PMID:23635083

  11. On the unsteady decline of atmospheric CFC-11: Bumps in the road to ozone recovery or variations in atmospheric transport and/or loss?

    Science.gov (United States)

    Montzka, Stephen; Dutton, Geoff; Yu, Pengfei; Portmann, Bob; Ray, Eric; Daniel, John; Moore, Fred; Nance, David; Hall, Brad; Siso, Carolina; Miller, Ben; Mondeel, Debra; Kuijpers, Lambert; Hu, Lei; Elkins, James

    2017-04-01

    Atmospheric mole fractions of the ozone-depleting and greenhouse gas CFC-11 have declined since 1995 owing to global controls on production associated with the fully adjusted and amended Montreal Protocol on Substances that Deplete the Ozone Layer. From 2002 to 2012, CFC-11 mole fractions in both hemispheres decreased at a near-constant rate of 2.2 ± 0.2 ppt/yr. Assuming a constant atmospheric loss frequency, these results suggest that CFC-11 emissions did not decrease over this 11-yr period. This conclusion is difficult to reconcile with an idealized model of emissions being sustained by leaks from a shrinking reservoir of CFC-11 (reported global production has been negligible since 2007). Even more surprising, from 2013 to 2015 the atmospheric decline slowed appreciably (mean global rate was -1.3 ± 0.1 ppt/yr) and the hemispheric difference (N - S) increased by 50%. Here we consider the implications of these atmospheric changes. When analyzed with a simple 3-box model and constant loss frequency or a 3-D climate model (WACCM) with specified dynamics, the observations suggest global CFC-11 emissions in 2014-2015 that were 30% (15 Gg/yr) larger in 2014 and 2015 compared to the 2002-2012 mean. Are emissions of this globally controlled Class 1 ozone-depleting substance actually increasing despite global reported production being negligible for nearly a decade? Or do anomalies observed for multiple trace gases during these periods suggest significant changes in stratospheric loss and mixing processes that are not captured by global models using estimates of actual meteorology?

  12. Sludge Stabilization Campaign blend plan

    Energy Technology Data Exchange (ETDEWEB)

    De Vries, M.L.

    1994-10-04

    This sludge stabilization blend plan documents the material to be processed and the order of processing for the FY95 Sludge Stabilization Campaign. The primary mission of this process is to reduce the inventory of unstable plutonium bearing sludge. The source of the sludge is residual and glovebox floor sweepings from the production of material at the Plutonium Finishing Plant (PFP). The reactive sludge is currently being stored in various gloveboxes at PFP. There are two types of the plutonium bearing material that will be thermally stabilized in the muffle furnace: Plutonium Reclamation Facility (PRF) sludge and Remote Mechanical C (RMC) Line material.

  13. YZ Cnc Chandra observing campaign

    Science.gov (United States)

    Waagen, Elizabeth O.

    2016-12-01

    Dr. Christian Knigge (University of Southampton) and colleagues have requested AAVSO coverage of the SU UMa-type dwarf nova YZ Cnc in support of Chandra X-ray observations to be carried out via a Target of Opportunity (TOO) triggering when the system is in a suitable outburst. YZ Cnc has normal outbursts about every 7-10 days, and superoutbursts about every 100-110 days. The astronomers are planning to use a superoutburst to time the trigger of the TOO observations to cover not only the superoutburst but also the following normal outburst; the superoutburst must occur at a time favorable for observing with Chandra. Once the TOO observations have been triggered, coverage will need to continue through at least one normal outburst after the Chandra observations have been completed. Good coverage of YZ Cnc from AAVSO observers this season is essential; your observations will be used to decide when to trigger the TOO observations. When the TOO observations are triggered, observers will be notified and revised observing instructions will likely be issued via an AAVSO Special Notice and/or via the discussion thread on this campaign on the AAVSO Campaigns and Observation Reports forum on the AAVSO website. Finder charts with sequence may be created using the AAVSO Variable Star Plotter (https://www.aavso.org/vsp). Observations should be submitted to the AAVSO International Database. See full Alert Notice for more details.

  14. INCREASING COMPLIANCE THROUGH EFFICIENT PUBLIC CAMPAIGNS

    Directory of Open Access Journals (Sweden)

    Ilie BANU

    2013-06-01

    Full Text Available This paper starts from the assumption that the degree of compliance of the taxpayer increases in direct proportion to the effectiveness of public campaigns carried out by the tax device. Information campaigns with a view to increase voluntary compliance can be carried out in various ways. They can emphasize either the potential benefits that taxpayers would receive if the compliance were full, or the potential losses when the degree of compliance is reduced. In theory, these campaigns are effective when intersecting with the promotion or warning of taxpayers about certain fiscal aspects. Following the presentation of campaigns carried out in other states, we propose the initiation of a campaign in Romania as well. Corporate taxpayers will choose out of several campaigns and in the end we will present the results of the research based on the methods of the questionnaire and of the interview.

  15. ATV "Jules Verne" Tests Campaign at ESA

    Science.gov (United States)

    Pery, V.; Bouchery, J.-P.; Le Querrec, L.; Maurel, E.; Ruffino, F.

    2004-08-01

    This paper provides with an overview of the ATV first flight model tests campaign that is to take place at ESTEC Test Centre between summer 2004 and mid- 2005. The ATV vehicle mission, configuration and development logic are first briefly described. The campaign sequence and purposes are then outlined together with the main tests principles and objectives. Some of the main constraints that drive the campaign preparation and performance as well as some particular safety aspects are finally defined.

  16. Contextual Influences and Campaign Awareness Among Young Adults: Evidence from the National truth® Campaign.

    Science.gov (United States)

    Vallone, Donna M; Ilakkuvan, Vinu; Xiao, Haijun; Cantrell, Jennifer; Rath, Jessica; Hair, Elizabeth

    2015-01-01

    Mass media campaigns have been found to shape the public's knowledge, attitudes, beliefs, and behavior around tobacco. This study examines the influence of contextual factors with respect to awareness of the national truth® campaign, a mass media, branded tobacco use prevention campaign, among a sample of young adults (n = 2,804) aged 24-34 years old; these respondents were within the age range for both the primary and secondary targets of the campaign during the period (2000-2007) when the campaign was airing television advertising at consistently high levels. Mulitvariable models reveal lower educational attainment and Hispanic ethnicity as significant contextual factors predictive of lower campaign awareness, controlling for media use. In contrast, gender, state tobacco control policy, sensation-seeking, current smoking status, and community-level SES variables were not significantly associated with campaign awareness. Further research is needed to identify the mechanisms through which public education campaigns operate, particularly among disadvantaged communities.

  17. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2010-10-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the “Grand Challenge” for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  18. Advanced Fuels Campaign Execution Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kemal Pasamehmetoglu

    2011-09-01

    The purpose of the Advanced Fuels Campaign (AFC) Execution Plan is to communicate the structure and management of research, development, and demonstration (RD&D) activities within the Fuel Cycle Research and Development (FCRD) program. Included in this document is an overview of the FCRD program, a description of the difference between revolutionary and evolutionary approaches to nuclear fuel development, the meaning of science-based development of nuclear fuels, and the 'Grand Challenge' for the AFC that would, if achieved, provide a transformational technology to the nuclear industry in the form of a high performance, high reliability nuclear fuel system. The activities that will be conducted by the AFC to achieve success towards this grand challenge are described and the goals and milestones over the next 20 to 40 year period of research and development are established.

  19. Twitter Campaigns Around the Fifth IPCC Report: Campaign Spreading, Shared Hashtags, and Separate Communities

    NARCIS (Netherlands)

    Holmberg, K.; Hellsten, I.

    2016-01-01

    In this article, we analyzed campaigning on Twitter around the publication of the fifth Intergovernmental Panel for Climate Change (IPCC) Working Group 1 report in September, 2013. In particular, we analyzed how participation in a specific campaign and use of hashtags connected to the campaign

  20. 11 CFR 106.3 - Allocation of expenses between campaign and non-campaign related travel.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Allocation of expenses between campaign and non-campaign related travel. 106.3 Section 106.3 Federal Elections FEDERAL ELECTION COMMISSION GENERAL ALLOCATIONS OF CANDIDATE AND COMMITTEE ACTIVITIES § 106.3 Allocation of expenses between campaign and non...

  1. Energy efficiency public service advertising campaign

    Energy Technology Data Exchange (ETDEWEB)

    Gibson-Grant, Amanda [Advertising Council, New York, NY (United States)

    2015-06-12

    The Advertising Council (“the Ad Council”) and The United States Department of Energy (DOE) created and launched a national public service advertising campaign designed to promote energy efficiency. The objective of the Energy Efficiency campaign was to redefine how consumers approach energy efficiency by showing that saving energy can save homeowners money.

  2. Perceived Dimensions of Political Campaign Communication.

    Science.gov (United States)

    Atwood, L. Erwin; Sanders, Keith R.

    Advocates of the "new politics" have argued that the use of television for political campaigning can be effectively utilized to encourage and enhance the probability of split ticket voting. Derivation and analysis of seven perceived dimensions of political campaign communication among registered voters finds television unrelated to…

  3. Political Campaigns Get Personal with Students

    Science.gov (United States)

    Hermes, J. J.

    2007-01-01

    On Election Day in 2006, some students at the University of Texas at Austin were prodded by startlingly personal calls from Democratic Party supporters. As political campaigns look to corral young voters, those calls could be a harbinger of things to come in 2008: campaigns going after students through contact information that public colleges are…

  4. Politics and Radio in the 1924 Campaign.

    Science.gov (United States)

    Berkman, Dave

    1987-01-01

    Discusses the relation between radio broadcasting and politics in the 1924 presidential campaign, focusing on newspaper and magazine coverage. Notes radio's influence on candidate image, the aspect of censorship, and the use of radio during the campaign and after the election. (MM)

  5. Quantification of T cell Antigen-specific Memory Responses in Rhesus Macaques, Using Cytokine Flow Cytometry (CFC, also Known as ICS and ICCS): Analysis of Flow Data.

    Science.gov (United States)

    Sylwester, Andrew W; Hansen, Scott G; Picker, Louis J

    2014-04-20

    What was initially termed 'CFC' (Cytokine Flow Cytometry) is now more commonly known as 'ICS' (Intra Cellular Staining), or less commonly as 'ICCS' (Intra Cellular Cytokine Staining). The key innovations were use of an effective permeant (allowing intracellular staining), and a reagent to disrupt secretion (trapping cytokines, thereby enabling accumulation of detectable intracellular signal). Because not all researchers who use the technique are interested in cytokines, the 'ICS' term has gained favor, though 'CFC' will be used here. CFC is a test of cell function, exposing lymphocytes to antigen in culture, then measuring any cytokine responses elicited. Test cultures are processed so as to stain cells with monoclonal antibodies tagged with fluorescent markers, and to chemically fix the cells and decontaminate the samples, using paraformaldehyde. CFC provides the powers of flow cytometry, which includes bulk sampling and multi-parametric cross-correlation, to the analysis of antigen-specific memory responses. A researcher using CFC is able to phenotypically characterize cells cultured with test antigen, and for phenotypic subsets (e.g. CD4(+) or CD8(+) T cells) determine the % frequency producing cytokine above background level. In contrast to ELISPOT and Luminex methods, CFC can correlate production of multiple cytokines from particular, phenotypically-characterized cells. The CFC assay is useful for detecting that an individual has had an antigen exposure (as in population screenings), or for following the emergence and persistence of antigen memories (as in studies of vaccination, infections, or pathogenesis). In addition to quantifying the % frequency of antigen-responding cells, mean fluorescence intensity can be used to assess how much of a cytokine is generated within responding cells. With the technological advance of flow cytometry, a current user of CFC often has access to 11 fluorescent channels (or even 18), making it possible to either highly

  6. Nutrients, chlorophyll, and other data from Northeast Water Column Monitoring cruises in the Mid-Atlantic Bight for the Northeast Monitoring Program (NEMP), 21 April 1980 to 24 April 1984 (NODC Accession 8800171)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Multiple cruise reports for the Northeast Monitoring Program (NEMP) describe the data collection activities, analyses and tabular data from multiple NEMP cruises in...

  7. Temperature, salinity, dissolved oxygen, fluorometer, and other data collected with CTD casts during six ECOHAB cruises in the Northeast Pacific and Puget Sound, 6/2/2003 - 10/4/2006 (NODC Accession 0049079)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is the final processed data for the following cruises in the northeastern Pacific Ocean, Strait of Juan De Fuca, and Puget Sound from 20030602 to 20061004: 1....

  8. Germline mutation in BRAF codon 600 is compatible with human development: de novo p.V600G mutation identified in a patient with CFC syndrome.

    Science.gov (United States)

    Champion, K J; Bunag, C; Estep, A L; Jones, J R; Bolt, C H; Rogers, R C; Rauen, K A; Everman, D B

    2011-05-01

    BRAF, the protein product of BRAF, is a serine/threonine protein kinase and one of the direct downstream effectors of Ras. Somatic mutations in BRAF occur in numerous human cancers, whereas germline BRAF mutations cause cardio-facio-cutaneous (CFC) syndrome. One recurrent somatic mutation, p.V600E, is frequently found in several tumor types, such as melanoma, papillary thyroid carcinoma, colon cancer, and ovarian cancer. However, a germline mutation affecting codon 600 has never been described. Here, we present a patient with CFC syndrome and a de novo germline mutation involving codon 600 of BRAF, thus providing the first evidence that a pathogenic germline mutation involving this critical codon is not only compatible with development but can also cause the CFC phenotype. In vitro functional analysis shows that this mutation, which replaces a valine with a glycine at codon 600 (p.V600G), leads to increased ERK and ELK phosphorylation compared to wild-type BRAF but is less strongly activating than the cancer-associated p.V600E mutation. © 2010 John Wiley & Sons A/S.

  9. Mesospheric removal of very long-lived greenhouse gases SF6 and CFC-115 by metal reactions, Lyman-α photolysis, and electron attachment.

    Science.gov (United States)

    Totterdill, Anna; Kovács, Tamás; Gómez Martín, Juan Carlos; Feng, Wuhu; Plane, John M C

    2015-03-12

    The fluorinated gases SF6 and C2F5Cl (CFC-115) are chemically inert with atmospheric lifetimes of many centuries which, combined with their strong absorption of IR radiation, results in unusually high global warming potentials. Very long lifetimes imply that mesospheric sinks could make important contributions to their atmospheric removal. In order to investigate this, the photolysis cross sections at the prominent solar Lyman-α emission line (121.6 nm), and the reaction kinetics of SF6 and CFC-115 with the neutral meteoric metal atoms Na, K, Mg, and Fe over large temperature ranges, were measured experimentally. The Na and K reactions exhibit significant non-Arrhenius behavior; quantum chemistry calculations of the potential energy surfaces for the SF6 reactions indicate that the Na and K reactions with SF6 are probably activated by vibrational excitation of the F-SF5 (v3) stretching mode. A limited set of kinetic measurements on Na + SF5CF3 are also presented. The atmospheric removal of these long-lived gases by a variety of processes is then evaluated. For SF6, the removal processes in decreasing order of importance are electron attachment, VUV photolysis, and reaction with K, Na, and H. For CFC-115, the removal processes in decreasing order of importance are reaction with O((1)D), VUV photolysis, and reaction with Na, K, and H.

  10. Improving the knowledge of pesticide and nitrate transfer processes using age-dating tools (CFC, SF6, 3H) in a volcanic island (Martinique, French West Indies).

    Science.gov (United States)

    Gourcy, Laurence; Baran, Nicole; Vittecoq, Benoit

    2009-09-01

    Numerous successful examples of CFC and SF(6) groundwater dating applications were recently published. However the proposed CFC/SF(6) method needs various hydrodynamic parameters that are not always available. In order to predict groundwater-quality trends in areas where the hydrogeological context is poorly known, a dating method using tritium, CFC and SF(6) was successfully implemented in Martinique. Hydrogeological understanding is limited in this volcanic island where groundwater contamination by pesticides and nitrate has been recently proven in various areas. A negative correlation was observed between nitrate concentrations and groundwater ages while pesticide contamination showed a more complex schema. Consequently the presence of old groundwater clearly explained the absence or low pesticide and nitrate concentrations in some areas. However a possible degradation of the water quality is to be feared in the future. In view of the relatively long transfer times and the complexity of the remobilization processes of solutes, the expected effects of any modifications in the use of fertilizers, or of changes in pesticide-use legislation, would take a long time to become apparent.

  11. Energy savings with the effect of magnetic field using R290/600a mixture as substitute for CFC12 and HFC134a

    Directory of Open Access Journals (Sweden)

    Mani Kolandavel

    2008-01-01

    Full Text Available This paper presents an experimental study on the replacement of CFC12 and HFC134a by the new R290/R600a refrigerant mixture as drop-in replacement refrigerant with and without the effect of magnetic field. Without any modification to the system components drop-in experimental tests were performed on a vapour compression refrigeration system with a reciprocating compressor, which was originally designed to operate with CFC12.The test results with no magnets showed that the refrigerant R290/R600a had 19.9-50.1% higher refrigerating capacity than R12 and 28.6-87.2% than R134a. The mixture R290/R600a consumed 6.8- -17.4% more energy than R12. The coefficient of performance of R290/R600a mixture increases from 3.9-25.1% than R12 at lower evaporating temperatures and 11.8-17.6% at higher evaporating temperatures. The effect of magnetic field force reduced the compressor energy consumption by 1.5-2.5% than with no magnets. The coefficient of performance of the system was higher in the range 1.5-2.4% with the effect of magnetic field force. The R290/600a (68/32 by wt.% mixture can be considered as an excellent alternative refrigerant for CFC12 and HFC134a systems.

  12. Effects of mesoscale eddies on global ocean distributions of CFC-11, CO2, and Δ14C

    Directory of Open Access Journals (Sweden)

    P. Delecluse

    2007-10-01

    Full Text Available Global-scale tracer simulations are typically made at coarse resolution without explicitly modelling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of transient tracers. We made global anthropogenic transient-tracer simulations in coarse-resolution (2°cosφ×2°, ORCA2 and eddy-permitting (½°cosφ×½°, ORCA05 versions of the ocean general circulation model OPA9. Our focus is on surface-to-intermediate waters of the southern extratropics where air-sea tracer fluxes, tracer storage, and meridional tracer transport are largest. Eddies have little effect on global and regional bomb Δ14C uptake and storage. Yet for anthropogenic CO2 and CFC-11, refining the horizontal resolution reduced southern extratropical uptake by 25% and 28%, respectively. There is a similar decrease in corresponding inventories, which yields better agreement with observations. With higher resolution, eddies strengthen upper ocean vertical stratification and reduce excessive ventilation of intermediate waters by 20% between 60° S and 40° S. By weakening the residual circulation, i.e., the sum of Eulerian mean flow and the opposed eddy-induced flow, eddies reduce the supply of tracer-impoverished deep waters to the surface near the Antarctic divergence, thus reducing the air-sea tracer flux. Thus in the eddy permitting model, surface waters in that region have more time to equilibrate with the atmosphere before they are transported northward and subducted. As a result, the eddy permitting model's inventories of CFC-11 and anthropogenic CO2 are lower in that region because mixed-layer concentrations of both tracers equilibrate with the atmosphere on relatively short time scales (15 days and 6 months, respectively; conversely, bomb Δ14C's air-sea equilibration time of 6 years is so slow that, even in the eddy permitting model, there is little time for surface concentrations to equilibrate with the atmosphere, i.e., before

  13. A novel SOS1 mutation in Costello/CFC syndrome affects signaling in both RAS and PI3K pathways.

    Science.gov (United States)

    Tumurkhuu, Munkhtuya; Saitoh, Makiko; Takita, Junko; Mizuno, Yoko; Mizuguchi, Masashi

    2013-04-01

    Pathological upregulation of the RAS/MAPK pathway causes Costello, Noonan and cardio-facio-cutaneous (CFC) syndrome; however, little is known about PI3K/AKT signal transduction in these syndromes. Previously, we found a novel mutation of the SOS1 gene (T158A) in a patient with Costello/CFC overlapping phenotype. The aim of this study was to investigate how this mutation affects RAS/MAPK as well as PI3K/AKT pathway signal transduction. Wild-type and mutant (T158A) Son of Sevenless 1 (SOS1) were transfected into 293T cells. The levels of phospho- and total ERK1/2, AKT, p70S6K and pS6 were examined under epidermal growth factor (EGF) stimulation. After EGF stimulation, the ratio of phospho-ERK1/2 to total ERK1/2 was highest at 5 min in mutant (T158A) SOS1 cells, and at 15 min in wild-type SOS1 cells. Phospho-AKT was less abundant at 60 min in mutant than in wild-type SOS1 cells. Phosphorylation at various sites in p70S6K differed between wild-type and mutant cells. Eighteen hours after activation by EGF, the ratio of phospho-ERK1/2 to total ERK1/2 remained significantly higher in mutant than in wild-type SOS1 cells, but that of phospho-AKT to total AKT was unchanged. T158A is located in the histone-like domain, which may have a role in auto-inhibition of RAS exchanger activity of SOS1. T158A may disrupt auto-inhibition and enhance RAS signaling. T158A also affects PI3K/AKT signaling, probably via negative feedback via phospho-p70S6K. The SOS1 T158A mutation altered the phosphorylation of gene products involved in both RAS/MAPK and PI3K/AKT pathways.

  14. The replanting campaign has begun

    CERN Multimedia

    GS-SEM Group - General Infrastructure and Services Department

    2010-01-01

    The poplars on the border of CERN's Prévessin site were felled, according to plan, on Friday, 26 February. The work was essential as the trees were showing signs of serious ageing problems (broken and dead branches, weakened trunks and root systems, etc.) and needed to be felled to ensure the safety of drivers on the D35 The trees that have been cut will be transformed into renewable energy wood chips and used to heat local schools and crèches. They will be replaced by a hedge of hornbeams, a native fast-growing tree, which will be planted in the spring.     The felling operation was entrusted to the French national forestry authorities, with the support of the Bellegarde-Pays de Gex Agence Routière et Technique. It marks the start of a vast poplar-felling and replanting campaign, which will be extended to CERN's Meyrin site.  The work is part of CERN's general renovation and site planning scheme for the future.    

  15. Advanced fuels campaign 2013 accomplishments

    Energy Technology Data Exchange (ETDEWEB)

    Braase, Lori [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hamelin, Doug [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2013-10-01

    The mission of the Advanced Fuels Campaign (AFC) is to perform Research, Development, and Demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This includes development of a state-of-the art Research and Development (R&D) infrastructure to support the use of “goal-oriented science-based approach.” In support of the Fuel Cycle Research and Development (FCRD) program, AFC is responsible for developing advanced fuels technologies to support the various fuel cycle options defined in the Department of Energy (DOE) Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. Accomplishments made during fiscal year (FY) 2013 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section.

  16. Evaluation of Kentucky's "Click It or Ticket" 2008 campaign.

    Science.gov (United States)

    2008-07-01

    The objective of this report was to document the results of the "Click It or Ticket" 2008 campaign in Kentucky. The campaign involved a combination of earned media, paid media, and enforcement. : The evaluation of the campaign included documenting th...

  17. AAU-DLR 2010 Indoor Measurement Campaign

    DEFF Research Database (Denmark)

    Steinböck, Gerhard; Pedersen, Troels; Wang, Wei

    2011-01-01

    A measurement campaign, not part of the WHERE2 project, with the focus on indoor multilink and reverberant in-room channels was conducted by DLR and AAU. The measurement data is used from both parties within the WHERE2 project and can be shared upon request. The measurement campaign has two main...... Channels". For the measurement campaign the measurement platform for time-variant wireless channels from DLR was used. The high spatial resolution of the platform allows for combining several transmitter positions to a virtual array. Together with the circular receiver array, this enables a bi...

  18. Evaluation of a brief anti-stigma campaign in Cambridge: do short-term campaigns work?

    Directory of Open Access Journals (Sweden)

    Henderson Claire

    2010-06-01

    Full Text Available Abstract Background In view of the high costs of mass-media campaigns, it is important to understand whether it is possible for a media campaign to have significant population effects over a short period of time. This paper explores this question specifically in reference to stigma and discrimination against people with mental health problems using the Time to Change Cambridge anti-stigma campaign as an example. Methods 410 face-to-face interviews were performed pre, during and post campaign activity to assess campaign awareness and mental health-related knowledge, attitudes and behaviours. Results Although campaign awareness was not sustained following campaign activity, significant and sustained shifts occurred for mental health-related knowledge items. Specifically, there was a 24% (p If a friend had a mental health problem, I know what advice to give them to get professional help, following the campaign. Additionally, for the statement: Medication can be an effective treatment for people with mental health problems, there was a 10% rise (p = 0.05 in the proportion of interviewees responding 'agree' or 'strongly agree' following the campaign. These changes, however, were not evident for attitudinal or behaviour related questions. Conclusions Although these results only reflect the impact of one small scale campaign, these preliminary findings suggest several considerations for mass-media campaign development and evaluation strategies such as: (1 Aiming to influence outcomes pertaining to knowledge in the short term; (2 Planning realistic and targeted outcomes over the short, medium and long term during sustained campaigns; and (3 Monitoring indirect campaign effects such as social discourse or other social networking/contact in the evaluation.

  19. Outreach Materials for the Collision Repair Campaign

    Science.gov (United States)

    The Collision Repair Campaign offers outreach materials to help collision repair shops reduce toxic air exposure. Materials include a DVD, poster, training video, and materials in Spanish (materiales del outreach en español).

  20. Campaigning on behalf of the party? Party constraints on candidate campaign personalisation

    DEFF Research Database (Denmark)

    Bøggild, Troels; Pedersen, Helene Helboe

    2017-01-01

    This article analyses what makes political candidates run a party-focused or personalised election campaign. Prior work shows that candidates face incentives from voters and the media to personalise their campaign rhetoric and promises at the expense of party policy. This has raised concerns about...... the capacity of parties to govern effectively and voters’ ability to hold individual politicians accountable. This article builds on the literature on party organisation and considers the possible constraints candidates face from their party in personalising their election campaigns. Specifically, we argue...... that party control over the candidate nomination process and campaign financing constrains most political candidates in following electoral incentives for campaign personalisation. Using candidate survey data from the 2009 EP election campaign in 27 countries, we show how candidates from parties in which...

  1. SEPARATIONS AND WASTE FORMS CAMPAIGN IMPLEMENTATION PLAN

    Energy Technology Data Exchange (ETDEWEB)

    Vienna, John D.; Todd, Terry A.; Peterson, Mary E.

    2012-11-26

    This Separations and Waste Forms Campaign Implementation Plan provides summary level detail describing how the Campaign will achieve the objectives set-forth by the Fuel Cycle Reasearch and Development (FCRD) Program. This implementation plan will be maintained as a living document and will be updated as needed in response to changes or progress in separations and waste forms research and the FCRD Program priorities.

  2. Human safety and pharmacokinetics of the CFC alternative propellants HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3, 3-heptafluoropropane) following whole-body exposure.

    Science.gov (United States)

    Emmen, H H; Hoogendijk, E M; Klöpping-Ketelaars, W A; Muijser, H; Duistermaat, E; Ravensberg, J C; Alexander, D J; Borkhataria, D; Rusch, G M; Schmit, B

    2000-08-01

    HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3, 3-heptafluoropropane) are used to replace chlorofluorocarbons (CFCs) in refrigerant and aerosol applications, including medical use in metered-dose inhalers. Production and consumption of CFCs are being phased out under the Montreal Protocol on Substances that Deplete the Ozone Layer. The safety and pharmacokinetics of HFC 134a and HFC 227 were assessed in two separate double-blind studies. Each HFC (hydrofluorocarbon) was administered via whole-body exposure as a vapor to eight (four male and four female) healthy volunteers. Volunteers were exposed, once weekly for 1 h, first to air and then to ascending concentrations of HFC (1000, 2000, 4000, and 8000 parts per million (ppm)), interspersed with a second air exposure and two CFC 12 (dichlorodifluoromethane) exposures (1000 and 4000 ppm). Comparison of either HFC 134a or HFC 227 to CFC 12 or air gave no clinically significant results for any of the measured laboratory parameters. There were no notable adverse events, there was no evidence of effects on the central nervous system, and there were no symptoms of upper respiratory tract irritation. HFC 134a, HFC 227, and CFC 12 blood concentrations increased rapidly and in an exposure-concentration-dependent manner, although not strictly proportionally, and approached steady state. Maximum blood concentrations (C(max)) tended to be higher in males than females; in the HFC 227 study, these were statistically significantly (P CFC 12 exposure level. In the HFC 134a study, the gender difference in C(max) was only statistically significant (P CFC 12 at 4000 ppm and HFC 134a at 8000 ppm. Following the end of exposure, blood concentrations declined rapidly, predominantly biphasically and independent of exposure concentration. For the HFC 134a study, the t(1/2)alpha (alpha elimination half-life) was short for both CFC 12 and HFC 134a (CFC 12 and HFC 134a, respectively. Mean residence time (MRT) was an overall mean

  3. 11 CFR 9002.11 - Qualified campaign expense.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Qualified campaign expense. 9002.11 Section 9002.11 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: GENERAL ELECTION FINANCING DEFINITIONS § 9002.11 Qualified campaign expense. (a) Qualified campaign expense means...

  4. 5 CFR 950.701 - DoD overseas campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false DoD overseas campaign. 950.701 Section... VOLUNTARY ORGANIZATIONS DoD Overseas Campaign § 950.701 DoD overseas campaign. (a) A Combined Federal Campaign is authorized for all Department of Defense (DoD) activities in the overseas areas during a 6-week...

  5. 11 CFR 9032.9 - Qualified campaign expense.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Qualified campaign expense. 9032.9 Section 9032.9 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: PRESIDENTIAL PRIMARY MATCHING FUND DEFINITIONS § 9032.9 Qualified campaign expense. (a) Qualified campaign expense...

  6. 29 CFR 452.79 - Opportunity to campaign.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Opportunity to campaign. 452.79 Section 452.79 Labor... DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.79 Opportunity to campaign. There must be a reasonable... prior to the election so that he was denied an equal opportunity to campaign. Similarly, in a mail...

  7. 26 CFR 701.9006-1 - Presidential Election Campaign Fund.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 20 2010-04-01 2010-04-01 false Presidential Election Campaign Fund. 701.9006-1...) INTERNAL REVENUE PRACTICE PRESIDENTIAL ELECTION CAMPAIGN FUND § 701.9006-1 Presidential Election Campaign Fund. (a) Transfer of amounts to the Presidential Election Campaign Fund. The Secretary shall determine...

  8. 29 CFR 452.67 - Distribution of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Distribution of campaign literature. 452.67 Section 452.67... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.67 Distribution of campaign literature. The Act... distribute his campaign literature to the membership at his expense. When the organization or its officers...

  9. What makes or breaks a health fundraising campaign on twitter?

    NARCIS (Netherlands)

    Prasetyo, N.D.; Hauff, C.; Nguyen, D.; Broek, T.A. van den; Hiemstra, D.

    2015-01-01

    Health campaigns that aim to raise awareness and subsequently raise funds for research and treatment are commonplace. While many local campaigns exist, very few attract the attention of a global audience. One of those global campaigns is Movember, an annual campaign during the month of November,

  10. Can public campaigns effectively change psychological determinants of safer sex? An evaluation of three Dutch campaigns

    NARCIS (Netherlands)

    Yzer, MC; Siero, FW; Buunk, BP

    This study evaluated the 1994, 1995 and 1996 Dutch safer sex campaigns as to their effectiveness in terms of improved attitudes, perceived social norms, self-efficacy and intentions regarding safer sex. The hypotheses were tested that variables become more positive when campaigns are conducted and

  11. Health Campaigns as Engaged Pedagogy: Considering a Motorcycle Safety Campaign as Scholarship of Teaching and Learning

    Science.gov (United States)

    Mattson, Marifran; Haas, Emily J.; Kosmoski, Carin

    2013-01-01

    This article argues that teaching health campaigns from an engaged pedagogy perspective is beneficial for students, instructors, and communities. This argument is supported by a teaching and learning perspective using a motorcycle safety campaign as an exemplar. Retrospective interviews were conducted with students who participated in a…

  12. Amateur astronomers in support of observing campaigns

    Science.gov (United States)

    Yanamandra-Fisher, P.

    2014-07-01

    The Pro-Am Collaborative Astronomy (PACA) project evolved from the observational campaign of C/2012 S1 or C/ISON. The success of the paradigm shift in scientific research is now implemented in other comet observing campaigns. While PACA identifies a consistent collaborative approach to pro-am collaborations, given the volume of data generated for each campaign, new ways of rapid data analysis, mining access, and storage are needed. Several interesting results emerged from the synergistic inclusion of both social media and amateur astronomers: - the establishment of a network of astronomers and related professionals that can be galvanized into action on short notice to support observing campaigns; - assist in various science investigations pertinent to the campaign; - provide an alert-sounding mechanism should the need arise; - immediate outreach and dissemination of results via our media/blogger members; - provide a forum for discussions between the imagers and modelers to help strategize the observing campaign for maximum benefit. In 2014, two new comet observing campaigns involving pro-am collaborations have been identified: (1) C/2013 A1 (C/Siding Spring) and (2) 67P/Churyumov-Gerasimenko (CG). The evolving need for individual customized observing campaigns has been incorporated into the evolution of PACA (Pro-Am Collaborative Astronomy) portal that currently is focused on comets: from supporting observing campaigns for current comets, legacy data, historical comets; interconnected with social media and a set of shareable documents addressing observational strategies; consistent standards for data; data access, use, and storage, to align with the needs of professional observers. The integration of science, observations by professional and amateur astronomers, and various social media provides a dynamic and evolving collaborative partnership between professional and amateur astronomers. The recent observation of comet 67P, at a magnitude of 21.2, from Siding

  13. Anti-idling campaign : Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-11-01

    The efficient use of transportation fuels and other petroleum products is being promoted by the Canadian Petroleum Products Institute. The Institute was busy during the past year in attempting to gain an understanding of the measures that could be adopted to assist motorists clearly identify the relationship between fuel consumption, personal transportation spending, and environmental impacts. The Institute undertook these efforts with Natural Resources Canada (NRCan) Office of Energy Efficiency (which both provided funding) and the Public Policy Forum. A first step proposed was the development of an anti-idling public awareness campaign. It was recognized that idling a vehicle for more than ten seconds costs money and wastes fuel, while simultaneously contributing to air pollution, greenhouse gas emissions, and climate change. The campaign also involved Esso, Shell, Petro-Canada, Canadian Tire and Sunoco for the development and implementation phases over the last two weeks of August 2002. A pilot campaign was tested in Mississauga, Ontario. Various materials were used for this campaign, such as posters, banners, cling vinyl window decals, air fresheners and information cards. The main successes of the campaign were: testing the methods of communicating the anti-idling message to drivers at gasoline retailing sites, increasing awareness among the driving public concerning the problems resulting from excessive idling, and encouraging the reduction of idling whenever and wherever it takes place. 1 tab.

  14. Remembering the 100,000 lives campaign

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2016-06-01

    Full Text Available No abstract available. Article truncated after 150 words. Earlier this week the Institute for Healthcare Improvement (IHI emailed its weekly bulletin celebrating that it has been ten years since the end of the 100,000 Lives Campaign (Appendix 1. This was the campaign, according to the bulletin, that put IHI on the map. The Campaign started at the IHI National Forum in December 2004, when IHI's president, Don Berwick, announced that IHI would work together with nearly three-quarters of the US hospitals to reduce needless deaths by 100,000 over 18 months. A phrase borrowed from political campaigns became IHI's cri de coeur: “Some is not a number. Soon is not a time.” The Campaign relied on six key interventions: Rapid Response Teams; Improved Care for Acute Myocardial Infarction; Medication Reconciliation; Preventing Central Line Infections; Preventing Surgical Site Infections; Preventing Ventilator-Associated Pnemonia [sic]. According to the bulletin, the Campaign’s impact rippled across the organization and the world. IHI listed some ...

  15. European emissions of HFC-365mfc, a chlorine-free substitute for the foam blowing agents HCFC-141b and CFC-11.

    Science.gov (United States)

    Stemmler, Konrad; Folini, Doris; Ubl, Sandy; Vollmer, Martin K; Reimann, Stefan; O'Doherty, Simon; Greally, Brian R; Simmonds, Peter G; Manning, Alistair J

    2007-02-15

    HFC-365mfc (1,1,1,3,3-pentafluorobutane) is an industrial chemical used for polyurethane foam blowing. From early 2003, HFC-365mfc has been commercially produced as a substitute for HCFC-141b, whose use in Europe has been banned since January 2004. We describe the first detection of HFC-365mfc in the atmosphere and report on a 2 year long record at the high Alpine station of Jungfraujoch (Switzerland) and the Atlantic coast station of Mace Head (Ireland). The measurements at Jungfraujoch are used to estimate the central European emissions of HFC-365mfc, HCFC-141b, and CFC-11. For HFC-365mfc, we estimate the central European emissions (Germany, France, Italy, Switzerland, The Netherlands, Belgium, and Luxembourg) in 2003 and 2004 as 400-500 tonnes year(-1). These emissions are about one-third lower on a per capita basis than what we estimate from the Mace Head measurements for the total of Europe. The estimated emissions of HCFC-141b for central Europe are higher (i.e., 7.2-3.5 ktonnes year(-1)) with a decreasing trend in the period from 2000 to 2004. Residual emissions of CFC-11 are estimated at 2.4-4.7 ktonnes year(-1) in the same time period. The Po Valley (northern Italy) appears to be a main source region for HFC-365mfc and for the former blowing agents HCFC-141b and CFC-11. In 2004, the emissions of HFC-365mfc arose from a wider region of Europe, which we attribute to an increased penetration of HFC-365mfc into the European market.

  16. Campaigning on behalf of the party? Party constraints on candidate campaign personalisation

    DEFF Research Database (Denmark)

    Bøggild, Troels; Pedersen, Helene Helboe

    2017-01-01

    that party control over the candidate nomination process and campaign financing constrains most political candidates in following electoral incentives for campaign personalisation. Using candidate survey data from the 2009 EP election campaign in 27 countries, we show how candidates from parties in which...... party officials exerted greater control over the nomination process and campaign finances were less likely to engage in personalised campaigning at the expense of the party programme. The findings imply that most parties, as central gatekeepers and resource suppliers, hold important control mechanisms...... for countering the electoral pressure for personalisation, and advance our understanding of the incentives and constraints candidates face when communicating with voters. We discuss how recent democratic reforms, paradoxically, might induce candidate personalisation with potential negative democratic...

  17. Road safety campaign is a great success

    CERN Multimedia

    2008-01-01

    Rolf Heuer, the next Director-General of CERN, and Sigurd Lettow, the Director of Finance and Human Resources (photo below), completed all the tests of the CERN road safety campaign under the supervision of TCS instructors. The road safety campaign, which took place in the Main Building during the week of 10 November, attracted large numbers of participants. More than 300 CERN personnel and users took part in, and in some cases were literally bowled over by, the activities set up by instructors from the TCS (Touring Club Suisse). The campaign’s aim was to raise driver awareness of several aspects of road safety, including speed, use of mobile phones at the wheel, pedestrian priority, unlawful parking and driving with a valid licence. The campaign was an unqualified success! Even CERN’s directors joined in, testing their own reactions as drivers on the various pieces of apparatus in place.

  18. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Multimedia

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  19. RESULTS of the "ELIMINATING NOISE" campaign

    CERN Document Server

    SC Unit

    2008-01-01

    From 4 to 6 August, CERN’s nurses conducted a screening campaign entitled "Eliminating noise". This campaign was especially aimed at young people exposed to noise during their leisure hours (playing in a band, listening to MP3 players, attending concerts, etc.). In all, 166 people attended the Infirmary, where they were able to receive personalised advice, documentation and, above all, a hearing test (audiogram). While the high attendance of people in the younger age category (18-30) was a success, their audiogram data were a cause for concern, with 24.5% showing abnormal results, hearing deficiencies which, we should remind you, are irreversible. It should be noted that such conditions are almost exclusively caused by noise exposure in a non-professional environment (leisure activities, music, etc.). This latest campaign confirms the harmful effects of noise on people’s hearing due to the absence or insufficiency of protective equipment during music-related activities; this further unde...

  20. Local Election Campaign in Social Media

    DEFF Research Database (Denmark)

    Bock Segaard, Signe; Agger Nielsen, Jeppe

    In this paper we focus on the usage of social media in political election campaigns. These new arenas have become increasingly important for democratic purposes, such as opinion sharing and discussions between candidates and voters. But there is a lack of research on how social media is used...... in local election campaigns. Therefore, the aim of this study is to investigate the use of social media as it was intended to be central arenas for local election campaigns in Norwegian municipalities. For that purpose we first develop a model of political communication in social media that conceptualise...... candidates, content registration of local blogs, and log file data of local blogs through Google Analytics). In contrast to the democratic vision for social media the analysis demonstrates that the election blogs primarily are used by those who are most politically active in advance. The analysis also shows...

  1. Teen PACK: Population Awareness Campaign Kit.

    Science.gov (United States)

    Zero Population Growth, Inc., Washington, DC.

    This packet of instructional materials is designed to teach teenagers about the effects of overpopulation on the world and on the individual. Information is presented in three related booklets. The first of the three parts of the "Teen Population Awareness Campaign Kit," illustrates overpopulation through profiles of teens living in…

  2. Persistence of Change: Fume Hood Campaign Lessons

    Science.gov (United States)

    Feder, Elah; Robinson, Jennifer; Wakefield, Sarah

    2012-01-01

    Purpose: Sustainability initiatives typically operate for a limited time period, but it is often unclear whether they have lasting effects. The purpose of this paper is to examine a laboratory fume hood campaign, in order to identify factors that might contribute or detract from long-term change persistence. Design/methodology/approach: The…

  3. Collaboration Portals for NASA's Airborne Field Campaigns

    Science.gov (United States)

    Conover, H.; Kulkarni, A.; Garrett, M.; Goodman, M.; Petersen, W. A.; Drewry, M.; Hardin, D. M.; He, M.

    2011-12-01

    The University of Alabama in Huntsville (UAH), in collaboration with the Global Hydrology Resource Center, a NASA Earth Science Data Center, has provided information management for a number of NASA Airborne Field campaigns, both hurricane science investigations and satellite instrument validation. Effective field campaign management requires communication and coordination tools, including utilities for personnel to upload and share flight plans, weather forecasts, a variety of mission reports, preliminary science data, and personal photos. Beginning with the Genesis and Rapid Intensification Processes (GRIP) hurricane field campaign in 2010, we have provided these capabilities via a Drupal-based collaboration portal. This portal was reused and modified for the Midlatitude Continental Convective Clouds Experiment (MC3E), part of the Global Precipitation Measurement mission ground validation program. An end goal of these development efforts is the creation of a Drupal profile for field campaign management. This presentation will discuss experiences with Drupal in developing and using these collaboration portals. Topics will include Drupal modules used, advantages and disadvantages of working with Drupal in this context, and how the science teams used the portals in comparison with other communication and collaboration tools.

  4. Japanese campaign to enthuse young scientists

    CERN Multimedia

    1999-01-01

    Japan's Science and Technology Agency has launched a 3-year campaign to promote the public understanding of science and revive the interest in science subjects in schools. Plans include a science-only television channel and a 'virtual science museum' on the Internet (2 paragraphs).

  5. Ecuador's Healthy Food Campaign: An Effectiveness Assessment ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The campaign will help improve food policy interventions, convince people to adopt healthy and sustainable diets, and prevent food-related chronic illness. Heavy health burden Overweight and obesity ... This would trigger changes in food production, retail, and marketing. Impact and opportunities This project will allow a ...

  6. Analyzing the Communication Dynamics of Political Campaigns

    Science.gov (United States)

    Tannenbaum, Sally

    2007-01-01

    It is widely agreed that college students do not fully participate in the political process. The most commonly cited reasons are apathy, indifference, and ignorance. This article presents an activity that aims to help students learn about communication dynamics in the context of political campaigns and develop an appreciation and confidence about…

  7. The Political Scientist as Local Campaign Consultant

    Science.gov (United States)

    Crew, Robert E., Jr.

    2011-01-01

    During my 45 years as an academic, I have followed the admonition sometimes attributed to the legendary Jedi warrior Obi-Wan Kenobe that political scientists should "use [their] power for good and not for evil." In this spirit, I have devoted substantial portions of my career to public service by providing strategic advice and campaign management…

  8. White Paper on Televised Political Campaign Debates.

    Science.gov (United States)

    Argumentation and Advocacy, 2002

    2002-01-01

    Surveys existing research on televised campaign debates; indicates areas for future research; considers the resources needed to expand and improve current research efforts; and encourages more systematic and sustained inquiry. Notes two compelling needs in terms of resources: an archive containing comprehensive records of media coverage of the…

  9. The Air Campaign: Planning for Combat

    Science.gov (United States)

    1988-01-01

    Interference before and during the offensive with lateral lines of communication was especially effec- tive.9 General Frido von Senger und Etterlin...theater. 20, 5b, 71, 96. Sea Torces. See Naval forces 107, 108. See also Japan Senger und Etterlin, Frido von, air superioritv campaign in, 90 29-34, 38, 60

  10. Transmutation Fuels Campaign FY-09 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2009-09-01

    This report summarizes the fiscal year 2009 (FY-08) accomplishments for the Transmutation Fuels Campaign (TFC). The emphasis is on the accomplishments and relevance of the work. Detailed description of the methods used to achieve the highlighted results and the associated support tasks are not included in this report.

  11. A colorful, charismatic, community-oriented campaign.

    Science.gov (United States)

    McLaughlin, Kandace

    2007-01-01

    You might think that the draw of blue skies, palm trees, and warm climates would be enough to lure workers to NCH Healthcare Systems, centered in Naples, FL. With a unique benefits plan, NCH launched a unique campaign to organize the many elements that make working for the facility like a day at the beach.

  12. My #safecities solution campaign | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-05-19

    May 19, 2017 ... The conference, organized with IDRC by the African Leadership Centre, will offer many opportunities for online participation, including webcasts. my safe cities solutions posters. IDRC is running a campaign on Facebook and Twitter to highlight the many solutions generated by SAIC research and other ...

  13. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  14. [A multi-center, randomized, double-blind, positive controlled clinical trial of salbutamol sulfate MDI without CFC in the treatment of asthma].

    Science.gov (United States)

    2014-03-01

    To evaluate the efficacy and safety of domestically produced Salbutamol Sulfate metered dose inhaler (MDI) without chloro-fluro-carbon (CFC) in the treatment of asthmatic patients. A muticenter, randomized, double-blind, positive controlled clinical trial was conducted in asthmatic patients. The participants were randomized divided into trial group treated with domestically produced Salbutamol Sulfate Aerosol MDI (200 microg single-dose) and control group treated with imported Salbutamol Sulfate Aerosol MDI (200 microg single-dose). The lung function was measured by spirometry and a scoring questionaire before medications and 15, 30, 120 and 240 min post medications. A total of 238 patients were enrolled in the trial. Compared with baselines, the forced expiratory volume in 1 s (FEV1) of the participants in both groups increased significantly 15, 30, 120 and 240 min after medications (P 0.05). Similarly, the forced vital capacity (FVC) and asthma symptomatic scores of the participants in both groups improved significantly after administration of medications (P 0.05). In both groups, drugs were well tolerated. The domestically produced Salbutamol Sulfate Aerosol MDI without CFC is effective and safe for treating asthma.

  15. The DAURE field campaign: meteorological overview

    Science.gov (United States)

    Jorba, O.; Pandolfi, M.; Spada, M.; Baldasano, J. M.; Pey, J.; Alastuey, A.; Arnold, D.; Sicard, M.; Artiñano, B.; Revuelta, M. A.; Querol, X.

    2011-02-01

    From end of February until March 2009 and July 2009 the experimental campaign named DAURE took place in northeastern Spain in both an urban and rural sites (Barcelona city and Montseny Natural Park) with the main objective of studying the formation and transport processes of particulate matter in the region. Several groups collaborated in an extensive measurement campaign with aerosol monitoring, meteorological measurements, atmospheric vertical structure retrievals from LIDAR and supported by numerical simulations of the meteorological and air quality conditions over the region. In this article, we present a description of the main meteorological conditions that affected the Barcelona geographical area during the campaign. The main synoptic conditions are identified and discussed by means of meteorological observations and numerical weather prediction models. Furthermore, a detailed analysis of the local meteorological conditions during the campaign is also presented. The characteristic surface wind field and the vertical structure of the main flows affecting Barcelona and the Montseny rural site are discussed using high-resolution mesoscale meteorological simulations, vertical profiles of LIDAR measurements, radiosoundings, and analysis of backward dispersion simulations with a Lagrangian model. The analysis permits the identification of three main meteorological regimes for the winter campaign (February and March 2009): a first regime dominated by high-pressure conditions over Barcelona and western Mediterranean Basin, high insolation, and the development of thermally-driven wind flows. A second regime is characterized by a strong northwestern advection that produced a cleansing action over the atmosphere. And a third identified regime is dominated by strong stagnant conditions produced by thermal inversions that decouple the low troposphere of plain and coastal areas from mountainous terrains. On the other hand, the main meteorological regimes identified for

  16. An overview of the AROMAT campaigns

    Science.gov (United States)

    Merlaud, Alexis; Dekemper, Emmanuel; Van Roozendael, Michel; Constantin, Daniel; Georgescu, Lucian; Meier, Andreas; Richter, Andreas; Den Hoed, Mirjam; Allaart, Marc; Boscornea, Andreea; Vajaiac, Sorin; Bellegante, Livio; Nemuc, Anca; Nicolae, Doina; Shaifangar, Reza; Dörner, Steffen; Wagner, Thomas; Stebel, Kerstin; Schuettemeyer, Dirk

    2016-04-01

    The Airborne ROmanian Measurements of Aerosols and Trace gases (AROMAT) campaign and its follow-up AROMAT-2 were held in September 2014 and August 2015, respectively. Both campaigns focused on two geophysical targets: the city of Bucharest and the large power plants of the Jiu Valley, which are located in a rural area 170 km West of Bucharest. These two areas are complementary in terms of emitted chemical species and their spatial distributions. The objectives of the AROMAT campaigns were (i) to test recently developed airborne observation systems dedicated to air quality satellite validation studies such as the AirMAP imaging DOAS system (University of Bremen), the NO2 sonde (KNMI), and the compact SWING whiskbroom imager (BIRA), and (ii) to prepare the validation programme of the future Atmospheric Sentinels, starting with Sentinel-5 Precursor (S5P) to be launched in early summer 2016. We present results from the different airborne instrumentations and from coincident ground-based measurements (lidar, in-situ, and mobile DOAS systems) performed during both campaigns. The AROMAT dataset addresses several of the mandatory products of TROPOMI/S5P, in particular NO2 and SO2 (horizontal distribution and profile from aircraft, plume image with ground-based SO2 and NO2 cameras, transects with mobile DOAS, in-situ), H2CO (mobile MAX-DOAS), and aerosols (lidar, airborne FUBISS-ASA2 sun-photometer, and aircraft in-situ). We investigate the information content of the AROMAT dataset for satellite validation studies based on co-located OMI and GOME-2 data, and simulations of TROPOMI measurements. The experience gained during AROMAT and AROMAT-2 will be used in support of a large-scale TROPOMI/S5P validation campaign in Romania scheduled for summer 2017.

  17. International 24-Hour LEO Space Debris Measurement Campaign 2015

    Science.gov (United States)

    Hamilton, Joseph; Letsch, Klemens; Blackwell, Christopher; McSheehy, Richard; Quanette, Juarez

    2017-01-01

    The Inter-Agency Space Debris Coordination Committee (IADC) provides the organizational framework for sponsoring periodic international measurement campaigns of the space debris environment. The IADC has conducted two types of campaigns: high altitude campaigns designed to measure the debris environment at near-geostationary altitudes using mostly optical telescopes, and low altitude campaigns using primarily radars. One of the goals of the low altitude campaigns is to collect data for 24 contiguous hours. This way, all orbit planes can be sampled. Multiple sensors are used, each with its own strengths and weaknesses, to provide a more complete understanding of the environment. Comparing results between sensors also provides a better understanding of the potential biases resulting from any one sensor. Conducting the campaigns at roughly regular intervals over a long period also allows researchers to examine trends and growth of the environment over time. For this reason, low altitude campaigns are anticipated at two-year intervals. This is the eighth IADC low altitude campaign conducted. The first campaign was conducted in 1996 and two campaigns were conducted in 1999. The 2002 campaign was delayed until January 2003 because of scheduling conflicts, and the fifth, sixth, and seventh campaigns were conducted in 2004, 2008, and 2013 respectively. The eighth campaign was conducted on 8 December 2015.

  18. Can public campaigns effectively change psychological determinants of safer sex? An evaluation of three Dutch campaigns

    National Research Council Canada - National Science Library

    Yzer, MC; Siero, FW; Buunk, BP

    2000-01-01

    This study evaluated the 1994, 1995 and 1996 Dutch safer sex campaigns as to their effectiveness in terms of improved attitudes, perceived social norms, self-efficacy and intentions regarding safer sex...

  19. Citizen Preparedness Campaign: Information Campaigns Increasing Citizen Preparedness to Support Creating a Culture of Preparedness’

    Science.gov (United States)

    2007-03-01

    and volunteer opportunities through these messages. Since most cinemas today have advertisements in slide format, and some cinemas show short film...campaigns. For example, in many of the Ad Council information campaigns, marketing and advertising firms produced the messages pro bono, and...mechanism for messages on preparedness and then allows a person to find out even more information once you gain their attention. Cinemas Partner with

  20. Social Media Campaign Effects: Moderating Role of Social Capital in an Anti-Smoking Campaign.

    Science.gov (United States)

    Namkoong, Kang; Nah, Seungahn; Van Stee, Stephanie K; Record, Rachael A

    2018-03-01

    This study examined the effects of an anti-smoking campaign that employs a crowdsourcing method with a social networking service. Drawing upon social capital scholarship and the expression effect research paradigm in eHealth systems, the study also investigated the roles of social trust and community life satisfaction in the social media campaign that has a specific geographical boundary. To that end, we conducted an experiment using a two-group pretest-posttest design. We randomly assigned 201 participants to two conditions: "campaign message reception only" as a control group and "message reception and expression" as a treatment group in which participants fully engaged in the campaign process by sharing their own campaign ideas with other participants. Findings revealed that social trust and community life satisfaction interacted with the treatment condition to positively affect persuasive intentions, but in distinct ways. Social trust moderated the effect of the message reception and interaction condition on participants' willingness to encourage community members to stop smoking. In contrast, community life satisfaction moderated the effect of the treatment condition on encouraging others to comply with the community's anti-smoking policy. These results provide theoretical and practical implications related to the roles of social capital in geographically defined social media campaigns.

  1. GPM GROUND VALIDATION CAMPAIGN REPORTS MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation Campaign Reports MC3E dataset consists of various reports filed by the scientists during the MC3E campaign which took place from mid April...

  2. An Expert Systems Approach for PR Campaigns Research.

    Science.gov (United States)

    Cameron, Glen T.; Curtin, Patricia A.

    1992-01-01

    Describes an expert system (the artificial intelligence program "Publics") that helps users identify key publics for public relations campaigns. Examines advantages and problems encountered in its use in public relations campaigns classrooms. (SR)

  3. Editorials and Foreign Affairs in Recent Presidential Campaigns.

    Science.gov (United States)

    Myers, David S.

    1982-01-01

    Reveals that the amount of space given to foreign affairs in editorials during the 1980 presidential campaign was slightly greater than that given in the four previous campaigns, but that the number of issues discussed was smaller. (FL)

  4. A Smoking Cessation Campaign on Twitter: Understanding the Use of Twitter and Identifying Major Players in a Health Campaign.

    Science.gov (United States)

    Chung, Jae Eun

    2016-05-01

    The current study examined the use of online social media for a health campaign. Collecting tweets (N = 1,790) about the recent smoking cessation campaign by the Centers for Disease Control and Prevention, the current study investigated the dissemination of health campaign messages on Twitter and answered questions from the process evaluation of health campaigns: who tweeted about the campaign, who played central roles in disseminating health campaign messages, and how various features of Twitter were used for sharing of campaign messages. Results showed that individuals and nonprofit organizations posted frequently about the campaign: Individuals and nonprofit organizations posted about 40% and 30% of campaign-related tweets, respectively. Although the campaign under investigation was steered by a government agency, nonprofit organizations played a vital role as mediators who disseminated campaign messages. The culture of retweeting demonstrated its particular usefulness for the dissemination of campaign messages. Despite the expectation that the use of social media would expand opportunities for engagement, actual two-way interactions were few or minimal. Drawn from the results, practical suggestions on how to strategize the use of Twitter for future health campaigns are discussed.

  5. World Rabies Day campaign in the Philippines.

    Science.gov (United States)

    Medina, Danellie Joy O; Jayme, Sarah I; Amparo, Anna Charinna B; Cresencio, Rubina O; Lopez, Emelinda L; Baquilod, Mario S; Hernandez, Leda M; Villalon, Ernesto E S; Nel, Louis D

    2016-01-01

    Rabies is a fatal disease, claiming the lives of around 59,000 people annually worldwide. It is considered a neglected and underreported disease leading to inadequate support from governments. Apart from dog vaccination and proper animal bite management, an integral part of a successful rabies control program is community education. The Philippine government conducts an extensive nationwide annual World Rabies Day (WRD) celebration as part of its community education. Strong inter-sectoral collaboration at the national level is a key factor for the success of WRD, capitalizing on the partners' strengths to mobilize various sectors. Strategies include the National WRD Celebration and releasing national government memorandums. An invitation letter campaign was initiated, encouraging stakeholders to register their activities. Banners were given as an incentive for those who registered. Mass and social media were also utilized to promote WRD. Registered WRD events held in the Philippines rose from 10 events in 2012, to 37 events in 2013, to 66 events in 2014 and 76 events in 2015. The individual activities involved veterinary services and information, communication, and education (IEC) activities. Nine unique WRD IEC activities are highlighted in this paper. Promotion of WRD through social media was also utilized in recent years. More news items were published online than those printed in newspapers and aired on television. The campaign's success underlines the value of a national government-led program. The national rabies program sets the agenda for priority activities including the WRD campaign. Its capacity to allocate funds for the program also denotes stability which is beneficial for local program implementers. Different segments of society were tapped through various strategies. The campaign's flexibility allowed for a large range of activities and presented opportunities for expanding partnerships and integration with others interventions for its sustainability

  6. 5 CFR 950.103 - Establishing a local campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Establishing a local campaign. 950.103... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.103 Establishing a local campaign. (a) The Director establishes and maintains the official list of local campaigns and the geographical area each...

  7. Campaigning for Children's Oral Health: A Case Study

    Science.gov (United States)

    Vaughan, Kate

    2009-01-01

    Arguably, the ultimate application of evidenced-based communications is translating the research recommendations into a full-fledged media campaign. This article explains the development and implementation of Watch Your Mouth, a campaign based on FrameWorks Institute's research on children's oral health. To date, this innovative campaign has been…

  8. 29 CFR 452.69 - Expenses of campaign literature.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Expenses of campaign literature. 452.69 Section 452.69... AND DISCLOSURE ACT OF 1959 Campaign Safeguards § 452.69 Expenses of campaign literature. Each... is no requirement that the union distribute the literature of the candidate free of charge. In the...

  9. 11 CFR 103.4 - Vice Presidential candidate campaign depositories.

    Science.gov (United States)

    2010-01-01

    ... designated by the principal campaign committee of a political party's candidate for President shall be the campaign depository for that political party's candidate for the office of Vice President. ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Vice Presidential candidate campaign...

  10. Marketing Social Service Programs Using Political Campaign Technology.

    Science.gov (United States)

    Bynum, Peter

    1991-01-01

    Discusses how human services agencies can use strategies and information technologies similar to those used in political campaigns to identify needs and attitudes for social services campaigns. Marketing for social services programs is described, and the use of computers for a political campaign and for a teenage pregnancy program is compared.…

  11. 5 CFR 734.205 - Participation in political campaigns.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in political campaigns. 734... in political campaigns. Subject to the prohibitions in § 734.306, an employee may: (a) Display... candidate or a candidate for political party office in a political advertisement, broadcast, campaign...

  12. 5 CFR 734.411 - Participation in political campaigning; prohibitions.

    Science.gov (United States)

    2010-01-01

    ... under this subpart may not: (a) Take an active part in managing the political campaign of a candidate for partisan political office or a candidate for political party office; (b) Campaign for partisan... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in political campaigning...

  13. Analysis of physical activity mass media campaign design.

    Science.gov (United States)

    Lankford, Tina; Wallace, Jana; Brown, David; Soares, Jesus; Epping, Jacqueline N; Fridinger, Fred

    2014-08-01

    Mass media campaigns are a necessary tool for public health practitioners to reach large populations and promote healthy behaviors. Most health scholars have concluded that mass media can significantly influence the health behaviors of populations; however the effects of such campaigns are typically modest and may require significant resources. A recent Community Preventive Services Task Force review on stand-alone mass media campaigns concluded there was insufficient evidence to determine their effectiveness in increasing physical activity, partly due to mixed methods and modest and inconsistent effects on levels of physical activity. A secondary analysis was performed on the campaigns evaluated in the Task Force review to determine use of campaign-building principles, channels, and levels of awareness and their impact on campaign outcomes. Each study was analyzed by 2 reviewers for inclusion of campaign building principles. Campaigns that included 5 or more campaign principles were more likely to be successful in achieving physical activity outcomes. Campaign success is more likely if the campaign building principles (formative research, audience segmentation, message design, channel placement, process evaluation, and theory-based) are used as part of campaign design and planning.

  14. The Demeter micro satellite launch campaign

    Science.gov (United States)

    Dubourg, V.; Kainov, V.; Thoby, M.; Silkin, O.; Solovey, V.

    The CNES Micro satellite DEMETER is planned for launch by the end of June 2004 on a DNEPR launcher, from the Baíkonur cosmodrome. DEMETER will be the main payload among nine co-passengers. DEMETER, initiated by CNES in 1998, is the first model of the MYRIADE micro satellites line of product; at the time when this abstract is issued, the satellite is going through the final integration tests, as well as the last system validation phase. The space head module of the launcher has been developed by the Ukrainian YSDO company, and a successful fit check test campaign has been performed in December 2003 and January 2004 that allowed confirming the compatibility of the payloads with their launcher interface. The launch campaign is in process of preparation, implying a close partnership between the satellite team at CNES and Russian and Ukrainian launcher authorities: DEMETER is a pioneer not only for the satellite concept itself, but also for being the first satellite of this range (3 axis stabilized, including an hydrazine propulsion system and developed by a national space agency) being launched on a Russian space adapted intercontinental ballistic missile SS18. The launch service is contracted and managed by ISC Kosmotras, and it will also be the first sun synchronous orbit launch for DNEPR. Thus the launch preparation proved to be a very challenging endeavour providing all the actors with very rich human experience, as well as technical exchanges, in the fields of launcher technology and interfaces, facilities adaptation, logistics and project coordination. In the coming paper, a short presentation of the DEMETER satellite and of the DNEPR launcher will be made, but the main purpose is to present: the launch campaign preparation milestones, the launch campaign itself and related preliminary results and the lessons learnt from this first CNES/DNEPR experience to open the way to the future MYRIADE launches. A common CNES/KOSMOTRAS presentation is proposed at the

  15. PERSON DEIXIS IN USA PRESIDENTIAL CAMPAIGN SPEECHES

    OpenAIRE

    Nanda Anggarani Putri; Eri Kurniawan

    2015-01-01

    This study investigates the use of person deixis in presidential campaign speeches. This study is important because the use of person deixis in political speeches has been proved by many studies to give significant effects to the audience. The study largely employs a descriptive qualitative method. However, it also employs a simple quantitative method in calculating the number of personal pronouns used in the speeches and their percentages. The data for the study were collected from the trans...

  16. The Z CamPaign: Year Five

    Science.gov (United States)

    Simonsen, Mike

    2014-05-01

    Entering into the fifth year of the Z CamPaign, the author has developed a website summarizing our findings which will also act as a living catalog of bona fide Z Cam stars, suspected Z Cams, and Z Cam impostors. In this paper we summarize the findings of the first four years of research, introduce the website and its contents to the public, and discuss the way forward into year five and beyond.

  17. Campaigns and counter campaigns: reactions on Twitter to e-cigarette education.

    Science.gov (United States)

    Allem, Jon-Patrick; Escobedo, Patricia; Chu, Kar-Hai; Soto, Daniel W; Cruz, Tess Boley; Unger, Jennifer B

    2017-03-01

    Social media present opportunities for public health departments to galvanise interest in health issues. A challenge is creating content that will resonate with target audiences, and determining reactions to educational material. Twitter can be used as a real-time surveillance system to capture individuals' immediate reactions to education campaigns and such information could lead to better campaigns in the future. A case study testing Twitter's potential presented itself when the California Department of Public Health launched its 'Still Blowing Smoke' media campaign about the potential harmful effects of e-cigarettes. Pro-e-cigarette advocacy groups, in response, launched a counter campaign titled 'Not Blowing Smoke'. This study tracked the popularity of the two campaigns on Twitter, analysed the content of the messages and determined who was involved in these discussions. The study period was from 22 March 2015 to 27 June 2015. A stratified sampling procedure supplied 2192 tweets for analysis. Content analysis identified pro, anti and neutral e-cigarette tweets, and five additional themes: Marketing Elements, Money, Regulation/propaganda, Health, and Other. Metadata were analysed to obtain additional information about Twitter accounts. 'Not Blowing Smoke' was referenced more frequently than 'Still Blowing Smoke' on Twitter. Messages commonly objected to government regulation of e-cigarettes, refuted claims that e-cigarette manufactures were aligned with big tobacco, and touted the health benefits of e-cigarette use. E-cigarette companies and vape shops used campaign slogans to communicate with customers on Twitter. Findings showed the time dynamics of Twitter and the possibility for real-time monitoring of education campaigns. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  18. Coupling 3D groundwater modeling with CFC-based age dating to classify local groundwater circulation in an unconfined crystalline aquifer

    Science.gov (United States)

    Kolbe, Tamara; Marçais, Jean; Thomas, Zahra; Abbott, Benjamin W.; de Dreuzy, Jean-Raynald; Rousseau-Gueutin, Pauline; Aquilina, Luc; Labasque, Thierry; Pinay, Gilles

    2016-12-01

    Nitrogen pollution of freshwater and estuarine environments is one of the most urgent environmental crises. Shallow aquifers with predominantly local flow circulation are particularly vulnerable to agricultural contaminants. Water transit time and flow path are key controls on catchment nitrogen retention and removal capacity, but the relative importance of hydrogeological and topographical factors in determining these parameters is still uncertain. We used groundwater dating and numerical modeling techniques to assess transit time and flow path in an unconfined aquifer in Brittany, France. The 35.5 km2 study catchment has a crystalline basement underneath a ∼60 m thick weathered and fractured layer, and is separated into a distinct upland and lowland area by an 80 m-high butte. We used groundwater discharge and groundwater ages derived from chlorofluorocarbon (CFC) concentration to calibrate a free-surface flow model simulating groundwater flow circulation. We found that groundwater flow was highly local (mean travel distance = 350 m), substantially smaller than the typical distance between neighboring streams (∼1 km), while CFC-based ages were quite old (mean = 40 years). Sensitivity analysis revealed that groundwater travel distances were not sensitive to geological parameters (i.e. arrangement of geological layers and permeability profile) within the constraints of the CFC age data. However, circulation was sensitive to topography in the lowland area where the water table was near the land surface, and to recharge rate in the upland area where water input modulated the free surface of the aquifer. We quantified these differences with a local groundwater ratio (rGW-LOCAL), defined as the mean groundwater travel distance divided by the mean of the reference surface distances (the distance water would have to travel across the surface of the digital elevation model). Lowland, rGW-LOCAL was near 1, indicating primarily topographical controls. Upland, r

  19. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Maurice Ewing Cruise in the Atlantic Ocean (WOCE Section A17, 4 January - 21 March 1994)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2005-06-30

    This documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and pH at hydrographic stations during the R/V Maurice Ewing cruise in the South Atlantic Ocean on the A17 WOCE section. Conducted as part of the World Ocean Circulation Experiment (WOCE), this cruise was also a part of the French WOCE program consisting of three expeditions (CITHER 1, 2, and 3) focused on the South Atlantic Ocean. The A17 section was occupied during the CITHER 2 expedition, which began in Montevideo, Uruguay, on January 4, 1994 and finished in Cayenne, French Guyana, on March 21, 1994. During this period the ship stopped in Salvador de Bahia and Recife, Brazil, to take on supplies and exchange personnel. Upon completion of the cruise the ship transited to Fort de France, Martinique. Instructions for accessing the data are provided.

  20. Q-Thruster Breadboard Campaign Project

    Science.gov (United States)

    White, Harold

    2014-01-01

    Dr. Harold "Sonny" White has developed the physics theory basis for utilizing the quantum vacuum to produce thrust. The engineering implementation of the theory is known as Q-thrusters. During FY13, three test campaigns were conducted that conclusively demonstrated tangible evidence of Q-thruster physics with measurable thrust bringing the TRL up from TRL 2 to early TRL 3. This project will continue with the development of the technology to a breadboard level by leveraging the most recent NASA/industry test hardware. This project will replace the manual tuning process used in the 2013 test campaign with an automated Radio Frequency (RF) Phase Lock Loop system (precursor to flight-like implementation), and will redesign the signal ports to minimize RF leakage (improves efficiency). This project will build on the 2013 test campaign using the above improvements on the test implementation to get ready for subsequent Independent Verification and Validation testing at Glenn Research Center (GRC) and Jet Propulsion Laboratory (JPL) in FY 2015. Q-thruster technology has a much higher thrust to power than current forms of electric propulsion (7x Hall thrusters), and can significantly reduce the total power required for either Solar Electric Propulsion (SEP) or Nuclear Electric Propulsion (NEP). Also, due to the high thrust and high specific impulse, Q-thruster technology will greatly relax the specific mass requirements for in-space nuclear reactor systems. Q-thrusters can reduce transit times for a power-constrained architecture.

  1. Feasibility study of the AOSTA experimental campaign

    Directory of Open Access Journals (Sweden)

    Carta M.

    2016-01-01

    Full Text Available The reduction of the nuclear waste is one of the most important nuclear issues. The high radiotoxicity of the spent fuel is due to plutonium and some minor actinides (MAs such as neptunium, americium and curium, above all. One way to reduce their hazard is to destroy by fission MAs in appropriate nuclear reactors. To allow the MAs destruction an important effort have been done on the nuclear data due to the poor knowledge in this field. In the framework of one of the NEA Expert Group on Integral Experiments for Minor Actinide Management an analysis of the feasibility of MAs irradiation campaign in the TAPIRO fast research reactor is carried out. This paper provides preliminary results obtained by calculations modelling the irradiation, in different TAPIRO irradiation channels, of some CEA samples coming from the French experimental campaign OSMOSE, loaded with different contents of MAs, in order to access, through particular peak spectrometry, to their capture cross section. On the basis of neutron transport calculation results, obtained by both deterministic and Monte Carlo methods, an estimate of the irradiated samples counting levels from the AOSTA (Activation of OSMOSE Samples in TAPIRO experimental campaign is provided.

  2. Coordinated Science Campaign Scheduling for Sensor Webs

    Science.gov (United States)

    Edgington, Will; Morris, Robert; Dungan, Jennifer; Williams, Jenny; Carlson, Jean; Fleming, Damian; Wood, Terri; Yorke-Smith, Neil

    2005-01-01

    Future Earth observing missions will study different aspects and interacting pieces of the Earth's eco-system. Scientists are designing increasingly complex, interdisciplinary campaigns to exploit the diverse capabilities of multiple Earth sensing assets. In addition, spacecraft platforms are being configured into clusters, trains, or other distributed organizations in order to improve either the quality or the coverage of observations. These simultaneous advances in the design of science campaigns and in the missions that will provide the sensing resources to support them offer new challenges in the coordination of data and operations that are not addressed by current practice. For example, the scheduling of scientific observations for satellites in low Earth orbit is currently conducted independently by each mission operations center. An absence of an information infrastructure to enable the scheduling of coordinated observations involving multiple sensors makes it difficult to execute campaigns involving multiple assets. This paper proposes a software architecture and describes a prototype system called DESOPS (Distributed Earth Science Observation Planning and Scheduling) that will address this deficiency.

  3. A national campaign to finance supported employment.

    Science.gov (United States)

    Hogan, Michael F; Drake, Robert E; Goldman, Howard H

    2014-06-01

    Medicaid is now the main payment source and financing mechanism for services for adults with serious mental illness. Services formerly paid with state mental health funds have been converted to Medicaid, lightening the burden on state budgets affected by recession and other factors. The change has allowed states to maintain community care and inpatient services (in general hospitals). Medicaid service benefits include clinic and inpatient care, case management, and some rehabilitation services. But using Medicaid to finance some high-priority services such as supported employment has proven difficult. Now critical changes in Medicaid under the Affordable Care Act allow states to amend their Medicaid State Plans to provide more flexible services to people with serious mental illness. Advocacy and support may be needed to encourage this step. A national campaign to finance supported employment would join various stakeholders in the field, including professional organizations, family and service user groups, and organizations representing service providers. The authors of this editorial pledge their energies to support this campaign. They present suggestions for a campaign, including building a coalition, goals and targets, and online resources.

  4. PERSON DEIXIS IN USA PRESIDENTIAL CAMPAIGN SPEECHES

    Directory of Open Access Journals (Sweden)

    Nanda Anggarani Putri

    2015-06-01

    Full Text Available This study investigates the use of person deixis in presidential campaign speeches. This study is important because the use of person deixis in political speeches has been proved by many studies to give significant effects to the audience. The study largely employs a descriptive qualitative method. However, it also employs a simple quantitative method in calculating the number of personal pronouns used in the speeches and their percentages. The data for the study were collected from the transcriptions of six presidential campaign speeches of Barack Obama and Mitt Romney during the campaign rally in various places across the United States of America in July, September, and November 2012. The results of this study show that the presidential candidates make the best use of pronouns as a way to promote themselves and to attack their opponents. The results also suggest that the use of pronouns in the speeches enables the candidates to construct positive identity and reality, which are favorable to them and make them appear more eligible for the position.

  5. Advertising Efficiency in Road Safety Prevention Campaigns

    Directory of Open Access Journals (Sweden)

    Julia Catalina Serrano Cordero

    2017-11-01

    Full Text Available This paper addresses the importance of the results evaluation processes in the education and road safety campaigns, although they have achieved remarkable progress in praxis, evidenced a lack of information as to the relevance and suitability of the tools of communication in prevention. The objective was to validate an education and road safety campaign implemented by the Municipal Transit and Transport Company of the city of Cuenca (Ecuador in 2014, for which qualitative and quantitative techniques were used, choosing a stratified probabilistic sample of 304 university students, (age: 15-39. The data collection instruments were: focus group, questionnaire and statistical records, interpreted through content analysis and descriptive statistics. The findings indicate that the most frequent perception about the causes of accidents is: alcohol consumption, speeding, cell phone use. Likewise, the campaign "Best to Prevent" obtained a level of generalized recognition, but it was the younger ones who received more influence of their content of communication. Results that corroborate that the methods of motivation and persuasion do affect the attitude changes, which influences the transformation towards a culture of road prevention.

  6. [The wallop of the El Condonazo campaign].

    Science.gov (United States)

    Ramirez, M M

    1993-01-01

    The success of the "El Condonazo" (big condom) campaign to promote condom use conducted by the Venezuelan family planning association PLAFAM exceeded all expectations. The basic objective was to offer information about condoms to the Venezuelan population. Over 500 volunteers aided the campaign, planning discussion meetings and distributing materials. On February 15, 1993, the day of the campaign, volunteers spread the message of the family planning and health protection offered by condoms throughout Caracas and surrounding areas. The impact on public opinion and the assistance provided by the mass media demonstrated receptivity to family planning and sexual and reproductive health messages. "El Condonazo" was more than just 1-day event; it demonstrated the possibilities of working together for common objectives. The most regrettable repercussion of the day was the heated opposition and criticism it attracted from a few influential persons. Family planning has been recognized as a basic human right. It allows couples to make decisions together, and recognizes conception as a marvelous and conscious act. The mythic-religious attitude that all children sent by God should be accepted implies servile and unconditional acceptance of any fate. The attitude that "food enough for 9 is food enough for 10" ignore the fact that many poor families have no food at all.

  7. 11 CFR 9004.4 - Use of payments; examples of qualified campaign expenses and non-qualified campaign expenses.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Use of payments; examples of qualified campaign expenses and non-qualified campaign expenses. 9004.4 Section 9004.4 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: GENERAL ELECTION FINANCING ENTITLEMENT OF ELIGIBLE CANDIDATES...

  8. Do vegetarian marketing campaigns promote a vegan diet?

    OpenAIRE

    James, Waters

    2015-01-01

    This paper examines whether vegetarian marketing campaigns promote a vegan diet. Our trivariate model of omnivorous, vegetarian, and vegan consumption is estimated using twenty years of UK data. For short-lived campaigns, we find no persistent effect, but observe a rise and fall in vegan numbers during adjustment. For long-running campaigns, we find that for every person who adopts a vegetarian diet in such a campaign, around 0.34 people adopt a vegan diet. In a campaign to market veganis...

  9. A general measles vaccination campaign in urban Guinea-Bissau

    DEFF Research Database (Denmark)

    Byberg, S.; Thysen, S. M.; Rodrigues, A.

    2017-01-01

    .15 (0.04–0.63)). Conclusions We found indications of strong beneficial non-specific effects of receiving measles vaccine during the 2012 campaign, especially for girls and children with previous routine measles vaccination. Measles vaccination campaigns may be an effective way of improving child......Background Measles vaccination campaigns targeting children aged 9–59 months are conducted every three years in Guinea-Bissau. Studies have demonstrated beneficial non-specific effects of measles vaccine. We compared mortality one year after the December 2012 measles vaccination campaign in Bissau...... city for children who received campaign measles vaccine with children who did not receive campaign measles vaccine. Methods Field workers from Bandim Health Project registered all children living in the Bandim Health Project's study area who received measles vaccination at the campaign posts. Children...

  10. A combined morphostructural/fluid migration model of Pisciarelli area (Campi Flegrei caldera - CFc) through structural and integrated Terrestrial Laser Scanner (TLS) and Electrical Resistivity Tomography (ERT) analysis.

    Science.gov (United States)

    Caputo, Teresa; Di Giuseppe, Maria Guilia; Troiano, Antonio; Somma, Renato; Isaia, Roberto; Vitale, Stefano; Troise, Claudia; De Natale, Giuseppe

    2014-05-01

    The Solfatara-Pisciarelli (S-P) area was characterized by an intense eruptive activity during the last 5 ka and is presently the highly distributed degassing zones inside the CFC, worldwide well-known for its bradyseismic phenomenon. The last two main crises occurred during the 1970-72 and 1982-84, associated with an overall 3.5 m of ground uplift and an elevate rate of low magnitude seismicity. A strong direct relationship has always been observed between the increase of hydrothermal activity in the S-P area and ground uplift of the CFc. More recently starting from the 2005 a new gradual increase of the hydrothermal activity and ground uplift has been observed, with a steep growth of these effects from 2012, accompanied by seismic events with highest magnitude of 1.8. The Pisciarelli area has been the site of a significant morphological changes of its hydrothermal field including new fumarolic vents and a wide enlargement of a mud pool. Monitoring either landscape deformation than fluids migration of the S-P activity can be considered a good indicator of the volcanic dynamics taking place in the whole CFc caldera. This study shows a first attempt to integrate multidisciplinary approach including volcanological and structural field surveys and studies such us TLS and ERT signals applied to this highly dynamic areas. A detailed geo-structural survey allow us to characterize the complex pattern of fractures and faults recorded in the volcanic rocks in different times of the polyphasic CFc volcanic history. In order to statistically record data about fault and fracture (i) attitudes and (ii) spacing, the scan line method was applied. The whole planar structure is the locus of the well-known fumaroles and mud pools of Pisciarelli. A first time detailed Digital Terrestrial Model DTM of the area with an accuracy of 5cm obtained through TLS has been integrated combining the ERT of the lower part of the area, characterized by a widespread fumarolic activity and soil

  11. Efficacy and safety of inhaled budesonide delivered once or twice daily via HFA-134a in mild to moderate persistent asthma in adult patients. Comparison with budesonide CFC.

    Science.gov (United States)

    Vastagh, E; Kuna, P; Calistruc, P; Bogdan, M A

    2003-11-01

    This study was undertaken to investigate whether budesonide 4001 microg twice daily (Chiesi Farmaceutici S.p.A.) given with the HFA-134a propellant is equivalent in efficacy and safety to the same dose regimen delivered with the marketed CFC product in adult asthmatics with mild to moderate persistent asthma; the effects of budesonide HFA 800 microg once daily were also studied. After a 2-week run-in, a total number of 98, 103 and 97 patients were assigned to the 12-week treatment with budesonide given with HFA or CFC twice daily (morning and evening), or HFA once daily (morning), respectively. The main outcome variable morning PEFR, as well as evening PEFR and clinical symptoms (day-time and night-time asthma attacks, number of asthma-induced night-time awakenings and overall symptoms' scores) were measured daily by patients. Other standard pulmonary function testing were measured at clinic visits. A blood sample for morning serum dosing (8.00-10.00 AM) was taken at baseline and at endpoint. Adverse events and vital signs were also recorded. Significant improvements at endpoint in morning and evening PEFR, as well as in clinic PEFR and MEF50, were observed in both the twice daily groups only. An exact proof of equivalence between HFA and CFC given twice daily was demonstrated for the primary parameters, morning PEFR (equivalence pre-defined limits were +/- 40.27 l/min, difference between means = 4.0 l/min and 95% CI -6.9-14.9) and secondary parameters as evening PEFR: (limits +/- 40.19 l/min, difference between means = 2.1 l/min and 95% Confidence interval (CI) -9.4-13.5) and FEV1 (limits +/- 0.27 l, difference between means = 0.0 l and 95% CI -0.11-0.10). Less evident (but within limits) proofs of equivalence were shown in the comparisons with the once daily group. No substantial differences between the three groups were observed for the other efficacy variables, including symptoms and use of rescue salbutamol, which significantly improved over the run-in values

  12. Utilizing Tritium and CFC-12 to Determine Groundwater Sources in an Unconfined Aquifer Within the Abalone Cove Landslide, Palos Verdes, California

    Science.gov (United States)

    Difilippo, E. L.; Hammond, D. E.; Douglas, R.; Clark, J. F.; Avisar, D.; Dunker, R.

    2004-12-01

    The Abalone Cove landslide occupies 80 acres of an ancient landslide complex on the Palos Verdes peninsula, and was re-activated in 1979. The uphill portion of the ancient landslide complex has remained stable in historic times. Water infiltration into the slide is a short term catalyst for mass movement in the area, so it is important to determine the sources of groundwater throughout the slide mass. Water may enter the slide mass through direct percolation of recent precipitation, inflow along the head scarp of the ancient landslide or by rising through the slide plane from a deeper aquifer. The objective of this contribution is to use geochemical tracers (tritium and CFC-12) in combination with numerical modeling to constrain the importance of each of these sources. Numerical models were constructed to predict geochemical tracer concentrations throughout the basin, assuming that the only source of water to the slide mass is percolation of recent precipitation. Predicted concentrations were then compared to measured tracer values. In the ancient landslide, predicted and measured tracer concentrations are in good agreement, indicating that most of the water in this area is recent precipitation falling within the basin. Groundwater recharged uphill of the ancient landslide contributes minor flow into the complex through the head scarp, with the majority of this water flowing beneath the ancient slide plane. However, predicted tracer concentrations in the toe of the Abalone Cove landslide are not consistent with measured values. Both CFC-12 and tritium concentrations indicate that water is older than predicted and communication between the slide mass and the aquifer beneath the slide plane must occur in this area. Infiltration of this deep circulating water may exert upward hydraulic pressure on the landslide slip surface, increasing the potential for movement. This hypothesis is consistent with the observation that current movement is only occurring in the area in

  13. Testing the Validity of Campaign Ad Exposure Measures: A Family Planning Media Campaign in Pakistan.

    Science.gov (United States)

    Beaudoin, Christopher E; Stephenson, Michael T; Agha, Sohail

    2016-07-01

    Although prior research has tested the nomological validity of media campaign exposure, including the related comparative validity of some measures, it has not well studied predictive validity or made extensions to other types of media campaign exposure. To help build on research in this area, the current study tested the nomological and predictive validity of 5 ad recall and recognition measures specific to the Touch condom media campaign in Pakistan. Between-effects regression of panel survey data confirmed the nomological validity of each of the 5 measures of Touch ad exposure. In addition, 2 sets of panel regression models (i.e., fixed-effects models and fixed-effects with lag models) confirmed the predictive validity of each of the 5 ad exposure measures. Results on comparative validity were quite similar for nomological and predictive validity, indicating that confirmed ad recall and recognition measures tend to have greater validity than unconfirmed measures.

  14. The Effect of Campaign-Generated Interpersonal Communication on Campaign-Targeted Health Outcomes: A Meta-Analysis.

    Science.gov (United States)

    Jeong, Michelle; Bae, Rosie Eungyuhl

    2017-06-16

    This study examined the effect of mass media campaign-generated conversations on campaign-targeted health outcomes, via a systematic meta-analysis of 28 studies (including 124 sub-studies and a total of 138,898 participants). The study also conducted a series of moderation analyses to examine the conditions under which interpersonal communication has larger effects on bringing about the desired outcomes. The findings of this meta-analysis indicate that campaign-generated conversations have a positive effect on inducing campaign-targeted outcomes (OR = 1.28) and show that this effect is moderated by health topic addressed by the campaign, the type of outcome being targeted by the campaign, and with whom people converse, along with several other campaign-relevant and study-relevant variables. The implications of these findings for future research are discussed.

  15. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  16. Forecasting for a Lagrangian aircraft campaign

    Directory of Open Access Journals (Sweden)

    A. Stohl

    2004-01-01

    Full Text Available A forecast system has been developed in preparation for an upcoming aircraft measurement campaign, where the same air parcels polluted by emissions over North America shall be sampled repeatedly as they leave the continent, during transport over the Atlantic, and upon their arrival over Europe. This paper describes the model system in advance of the campaign, in order to make the flight planners familiar with the novel model output. The aim of a Lagrangian strategy is to infer changes in the chemical composition and aerosol distribution occurring en route by measured upwind/downwind differences. However, guiding aircraft repeatedly into the same polluted air parcels requires careful forecasting, for which no suitable model system exists to date. This paper describes a procedure using both Eulerian-type (i.e. concentration fields and Lagrangian-type (i.e. trajectories model output from the Lagrangian particle dispersion model FLEXPART to predict the best opportunities for a Lagrangian experiment. The best opportunities are defined as being highly polluted air parcels which receive little or no emission input after the first measurement, which experience relatively little mixing, and which are reachable by as many aircraft as possible. For validation the system was applied to the period of the NARE 97 campaign where approximately the same air masses were sampled on different flights. Measured upwind/downwind differences in carbon monoxide (CO and ozone (O3 decreased significantly as the threshold values used for accepting cases as Lagrangian were tightened. This proves that the model system can successfully identify Lagrangian opportunities.

  17. Social marketing campaigns and children's media use.

    Science.gov (United States)

    Evans, W Douglas

    2008-01-01

    Media-related commercial marketing aimed at promoting the purchase of products and services by children, and by adults for children, is ubiquitous and has been associated with negative health consequences such as poor nutrition and physical inactivity. But, as Douglas Evans points out, not all marketing in the electronic media is confined to the sale of products. Increasingly savvy social marketers have begun to make extensive use of the same techniques and strategies used by commercial marketers to promote healthful behaviors and to counter some of the negative effects of conventional media marketing to children and adolescents. Evans points out that social marketing campaigns have been effective in helping to prevent and control tobacco use, increase physical activity, improve nutrition, and promote condom use, as well as other positive health behaviors. He reviews the evidence from a number of major recent campaigns and programming in the United States and overseas and describes the evaluation and research methods used to determine their effectiveness. He begins his review of the field of social marketing by describing how it uses many of the strategies practiced so successfully in commercial marketing. He notes the recent development of public health brands and the use of branding as a health promotion strategy. He then goes on to show how social marketing can promote healthful behavior, how it can counter media messages about unhealthful behavior, and how it can encourage discussions between parents and children. Evans concludes by noting some potential future applications to promote healthful media use by children and adolescents and to mitigate the effects of exposure to commercial marketing. These include adapting lessons learned from previous successful campaigns, such as delivering branded messages that promote healthful alternative behaviors. Evans also outlines a message strategy to promote "smart media use" to parents, children, and adolescents and

  18. Advanced Fuels Campaign FY 2015 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Braase, Lori Ann [Idaho National Lab. (INL), Idaho Falls, ID (United States); Carmack, William Jonathan [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-10-29

    The mission of the Advanced Fuels Campaign (AFC) is to perform research, development, and demonstration (RD&D) activities for advanced fuel forms (including cladding) to enhance the performance and safety of the nation’s current and future reactors; enhance proliferation resistance of nuclear fuel; effectively utilize nuclear energy resources; and address the longer-term waste management challenges. This report is a compilation of technical accomplishment summaries for FY-15. Emphasis is on advanced accident-tolerant LWR fuel systems, advanced transmutation fuels technologies, and capability development.

  19. Advanced Fuels Campaign Cladding & Coatings Meeting Summary

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2013-03-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) organized a Cladding and Coatings operational meeting February 12-13, 2013, at Oak Ridge National Laboratory (ORNL). Representatives from the U.S. Department of Energy (DOE), national laboratories, industry, and universities attended the two-day meeting. The purpose of the meeting was to discuss advanced cladding and cladding coating research and development (R&D); review experimental testing capabilities for assessing accident tolerant fuels; and review industry/university plans and experience in light water reactor (LWR) cladding and coating R&D.

  20. Ignition tuning for the National Ignition Campaign

    Directory of Open Access Journals (Sweden)

    Landen O.

    2013-11-01

    Full Text Available The overall goal of the indirect-drive inertial confinement fusion [1] tuning campaigns [2] is to maximize the probability of ignition by experimentally correcting for likely residual uncertainties in the implosion and hohlraum physics [3] used in our radiation-hydrodynamic computational models, and by checking for and resolving unexpected shot-to-shot variability in performance [4]. This has been started successfully using a variety of surrogate capsules that set key laser, hohlraum and capsule parameters to maximize ignition capsule implosion velocity, while minimizing fuel adiabat, core shape asymmetry and ablator-fuel mix.

  1. The Irish national stroke awareness campaign: a stroke of success?

    Science.gov (United States)

    Hartigan, Irene; O'Connell, Elizabeth; O'Brien, Sinéad; Weathers, Elizabeth; Cornally, Nicola; Kilonzo, Brid; McCarthy, Geraldine

    2014-11-01

    Mass media campaigns are widely used to expose large populations to health-risk behaviour messages through routine uses of media. The Act F.A.S.T stroke campaign, which highlights the symptoms of stroke, has been endorsed globally. The aim of this study was to identify the influence of the campaign on the general public in Ireland. Descriptive pre and post comparative study design was conducted. Phase one was conducted in April 2010 prior to the campaign. Data were collected on a cross-section of the public (n=1925) to obtain baseline information on stroke warning signs. Phase two involved collecting data from participants (n=688) 18 months after the campaign launch. The majority of participants from both phases were between 30 and 50 years of age. Results from phase two reported that 93% heard or saw the campaign yet only 37% could recall the campaign name or the slogan. Post the campaign over 80% recognized the warning signs of stroke. The increase in symptom recognition is evident from pre campaign to post campaign with an increase in knowledge across all the stroke symptoms. Post the campaign there was an increase of 54% of who stated that they would go straight to hospital for stroke symptoms. Findings suggest the campaign was well executed given the high percentage of participants recall and the increase in the recognition of stroke symptoms. However, the influence of the campaign in changing behaviour was not as evident. Further research is needed to examine factors that influence behaviour when a stroke strikes. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. A pilot study to assess lung deposition of HFA-beclomethasone and CFC-beclomethasone from a pressurized metered dose inhaler with and without add-on spacers and using varying breathhold times.

    Science.gov (United States)

    Leach, Chet L; Colice, Gene L

    2010-12-01

    The study objective of this pilot study was to determine the lung delivery of HFA-134a-beclomethasone dipropionate (HFA-BDP; QVAR™) and CFC-beclomethasone dipropionate (CFC-BDP; Becloforte™) with and without the add-on spacers, Aerochamber™, and Volumatic™. The smaller particles of HFA-BDP were presumed to produce greater lung deposition using spacers, with and without a delay [i.e., metered dose inhaler (MDI) actuation into the spacer and subsequent inhalation 0 and 2 sec later], compared with the larger particles of CFC-BDP. The study included a comparison of breathhold effects (i.e., 1 and 10-sec breatholds) on lung deposition. The study was an open-label design and utilized healthy subjects (n = 12 males). Each arm of the study contained three subjects; thus, outcomes were not powered to assess statistical significance. HFA-BDP and CFC-BDP were radiolabeled with technetium-99m and delivered to subjects. Results showed that the small particle HFA-BDP lung deposition averaged 52% and was not affected by the use of Aerochamber with or without a spacer delay. The oropharyngeal deposition of HFA-BDP was reduced from approximately 28% to 4% with the Aerochamber. Lung deposition with the large particle CFC-BDP was 3-7% and generally decreased with Aerochamber or Volumatic. A 2-sec time delay between actuation and breath plus the spacer reduced lung deposition slightly but reduced oropharygeal deposition substantially (84% down to 3-20%) using the Aerochamber or Volumatic with and without a spacer delay. HFA-BDP lung deposition was dependent on the breathhold. Lung deposition with HFA-BDP was reduced by 16% with a 1-sec versus 10-sec breathhold. The difference was measured in the increased exhaled fraction, confirming that smaller particles need time to deposit and are exhaled if there is a reduced breathhold. The large particle CFC-BDP lung deposition was not affected by breathhold. The use of Aerochamber or Volumatic spacers with HFA-BDP did not alter lung

  3. Second-rate election campaigning? An analysis of campaign styles in European parliamentary elections

    NARCIS (Netherlands)

    de Vreese, C.H.

    2009-01-01

    The literature on professionalization of political campaigns is strongly biased toward first-order (national) elections and the U.S. and U.K. contexts. This study expands that scope. Based on a survey of candidates for the 2004 European elections in eight European Union countries, we tested whether

  4. Fear appeals and confronting information campaigns. [Previously: Fear-based information campaigns.

    NARCIS (Netherlands)

    2007-01-01

    Fear appeals or confronting information campaigns confront people in an often hard and sometimes even shocking way with the consequences of risky behaviour. This can have a positive impact on the attitudes and behavioural intentions of the target group, but only if key conditions are met. Those

  5. Post-campaign information from the Infirmary

    CERN Multimedia

    2015-01-01

    The Medical Service’s “TAKE YOUR BLOOD PRESSURE TO HEART” campaign, which ran from 24 to 27 March 2015 (see here), was a resounding success.   In total, 274 people visited the nurses at their pop-up clinics (in Building 40, Restaurants 2 and 3 and the Main Building) or at the Infirmary (Building 57). Each of them had their blood pressure measured and received information and advice about high blood pressure, its contributory factors and ways to control it. They were also offered various leaflets about this public health issue. We would like to draw attention to the fact that 21% of the participants were found to have abnormally high blood-pressure and, crucially, 72% of these had been unaware of the problem. Another point to note is that a significant proportion (16%) of the younger people tested (aged 18 to 30) had abnormal results. The results of this campaign demonstrate the importance of early screening, but also the high level of interest among the pers...

  6. Public health campaigns and obesity - a critique

    Directory of Open Access Journals (Sweden)

    Proietto Joseph

    2011-02-01

    Full Text Available Abstract Background Controlling obesity has become one of the highest priorities for public health practitioners in developed countries. In the absence of safe, effective and widely accessible high-risk approaches (e.g. drugs and surgery attention has focussed on community-based approaches and social marketing campaigns as the most appropriate form of intervention. However there is limited evidence in support of substantial effectiveness of such interventions. Discussion To date there is little evidence that community-based interventions and social marketing campaigns specifically targeting obesity provide substantial or lasting benefit. Concerns have been raised about potential negative effects created by a focus of these interventions on body shape and size, and of the associated media targeting of obesity. Summary A more appropriate strategy would be to enact high-level policy and legislative changes to alter the obesogenic environments in which we live by providing incentives for healthy eating and increased levels of physical activity. Research is also needed to improve treatments available for individuals already obese.

  7. Mass measles rubella immunization campaign: Bhutan experience

    Directory of Open Access Journals (Sweden)

    Bhakta R Giri

    2011-01-01

    Full Text Available Background: Bhutan has attained universal child immunization since 1991. Since then, immunization coverage is maintained at high level through routine immunization, periodic National Immunization Days, and mop up campaigns. Despite high immunization coverage, every year, significant numbers of clinically suspected measles cases were reported. Objective: To assess the cause of continuing high "suspected measles cases" and take appropriate public health measures. Materials and Methods: Febrile rash outbreaks occurred in several districts in 2003. These episodes were investigated. Simultaneously, a retrospective data search revealed evidence of congenital rubella syndrome (CRS in the country. Results: Thirty five percent of the tested samples were positive for rubella but none for measles. There were evidences of the presence of CRS. This was discussed in the annual health conference 2004, amongst health policy makers and district heads who recommended that a possibility of inclusion of rubella as an antigen be looked into. A nationwide measles and rubella immunization campaign was conducted in 2006 followed by introduction of rubella vaccine in the immunization schedule. Conclusion: Febrile rash can be caused by a host of viral infections. Following universal measles immunization, it is pertinent that febrile rash be looked in the light of rubella infections. Following the introduction of rubella vaccination in the national immunization schedule, there has been significant reduction of febrile rash episodes, cases of rubella, and congenital rubella syndrome.

  8. Towards Sustainability in Viral Marketing with User Engaging Supporting Campaigns

    Directory of Open Access Journals (Sweden)

    Jarosław Jankowski

    2017-12-01

    Full Text Available While viral marketing has captured substantial academic and professional interest, the processes that underpin successful viral marketing campaigns remain poorly understood. High competition and pressure for successful campaigns lead to strategies based on persuasion, unsolicited messages, and other techniques that negatively affect brand perception. The need for more sustainable strategies with a limited negative impact on web users is observed. Therefore, the current study examines the effectiveness of viral marketing and a supporting campaign, where the main goal was to increase user engagement and overall campaign performance. Supporting campaigns were evaluated, to determine whether they enhanced viral activity, but without the need for high persuasion or intrusive techniques. Results showed that supporting actions could be integrated with lower performing campaigns to increase their effectiveness. Apart from the main scientific goal that is presented, the study demonstrates how virtual worlds can provide a laboratory-like environment for identifying the processes that underpin viral marketing.

  9. 29 CFR 452.111 - Campaigning in polling places.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Campaigning in polling places. 452.111 Section 452.111... places. There must not be any campaigning within a polling place 54 and a union may forbid any campaigning within a specified distance of a polling place. 54 See Hodgson v. UMW, 344 F.Supp. 17 (D.D.C. 1972). ...

  10. Use of Deixis in Donald Trump?s Campaign Speech

    OpenAIRE

    Hanim, Saidatul

    2017-01-01

    The aims of this study are (1) to find out the types of deixis in Donald Trump?s campaign speech, (2) to find out the reasons for the use of dominant type of deixis in Donald Trump?s campaign speech and (3) to find out whether or not the deixis is used appropriately in Donald Trump?s campaign speech. This research is conducted by using qualitative content analysis. The data of the study are the utterances from the script Donald Trump?s campaign speech. The data are analyzed by using Levinson ...

  11. Visualizing Risk: Images, Risk and Fear in a Health Campaign.

    Science.gov (United States)

    Kuperavage, Jessica

    2017-06-01

    This essay considers the structure of risk in health campaign formation and design by examining an early 20th century federal campaign to reduce infant mortality. Health campaigns navigate the gap between study and practice, translating quantitative findings into prescriptive responses for individual consumers of the text. By focusing specifically on the visual rhetoric of risk, this campaign serves as a case study to examine how the public was taught to see and understand risk and preventive health at a critical point in the development of public health in the United States.

  12. Action of granulopoiesis-stimulating cytokines rhG-CSF, rhGM-CSF, and rmGM-CSF on murine haematopoietic progenitor cells for granulocytes and macrophages (GM-CFC).

    Science.gov (United States)

    Hofer, M; Vacek, A; Weiterová, L

    2005-01-01

    The aim of this study was to provide new data to the knowledge of mechanisms by which recombinant human granulocyte colony-stimulating factor (rhG-CSF), recombinant human granulocyte-macrophage colony-stimulating factor (rhGM-CSF) and recombinant murine granulocyte-macrophage colony-stimulating factor (rmGM-CSF) enhance the numbers of colonies growing from hematopoietic progenitor cells for granulocytes and macrophages (GM-CFC) in the murine bone marrow. The in vitro technique for cultivating GM-CFC from normal bone marrow cells was used. For evaluation of stimulatory actions of the drugs studied, the factors themselves or sera of mice given these factors were added to the cultures. The factors or the sera were present in the cultures either as the only potentially stimulatory agents or acted jointly with a suboptimum concentration of recombinant murine interleukin-3 (rmIL-3). It was found that both rhG-CSF and rmGM-CSF stimulate the proliferation of GM-CFC by a combination of direct mechanisms (direct actions on the target cells) and indirect effects (effects mediated through the induction of other cytokines and/or growth factors in the murine organism). The rhGM-CSF exhibited somewhat weaker in vitro effects in comparison with the other two factors and only indirect effects were noted. Additional in vivo experiments documented that, in spite of differences in mechanisms of action of the individual drugs studied on murine bone marrow cells in vitro, equal in vivo doses of the factors induce quantitatively similar effects on the production of GM-CFC in vivo.

  13. Advanced Fuels Campaign FY 2011 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2011-11-01

    One of the major research and development (R&D) areas under the Fuel Cycle Research and Development (FCRD) program is advanced fuels development. The Advanced Fuels Campaign (AFC) has the responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. Accomplishments made during fiscal year (FY 20) 2011 are highlighted in this report, which focuses on completed work and results. The process details leading up to the results are not included; however, the technical contact is provided for each section. The order of the accomplishments in this report is consistent with the AFC work breakdown structure (WBS).

  14. Strategies for reward-based crowdfunding campaigns

    DEFF Research Database (Denmark)

    Kraus, Sascha; Richter, Christian; Brem, Alexander

    2016-01-01

    Crowdfunding represents an alternative way of funding entrepreneurial ventures – and is attracting a high amount of interest in research as well as practice. Against this back- ground, this paper analyzes reward-based crowdfunding campaign strategies and their communication tools. To do this, 446....... The terms communicator, networker and self-runner are created for this crowdfunding strategy and filled with practi- cal examples. This paper contributes to the literature in different ways: first, it sheds more light on the developing concept of crowdfunding, with an overview of current academic dis...... crowdfunding projects were gathered and empirically analyzed. Three different paths of successful crowdfunding projects could be identified and are described in detail. Practical implications of crowdfunding strategies are derived, and are dependent on the required sales effort and the project added value...

  15. Fit for purpose: Australia's National Fitness Campaign.

    Science.gov (United States)

    Collins, Julie A; Lekkas, Peter

    2011-12-19

    During a time of war, the federal government passed the National Fitness Act 1941 to improve the fitness of the youth of Australia and better prepare them for roles in the armed services and industry. Implementation of the National Fitness Act made federal funds available at a local level through state-based national fitness councils, which coordinated promotional campaigns, programs, education and infrastructure for physical fitness, with volunteers undertaking most of the work. Specifically focused on children and youth, national fitness councils supported the provision of children's playgrounds, youth clubs and school camping programs, as well as the development of physical education in schools and its teaching and research in universities. By the time the Act was repealed in 1994, fitness had become associated with leisure and recreation rather than being seen as equipping people for everyday life and work. The emergence of the Australian National Preventive Health Agency Act 2010 offers the opportunity to reflect on synergies with its historic precedent.

  16. Mesospheric dust observations during the MAXIDUSTY campaign

    Science.gov (United States)

    Antonsen, Tarjei; Havnes, Ove; Fredriksen, Åshild; Friedrich, Martin; Sternovsky, Zoltan; Plane, John; Hartquist, Tom; Olsen, Sveinung; Eilertsen, Yngve; Trondsen, Espen; Mann, Ingrid; Hedin, Jonas; Gumbel, Jörg; Moen, Jøran; Latteck, Ralph; Baumgarten, Gerd; Höffner, Josef; Williams, Bifford; Hoppe, Ulf-Peter; Karlberg, Jan-Ove

    2017-04-01

    The MAXIDUSTY rocket payloads, launched from Andøya June 30 and July 8 2016, were equipped with dust impact detectors aiming to characterize mesospheric dust charge state, mass distribution of impact fragments and NLC/PMSE structure. One of the main scientific objectives for the campaign was to confirm that material of meteoric origin is abundant inside the icy mesospheric dust particles. The rockets were launched simultaneously with PMSE and NLC (MAXIDUSTY-1) and PMSE (MAXIDUSTY-1B) respectively, and radar measurements were made coincident with the rocket flight path. We report here on the initial results from the rocket probes and remote soundings, with emphasis on the dust impact detector results. Results from the Multiple Dust Detector (MUDD) confirm that NLC ice particles probably have a relatively high content of meteoric smoke particles with a filling factor of up to several percent. Comparisons of the DUSTY faraday bucket and PMSE show that there is no simple correlation between the two.

  17. [Pathology in social media networks. Recruitment campaign].

    Science.gov (United States)

    Alcaraz Mateos, Eduardo; Guerra Pastrián, Laura; Pijuan Andújar, Lara; López Solache, Laura; Zucchiatti, Adriana; García Ángel, Rubén; Prieto Cuadra, Juan Daniel; Labiano Miravalles, Tania; Carvalho, Rita; Gardner, Jerad M; Terrádez, Cristina; de Álava, Enrique

    Pathology is a speciality that is often poorly understood, not only by the general public, but also by clinicians. However, the recent widespread use of social media provides an opportunity to increase the visibility and comprehension of our profession. A working group was formed to carry out this task. The members of the Spanish Society of Pathology were contacted through its Communication and Social Projection Subcommittee to engage in the campaign #IWantYouForSEAP, to form a network on Twitter. The recruitment period was one month (August, 2016). The resulting project, developed during the XXVIII Congress of the SEAP-IAP, was registered using the analytical tools Symplur and Tweet Binder. 32 applications (29 pathologists, 2 histotechnicians, 1 administrative personnel) were received from all over Spain, including participants from 14 of the 17 Autonomous Regions, from 22 cities and 25 medical centres. The activity in relation to the hashtag #SEAP2017V used in the congress included 685 participants with 6704 tweets and 8,837,435 impressions. 28 of the 32 recruited by the #IWantYouForSEAP campaign participated, contributing with 2410 tweets, and generating 2,090,423 impressions (36% and 24% of the total, respectively). It is possible to promote and motivate teamwork within our discipline through social media networks. This preliminary experience of the use of social media networks in our scientific community has had encouraging results which have raised high expectations among participants. An appropriate use of social media networks could help to narrow the gap between pathologists and society. Copyright © 2017 Sociedad Española de Anatomía Patológica. Publicado por Elsevier España, S.L.U. All rights reserved.

  18. Campaigning for Organ Donation at Mosques.

    Science.gov (United States)

    Rady, Mohamed Y; Verheijde, Joseph L

    2016-09-01

    There is a trend of recruiting faith leaders at mosques to overcome religious barriers to organ donation, and to increase donor registration among Muslims. Commentators have suggested that Muslims are not given enough information about organ donation in religious sermons or lectures delivered at mosques. Corrective actions have been recommended, such as funding campaigns to promote organ donation, and increasing the availability of organ donation information at mosques. These actions are recommended despite published literature expressing safety concerns (i.e., do no harm) in living and end-of-life organ donation. Living donors require life-long medical follow-up and treatment for complications that can appear years later. Scientific and medical controversies persist regarding the international guidelines for death determination in end-of-life donation. The medical criteria of death lack validation and can harm donors if surgical procurement is performed without general anesthesia and before biological death. In the moral code of Islam, the prevention of harm holds precedence over beneficence. Moral precepts described in the Quran encourage Muslims to be beneficent, but also to seek knowledge prior to making practical decisions. However, the Quran also contains passages that demand honesty and truthfulness when providing information to those who are seeking knowledge. Currently, information is limited to that which encourages donor registration. Campaigning for organ donation to congregations in mosques should adhere to the moral code of complete, rather than selective, disclosure of information. We recommend as a minimal standard the disclosure of risks, uncertainties, and controversies associated with the organ donation process.

  19. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (< 1 year). In both cases MRTs of 13 - 17 years, calculated

  20. The Montenegrin-Albanian Campaign in 1916: The Last Successful Unilateral Campaign of Austria-Hungary

    Science.gov (United States)

    2015-06-12

    Montenegrin-Albanian campaign were capturing the Serbians and securing the borders of the Dual Monarchy . Austria-Hungary had chosen to launch a...idea of the Dual Alliance. The German leadership handled the Dual Monarchy more and more as a junior partner. The Austro-Hungarian pride, of course...reliable ally was the Dual Monarchy . Naturally every person handled this situation differently, but Erich von Falkenhayn was the Chief of General Staff in

  1. Mediacampaign: A Multimodal Semantic Analysis System for Advertisement Campaign Detection

    NARCIS (Netherlands)

    Rehatschek, Herwig; Sorschag, Robert; Rettenbacher, Bernhard; Zeiner, Herwig; Nioche, Julien; de Jong, Franciska M.G.; Ordelman, Roeland J.F.; van Leeuwen, David A.

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project’s main goal is to automate to a large degree the detection and tracking of advertisement

  2. Mediacampaign - A multimodal semantic analysis system for advertisement campaign detection

    NARCIS (Netherlands)

    Rehatschek, H.; Sorschag, R.; Rettenbacher, B.; Zeiner, H.; Nioche, J.; Jong, F. de; Ordelmann, R.; Leeuwen, D. van

    2008-01-01

    MediaCampaign's scope is on discovering and inter-relating advertisements and campaigns, i.e. to relate advertisements semantically belonging together, across different countries and different media. The project's main goal is to automate to a large degree the detection and tracking of advertisement

  3. Getting the message across: perceived effectiveness of political campaign communication

    NARCIS (Netherlands)

    van Spanje, J.; Boomgaarden, H.G.; Elenbaas, M.; Vliegenthart, R.; Azrout, R.; Schuck, A.R.T.; de Vreese, C.H.

    2013-01-01

    Do political actors communicate effectively during electoral campaigns? We introduce a novel concept in electoral research, the "perceived effectiveness of political parties' election campaigns." This evaluation concentrates on the extent to which a party is seen as getting its message across to the

  4. An evaluation of the national measles vaccination campaign in the ...

    African Journals Online (AJOL)

    1991-04-20

    Apr 20, 1991 ... vaccination campaign in the new shanty areas. ofKhayelitsha. ' D. J. BERRY, D. YACH, M. H. J. ... attention at a national level but the national measles vaccination campaign implemented in 1990 represents a ..... The first question has been the subject of much debate. There is little doubt from the results of ...

  5. Statewide Implementation of the 1% or Less Campaign

    Science.gov (United States)

    Maddock, Jay; Maglione, Christine; Barnett, Jodi D.; Cabot, Cynthia; Jackson, Susan; Reger-Nash, Bill

    2007-01-01

    The 1% or Less Campaign is an effective research-tested program for reducing saturated fat intake by encouraging individuals to switch to low-fat milk. All published studies have been conducted in small communities with mostly White populations. The 6-week intervention included a media campaign, public relations, and taste tests. Campaign…

  6. Teaching PR Campaigns: The Current State of the Art.

    Science.gov (United States)

    Benigni, Vincent L.; Cameron, Glen T.

    1999-01-01

    Reports results from a national survey regarding courses on public-relations campaigns. Examines predominant pedagogical strategies and course-management text techniques used; intentions for the course; theory/research elements; the role of management skill and/or interpersonal dynamics in the student campaign both internally and externally, and…

  7. Impact of a Rural Domestic Violence Prevention Campaign.

    Science.gov (United States)

    Gadomski, Anne M.; Tripp, Maria; Wolff, Debra A.; Lewis, Carol; Jenkins, Paul

    2001-01-01

    A 7-month public health information campaign used radio advertising, mass media articles, mailings, and posters to address attitudes and behavioral intentions toward domestic violence in a rural county. The campaign raised public awareness, particularly among men; increased stated intentions to intervene in a neighbor's domestic violence; and…

  8. Challenges to the Siyafunda Literacy Campaign in Richmond | Land ...

    African Journals Online (AJOL)

    Concepts of literacy campaigns provide the context for a description and evaluation of the Siyafunda Literacy Campaign in the town of Richmond, KwaZulu-Natal. Recent political events in the region are noted. The leadership provided by the mayor, the need for the involvement of community members and features of the ...

  9. Mass-media publicity campaign on driving while intoxicated.

    NARCIS (Netherlands)

    Wesemann, P.

    1986-01-01

    Mass media publicity campaigns against driving while intoxicated have been conducted in the netherlands for a number of years. A new, more aggressive approach was introduced in 1984 with the slogan "alcohol ..... all too easily a crime". Goals of this campaign were (1) internationalization of the

  10. Unsustainability of a measles immunisation campaign - rise in ...

    African Journals Online (AJOL)

    The 1990 national mass measles immunisation campaign resulted in a marked reduction in measles incidence in Natal/KwaZulu in the first 6 months after the campaign. Data from the measles ward admissions book at Clairwood Hospital were collated for the period 1 January 1989 to 31 May 1992 to assess the ...

  11. 45 CFR 1370.5 - Public information campaign grants.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Public information campaign grants. 1370.5 Section 1370.5 Public Welfare Regulations Relating to Public Welfare (Continued) OFFICE OF HUMAN DEVELOPMENT... VIOLENCE PREVENTION AND SERVICES PROGRAMS § 1370.5 Public information campaign grants. Each grantee awarded...

  12. Evaluating the ParticipACTION "Think Again" Campaign

    Science.gov (United States)

    Gainforth, Heather L.; Jarvis, Jocelyn W.; Berry, Tanya R.; Chulak-Bozzer, Tala; Deshpande, Sameer; Faulkner, Guy; Rhodes, Ryan E.; Spence, John C.; Tremblay, Mark S.; Latimer-Cheung, Amy E.

    2016-01-01

    Introduction: ParticipACTION's 2011 "Think Again" campaign aimed to draw parents', and specifically mothers', attention to the amount of physical activity (PA) their children do relative to the national guidelines (physical activity guidelines [PAG]). Purpose: To evaluate ParticipACTION's "Think Again" campaign in the context…

  13. An evaluation of the 2012 measles mass vaccination campaign in ...

    African Journals Online (AJOL)

    Introduction: To estimate the post-campaign level of measles vaccination coverage in Guinea. Method: Interview of parents and observation of measles vaccination cards of children aged 9 to 59 months during the mass measles campaign. A nationwide cluster randomized sample under health District stratification. Results: ...

  14. The pragmatics of NPP presidential campaign promises in Ghana's ...

    African Journals Online (AJOL)

    The paper discusses election campaign promises under Commissives, an aspect of Speech Act Theory, and Political Discourse Analysis (PDA). It considers the importance of context and looks at the social settings that are connected with promises. It examines the semantics, pragmatics and the structure of campaign ...

  15. National campaign effects on secondary pupils’ bullying and violence

    NARCIS (Netherlands)

    Mooij, Ton

    2016-01-01

    Background. Research on pupils' bullying (1991) and violence (1993) motivated the Dutch Ministry of Education, Culture and Science to initiate a national campaign on school safety. The government campaign was undertaken from 1995 to 2000. Aim. To test for differences in secondary pupils' bullying

  16. The use of stereotypical images of Africa in fundraising campaigns ...

    African Journals Online (AJOL)

    The article investigates the role of negative stereotypical consequences of such African images. The method of our research was a detailed visual analysis of the campaign including profound interviews with different parties that gave us their point of view. The campaign was financially very successful, especially because of ...

  17. Southern African Regional Science Initiative (SAFARI 2000): wet season campaigns

    CSIR Research Space (South Africa)

    Otter, LB

    2002-03-01

    Full Text Available The Southern African Regional Science Initiative (SAFARI 2000) involved two wet season and one dry season field campaigns. This paper reports on the wet season campaigns. The first was conducted at five sites along the Kalahari Transect in Zambia...

  18. Which Updates During an Equity Crowdfunding Campaign Increase Crowd Participation?

    NARCIS (Netherlands)

    J.H. Block (Jörn); L. Hornuf (Lars); A. Moritz (Alexandra)

    2016-01-01

    textabstractStart-ups often post updates during equity crowdfunding campaigns. Yet, little is known about the effects of such updates on funding success. We investigate this question using hand-collected data from 71 funding campaigns on two German equity crowdfunding portals. Using a combination of

  19. A configurational analysis of success factors in crowdfunding video campaigns

    DEFF Research Database (Denmark)

    Lomberg, Carina; Li-Ying, Jason; Alkærsig, Lars

    Recent discussions on success factors on crowdfunding campaigns highlight a plentitude of diverse factors that stem from different, partly contradicting theories. We focus on campaign videos and assume more than one way of creating a successful crowdfunding video. We generate data of 1000 randomly...

  20. Which updates during an equity crowdfunding campaign increase crowd participation?

    NARCIS (Netherlands)

    Block, J. (Jörn); Hornuf, L. (Lars); Moritz, A. (Alexandra)

    2017-01-01

    textabstractStart-ups often post updates during equity crowdfunding campaigns. However, little is known about the effects of such updates on crowd participation. We investigate this question by using hand-collected data from 71 funding campaigns and 39,399 investment decisions on two German equity

  1. Queer & Ally Youth Involvement in the Fair Wisconsin Campaign

    Science.gov (United States)

    Stiegler, Sam

    2008-01-01

    This article discusses the role and experience of queer youth and allies in the Fair Wisconsin campaign that fought against the marriage amendment to that state's constitution. It illustrates how LGBT and ally youth involvement can be incorporated into other organizations. Following an explanation of the campaign, are narratives of two…

  2. Communicating Sustainability: Student Perceptions of a Behavior Change Campaign

    Science.gov (United States)

    Godfrey, D. Matthew; Feng, Patrick

    2017-01-01

    Purpose: This paper aims to investigate the impacts of a science-based environmental communication campaign at a university dining hall. The impacts are assessed in terms of student attitudes toward sustainability, food consumption choices and perceptions and understanding of the campaign and the information it communicated.…

  3. Status Report on the Development of Research Campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Baer, Donald R.; Baker, Scott E.; Washton, Nancy M.; Linggi, Bryan E.

    2013-06-30

    Research campaigns were conceived as a means to focus EMSL research on specific scientific questions. Campaign will help fulfill the Environmental Molecular Sciences Laboratory (EMSL) strategic vision to develop and integrate, for use by the scientific community, world leading capabilities that transform understanding in the environmental molecular sciences and accelerate discoveries relevant to the Department of Energy’s (DOE’s) missions. Campaigns are multi-institutional multi-disciplinary projects with scope beyond those of normal EMSL user projects. The goal of research campaigns is to have EMSL scientists and users team on the projects in the effort to accelerate progress and increase impact in specific scientific areas by focusing user research, EMSL resources, and expertise in those areas. This report will give a history and update on the progress of those campaigns.

  4. How campaigns enhance European issues voting during European Parliament elections

    DEFF Research Database (Denmark)

    Beach, Derek; Møller Hansen, Kasper; Larsen, Martin Vinæs

    2017-01-01

    allegiances less important and attitudes about the European project more important by informing voters of and getting them interested in European politics. In effect, we argue that the political campaign leading up to the election makes European Parliament elections less second-order. While previous studies...... have demonstrated that EU attitudes can matter for voting behavior in European Parliament elections, existing research has drawn on post-election surveys that do not enable us to capture campaign effects. Our contribution is to assess the impact of a campaign by utilizing a rolling cross sectional......Based on findings from the literature on campaign effects on the one hand, and the literature on European Parliament elections on the other, we propose a model of European Parliamentary elections in which the campaign shift the calculus of electoral support, making differences in national political...

  5. [Complex management of partnerships during a health promotion campaign].

    Science.gov (United States)

    Renaud, Lise; Caron-Bouchard, Monique; Martel, Guillaume; Gagnon, Louis; Pelletier, Marie-Claude

    2009-01-01

    This article discusses an analysis of partnerships in the context of health promotion. The 5/30 Health Challenge, or "Défi Santé 5/30", is a campaign to promote healthy eating habits in Quebec. The authors employ this as a case study in order to 1) describe the actors and the nature of their involvement during the campaign's development, design and dissemination; 2) illustrate the interaction of these actors during the conceptualization and rollout of the campaign; 3) propose a paradigm that supports the identification of factors that contribute to or impede partner relationships. The "Défi Santé 5/30" example demonstrates that the creation and maintenance of a partnership network depends on the following key factors: dialogue between partners and the organization responsible for the campaign; the participation of partners at every stage of the campaign (no matter how many there are); allocation of sufficient time for the conceptualization of campaign materials. Dialogue between partners and the central organizer must be guaranteed through the establishment and use of a managerial contract that clearly outlines the role of each actor in the campaign. Further, the partners' activities during the campaign should be regulated through both a formal agreement and a code of ethics. Any campaign's efficiency is directly linked to these factors, among others. The study of partnerships between public, public-private, and private organizations within the framework of health promotion campaigns, thus, merits further study. In addition, to maintain alliances with partners, it is important to demonstrate the benefits of such arrangements to each partner and to equally ensure the contributions of each, be they public, private, media, or community-based organizations.

  6. Autonomous Rovers for Polar Science Campaigns

    Science.gov (United States)

    Lever, J. H.; Ray, L. E.; Williams, R. M.; Morlock, A. M.; Burzynski, A. M.

    2012-12-01

    We have developed and deployed two over-snow autonomous rovers able to conduct remote science campaigns on Polar ice sheets. Yeti is an 80-kg, four-wheel-drive (4WD) battery-powered robot with 3 - 4 hr endurance, and Cool Robot is a 60-kg 4WD solar-powered robot with unlimited endurance during Polar summers. Both robots navigate using GPS waypoint-following to execute pre-planned courses autonomously, and they can each carry or tow 20 - 160 kg instrument payloads over typically firm Polar snowfields. In 2008 - 12, we deployed Yeti to conduct autonomous ground-penetrating radar (GPR) surveys to detect hidden crevasses to help establish safe routes for overland resupply of research stations at South Pole, Antarctica, and Summit, Greenland. We also deployed Yeti with GPR at South Pole in 2011 to identify the locations of potentially hazardous buried buildings from the original 1950's-era station. Autonomous surveys remove personnel from safety risks posed during manual GPR surveys by undetected crevasses or buried buildings. Furthermore, autonomous surveys can yield higher quality and more comprehensive data than manual ones: Yeti's low ground pressure (20 kPa) allows it to cross thinly bridged crevasses or other voids without interrupting a survey, and well-defined survey grids allow repeated detection of buried voids to improve detection reliability and map their extent. To improve survey efficiency, we have automated the mapping of detected hazards, currently identified via post-survey manual review of the GPR data. Additionally, we are developing machine-learning algorithms to detect crevasses autonomously in real time, with reliability potentially higher than manual real-time detection. These algorithms will enable the rover to relay crevasse locations to a base station for near real-time mapping and decision-making. We deployed Cool Robot at Summit Station in 2005 to verify its mobility and power budget over Polar snowfields. Using solar power, this zero

  7. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems.

  8. Single-molecule force measurement via optical tweezers reveals different kinetic features of two BRaf mutants responsible for cardio-facial-cutaneous (CFC) syndrome.

    Science.gov (United States)

    Wen, Cheng; Ye, Anpei

    2013-01-01

    BRaf (B- Rapid Accelerated Fibrosarcoma) protein is an important serine/threonine-protein kinase. Two domains on BRaf can independently bind its upstream kinase, Ras (Rat Sarcoma) protein. These are the Ras binding domain (RBD) and cysteine-rich-domain (CRD). Herein we use customized optical tweezers to compare the Ras binding process in two pathological mutants of BRaf responsible for CFC syndrome, abbreviated BRaf (A246P) and BRaf (Q257R). The two mutants differ in their kinetics of Ras-binding, though both bind Ras with similar increased overall affinity. BRaf (A246P) exhibits a slightly higher Ras/CRD unbinding force and a significantly higher Ras/RBD unbinding force versus the wild type. The contrary phenomenon is observed in the Q257R mutation. Simulations of the unstressed-off rate, koff (0), yield results in accordance with the changes revealed by the mean unbinding force. Our approach can be applied to rapidly assess other mutated proteins to deduce the effects of mutation on their kinetics compared to wild type proteins and to each other.

  9. Campaigns and cliques: variations in effectiveness of an antismoking campaign as a function of adolescent peer group identity.

    Science.gov (United States)

    Moran, Meghan Bridgid; Murphy, Sheila T; Sussman, Steve

    2012-01-01

    Identity-based strategies have been suggested as a way to promote healthy behaviors when traditional approaches fall short. The truth® campaign, designed to reduce smoking in adolescents, is an example of a campaign that uses such a strategy to reach youth described as being outside the mainstream. This article examines the effectiveness of this strategy in promoting antitobacco company beliefs among youth. Survey data from 224 adolescents between 14 and 15 years of age were used to examine whether the truth® campaign was more or less effective at reaching and promoting antitobacco company beliefs among youth who identify with nonmainstream crowds (deviants and counterculture) versus those who identify with mainstream crowds (elites and academics). Analyses revealed that adolescents who identified as deviants and counterculture were more likely to have been persuaded by the truth® campaign. Social identity theory is used as a theoretical framework to understand these effects and to make recommendations for future health campaigns.

  10. [The medical literature of the Egyptian campaign].

    Science.gov (United States)

    Hutin, Jean-François

    2012-01-01

    Bonaparte's Egyptian Campaign (1798 - 1801), like all other episodes from the Napoleonic era, gave rise to an extensive literature on the subject, but most of all a significant medical literature. This fact is due to many reasons:--an important health service for this expeditionary corps of more than 36.000 men, with two main figures at its hea, Desgenettes and Larrey--but also with valuable subordinates like Assalini, Savaresi, Balme, Pugnet or Barbès.--A Commission for Science and Art, of which a few doctors and surgeons were members, but most of all pharmacists like Boudet or Rouyer--The presence in the field of Ludwig Frank, the nephew of the famous Johann Peter Frank.--The creation in Cairo of an Egyptian Institute and the publication of the masterly Description of Egypt and the establishment of printing houses.--The emergence of the myth of the Orient and its mysteries.--An extensive array of indigenous pathologies, which is characteristic of those countries. For instance: plague, dysentery, yellow fever, Egyptian ophthalmia, as well as more common diseases like tetanus, scurvy or venereal diseases. The main medical works that cover this period and its pathologies are skimmed.

  11. Modeling Overview of the MILAGRO Field Campaign

    Science.gov (United States)

    Madronich, S.; Hodzic, A.; Tie, X.; Wiedinmyer, C.; Zaveri, R.; Fast, J.

    2007-12-01

    The MILAGRO field campaign (Mexico City, March 2006) provided an interesting and challenging data base for evaluating tropospheric chemistry models on the urban and regional scale. This urban to regional transition spans a large range of VOC/NOx chemical regimes, and is complicated by the presence of aerosol of various origin including biomass burning, fossil fuel use, and dust. Complex terrain, urban effects, and frequently weak synoptic forcing challenge the representation of dispersion in the models. While together these factors are unique to Mexico City and its surroundings, gains in understanding processes and model improvements may also apply to many other urbanized regions. The MILAGRO data are being used to evaluate a hierarchy of models, from process-level chemistry, microphysics, and radiation, to more parameterized 3D chemistry- transport models that are applied to regional and global scales. Areas of special interest include the evolution of aerosol (especially secondary organic), budgets and partitioning of reactive nitrogen and other photochemically active gases, heterogeneous interactions, and radiative closure. Some specific examples (e.g. with the WRF- Chem model) will be presented and additional opportunities will be discussed.

  12. TRMM Field Campaigns: Objectives and Status Report

    Science.gov (United States)

    Zipser, Edward I.; Heymsfield, Gerald; Kummerow, Christian; Simpson, Joanne; Thiele, Otto; Rutledge, Steven; Dias, Maria Assuncio Silva; Houze, Robert A., Jr.; Yuter, Sandra; Kakar, Ramesh

    1999-01-01

    The Tropical Rainfall Measuring Mission (TRMM) satellite has been sending valuable data since launch in November 1997. Some of the key goals of the joint NASA (US) and NASDA (Japan) mission are: (1) to estimate the four-dimensional diabatic heating in the tropical and subtropical atmosphere, (2) understand the role of latent heating in driving tropical and extratropical circulations, (3) obtain monthly area-averaged estimates of rainfall over the data-sparse oceans, and (4) estimate the relative contribution of convective and stratiform precipitation over different regions during different seasons. The overarching scientific objective is to understand and improve estimates of rainfall and latent heating profiles throughout the global tropics. This requires observations for fundamental understanding of cloud dynamics and microphysics, as well as for validation, testing assumptions and error estimates of cloud-resolving models, forward radiative transfer models, algorithms used to estimate rainfall statistics and vertical structure of precipitation from surface-based radar, and from satellites. Field experiments designed to contribute to this understanding have been conducted in Texas and the South China Sea in spring of 1998, Florida in summer of 1998, and interior Brazil in (boreal) winter 1999. In summer 1999, a major oceanic campaign will be based at Kwajalein Atoll. Some early results will be highlighted, noting some significant contrasts between oceanic and continental convective systems.

  13. Critical Metadata for Spectroscopy Field Campaigns

    Directory of Open Access Journals (Sweden)

    Barbara A. Rasaiah

    2014-04-01

    Full Text Available A field spectroscopy metadata standard is defined as those data elements that explicitly document the spectroscopy dataset and field protocols, sampling strategies, instrument properties and environmental and logistical variables. Standards for field spectroscopy metadata affect the quality, completeness, reliability, and usability of datasets created in situ. Currently there is no standardized methodology for documentation of in situ spectroscopy data or metadata. This paper presents results of an international experiment comprising a web-based survey and expert panel evaluation that investigated critical metadata in field spectroscopy. The survey participants were a diverse group of scientists experienced in gathering spectroscopy data across a wide range of disciplines. Overall, respondents were in agreement about a core metadataset for generic campaign metadata, allowing for a prioritization of critical metadata elements to be proposed including those relating to viewing geometry, location, general target and sampling properties, illumination, instrument properties, reference standards, calibration, hyperspectral signal properties, atmospheric conditions, and general project details. Consensus was greatest among individual expert groups in specific application domains. The results allow the identification of a core set of metadata fields that enforce long term data storage and serve as a foundation for a metadata standard. This paper is part one in a series about the core elements of a robust and flexible field spectroscopy metadata standard.

  14. Arctic Observing Experiment (AOX) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Rigor, Ignatius [Applied Physics Lab, University of Washington; Johnson, Jim [Applied Physics Lab, University of Washington; Motz, Emily [National Ice Center; Bisic, Aaron [National Ice Center

    2017-06-30

    Our ability to understand and predict weather and climate requires an accurate observing network. One of the pillars of this network is the observation of the fundamental meteorological parameters: temperature, air pressure, and wind. We plan to assess our ability to measure these parameters for the polar regions during the Arctic Observing Experiment (AOX, Figure 1) to support the International Arctic Buoy Programme (IABP), Arctic Observing Network (AON), International Program for Antarctic Buoys (IPAB), and Southern Ocean Observing System (SOOS). Accurate temperature measurements are also necessary to validate and improve satellite measurements of surface temperature across the Arctic. Support for research associated with the campaign is provided by the National Science Foundation, and by other US agencies contributing to the US Interagency Arctic Buoy Program. In addition to the support provided by the U.S Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s North Slope of Alaska (NSA) site at Barrow and the National Science Foundation (NSF), the U.S. IABP is supported by the U.S. Coast Guard (USCG), the National Aeronautics and Space Administration (NASA), the National Ice Center (NIC), the National Oceanic and Atmospheric Administration (NOAA), and the Office of Naval Research (ONR).

  15. Advanced Fuels Campaign FY 2010 Accomplishments Report

    Energy Technology Data Exchange (ETDEWEB)

    Lori Braase

    2010-12-01

    The Fuel Cycle Research and Development (FCRD) Advanced Fuels Campaign (AFC) Accomplishment Report documents the high-level research and development results achieved in fiscal year 2010. The AFC program has been given responsibility to develop advanced fuel technologies for the Department of Energy (DOE) using a science-based approach focusing on developing a microstructural understanding of nuclear fuels and materials. The science-based approach combines theory, experiments, and multi-scale modeling and simulation aimed at a fundamental understanding of the fuel fabrication processes and fuel and clad performance under irradiation. The scope of the AFC includes evaluation and development of multiple fuel forms to support the three fuel cycle options described in the Sustainable Fuel Cycle Implementation Plan4: Once-Through Cycle, Modified-Open Cycle, and Continuous Recycle. The word “fuel” is used generically to include fuels, targets, and their associated cladding materials. This document includes a brief overview of the management and integration activities; but is primarily focused on the technical accomplishments for FY-10. Each technical section provides a high level overview of the activity, results, technical points of contact, and applicable references.

  16. 2013 Bike safety campaign: outcome and feedback

    CERN Multimedia

    HSE Unit

    2013-01-01

    From 3 to 17 June, the HSE Unit, in collaboration with the Reception and Access Control Service, led a campaign targeting CERN cyclists.   Photo: Laëtitia Wohlgemuth. In exchange for vouchers distributed by the security guards, 195 persons received a helmet and a reflective vest as well as documents on safety issues (ex: how to adjust one’s safety helmet properly; how to avoid blind spots; what is the required equipment for bikes and bike users, etc.). These persons also took part in a survey that contained questions on their cycling habits and level of knowledge on bike safety issues. It appeared that, for instance, 43% of the participants were aware that wearing a reflective vest is mandatory whenever visibility is poor (in France). 95% gave particular attention to the need to protect their heads (by assuming that wearing a helmet is either “mandatory” or “highly recommended”). The HSE Unit provided the participants with further i...

  17. Strategies for reward-based crowdfunding campaigns

    Directory of Open Access Journals (Sweden)

    Sascha Kraus

    2016-01-01

    Full Text Available Crowdfunding represents an alternative way of funding entrepreneurial ventures – and is attracting a high amount of interest in research as well as practice. Against this background, this paper analyzes reward-based crowdfunding campaign strategies and their communication tools. To do this, 446 crowdfunding projects were gathered and empirically analyzed. Three different paths of successful crowdfunding projects could be identified and are described in detail. Practical implications of crowdfunding strategies are derived, and are dependent on the required sales effort and the project added value. The terms communicator, networker and self-runner are created for this crowdfunding strategy and filled with practical examples. This paper contributes to the literature in different ways: first, it sheds more light on the developing concept of crowdfunding, with an overview of current academic discussions on crowdfunding. Furthermore, the analysis of success factors for crowdfunding initiatives adds to an emerging area of research and allows entrepreneurs to extract best practice examples for increasing the probability of successful crowdfunding projects under consideration of the key influencing factors of communication.

  18. Recall campaign for gas bottles and banks

    CERN Multimedia

    2015-01-01

    The previous contract with gas supplier Carbagas ended on 31 March 2015. Gas bottles and banks are not a property of CERN. According to the contract terms, they can remain on CERN sites without any extra costs until 30 September 2015.    If you are using Carbagas containers (bottles and/or banks) for gas purchased between 1 April 2010 and 31 March 2015, multiple options exist: Return them to the closest gas point. Purchase them on the following basis:     Rent them on the following basis: 12 CHF/month for bottles, 144 CHF/month for banks. The recall campaign has been going on for several months already: we would like to thank everyone who has already replied to it. If you haven’t answered yet, there is still time. If you know of unused or abandoned Carbagas containers, please don’t hesitate to contact us. Thank you i...

  19. What matters most in advertising campaigns? The relative effect of media expenditure and message content strategy

    NARCIS (Netherlands)

    van den Putte, B.

    2009-01-01

    Three main factors determine the effect of advertising campaigns: message content strategy, advertising expenditure and previous consumer behaviour. This study investigates the relative strength of each of these influences. Four possible campaign targets are taken into account: campaign recall,

  20. The GEOVIDE cruise in May–June 2014 reveals an intense Meridional Overturning Circulation over a cold and fresh subpolar North Atlantic

    Directory of Open Access Journals (Sweden)

    P. Zunino

    2017-11-01

    Full Text Available The GEOVIDE cruise was carried out in the subpolar North Atlantic (SPNA along the OVIDE section and across the Labrador Sea in May–June 2014. It was planned to clarify the distribution of the trace elements and their isotopes in the SPNA as part of the GEOTRACES international program. This paper focuses on the state of the circulation and distribution of thermohaline properties during the cruise. In terms of circulation, the comparison with the 2002–2012 mean state shows a more intense Irminger Current and also a weaker North Atlantic Current, with a transfer of volume transport from its northern to its central branch. However, those anomalies are compatible with the variability already observed along the OVIDE section in the 2000s. In terms of properties, the surface waters of the eastern SPNA were much colder and fresher than the averages over 2002–2012. In spite of negative temperature anomalies in the surface waters, the heat transport across the OVIDE section estimated at 0.56 ± 0.06 PW was the largest measured since 2002. This relatively large value is related to the relatively strong Meridional Overturning Circulation measured across the OVIDE section during GEOVIDE (18.7 ± 3.0 Sv. By analyzing the air–sea heat and freshwater fluxes over the eastern SPNA in relation to the heat and freshwater content changes observed during 2013 and 2014, we concluded that on a short timescale these changes were mainly driven by air–sea heat and freshwater fluxes rather than by ocean circulation.

  1. The GEOVIDE cruise in May-June 2014 reveals an intense Meridional Overturning Circulation over a cold and fresh subpolar North Atlantic

    Science.gov (United States)

    Zunino, Patricia; Lherminier, Pascale; Mercier, Herlé; Daniault, Nathalie; García-Ibáñez, Maribel I.; Pérez, Fiz F.

    2017-11-01

    The GEOVIDE cruise was carried out in the subpolar North Atlantic (SPNA) along the OVIDE section and across the Labrador Sea in May-June 2014. It was planned to clarify the distribution of the trace elements and their isotopes in the SPNA as part of the GEOTRACES international program. This paper focuses on the state of the circulation and distribution of thermohaline properties during the cruise. In terms of circulation, the comparison with the 2002-2012 mean state shows a more intense Irminger Current and also a weaker North Atlantic Current, with a transfer of volume transport from its northern to its central branch. However, those anomalies are compatible with the variability already observed along the OVIDE section in the 2000s. In terms of properties, the surface waters of the eastern SPNA were much colder and fresher than the averages over 2002-2012. In spite of negative temperature anomalies in the surface waters, the heat transport across the OVIDE section estimated at 0.56 ± 0.06 PW was the largest measured since 2002. This relatively large value is related to the relatively strong Meridional Overturning Circulation measured across the OVIDE section during GEOVIDE (18.7 ± 3.0 Sv). By analyzing the air-sea heat and freshwater fluxes over the eastern SPNA in relation to the heat and freshwater content changes observed during 2013 and 2014, we concluded that on a short timescale these changes were mainly driven by air-sea heat and freshwater fluxes rather than by ocean circulation.

  2. [Success factors in public healthy eating campaigns: a case study].

    Science.gov (United States)

    Aschemann-Witzel, J; Pérez-Cueto, F J A; Strand, M; Verbeke, W; Bech-Larsen, T

    2012-01-01

    Public campaigns and interventions are rarely fully evaluated regarding their effectiveness. The analysis of past, successful activities can contribute to the future development of public campaigns and interventions for healthier eating. The study of public campaigns and interventions for healthier eating aimed at identifying the underlying success factors and describing their relation. Interviews were conducted with representatives of 11 cases that had been identified as especially successful in an earlier research step. The interviews were analysed with regard to possible success factors and the latter used to develop a model of success factor interrelation. It was found that success of the cases was first, attributed to characteristics of the macro environment or to public private partnerships in the initiation of campaigns, second, to the engagement of social communities, elements of empowerment of the target group and the implementation of social marketing measures, and thirdly, in citizens adoption of the campaign and in accompanying structural changes. The model and identified success factors underline that success can stem from three crucial phases: the set up of a campaign, the conduction and finally, the interrelation with the citizen. The model can serve as a guide in the future development of campaigns.

  3. Inferring Social Influence of Anti-Tobacco Mass Media Campaign.

    Science.gov (United States)

    Zhan, Qianyi; Zhang, Jiawei; Yu, Philip S; Emery, Sherry; Xie, Junyuan

    2017-07-01

    Anti-tobacco mass media campaigns are designed to influence tobacco users. It has been proved that campaigns will produce users' changes in awareness, knowledge, and attitudes, and also produce meaningful behavior change of audience. Anti-smoking television advertising is the most important part in the campaign. Meanwhile, nowadays, successful online social networks are creating new media environment, however, little is known about the relation between social conversations and anti-tobacco campaigns. This paper aims to infer social influence of these campaigns, and the problem is formally referred to as the Social Influence inference of anti-Tobacco mass mEdia campaigns (Site) problem. To address the Site problem, a novel influence inference framework, TV advertising social influence estimation (Asie), is proposed based on our analysis of two real anti-tobacco campaigns. Asie divides audience attitudes toward TV ads into three distinct stages: 1) cognitive; 2) affective; and 3) conative. Audience online reactions at each of these three stages are depicted by Asie with specific probabilistic models based on the synergistic influences from both online social friends and offline TV ads. Extensive experiments demonstrate the effectiveness of Asie.

  4. Ionospheric measurements during the CRISTA/MAHRSI campaign: their implications and comparison with previous campaigns

    Directory of Open Access Journals (Sweden)

    J. Laštovicka

    Full Text Available The CRISTA/MAHRSI experiment on board a space shuttle was accompanied by a broad campaign of rocket, balloon and ground-based measurements. Supporting lower ionospheric ground-based measurements were run in Europe and Eastern Asia between 1 October-30 November, 1994. Results of comparisons with long ionospheric data series together with short-term comparisons inside the interval October-November, 1994, showed that the upper middle atmosphere 
    (h = 80-100 km at middle latitudes of the Northern Hemisphere in the interval of the CRISTA/MAHRSI experiment (4-12 November, 1994 was very close to its expected climatological state. In other words, the average results of the experiment can be used as climatological data, at least for the given area/altitudes. The role of solar/geomagnetic and "meteorological" control of the lower ionosphere is investigated and compared with the results of MAP/WINE, MAC/SINE and DYANA campaigns. The effects of both solar/geomagnetic and global meteorological factors on the lower ionosphere are found to be weak during autumn 1994 compared to those in MAP/WINE and DYANA winters, and they are even slightly weaker than those in MAP/SINE summer. The comparison of the four campaigns suggests the following overall pattern: in winter the lower ionosphere at northern middle latitudes appears to be fairly well "meteorologically" controlled with a very weak solar influence. In summer, solar influence is somewhat stronger and dominates the weak "meteorological" influence, but the overall solar/meteorological control is weaker than in winter. In autumn we find the weakest overall solar/meteorological control, local effects evidently dominate.

    Key words. Ionosphere (ionosphere · atmosphere interactions; mid-latitude ionosphere

  5. Rapid monitoring in vaccination campaigns during emergencies: the post-earthquake campaign in Haiti.

    Science.gov (United States)

    Rainey, Jeanette J; Sugerman, David; Brennan, Muireann; Cadet, Jean Ronald; Ernsly, Jackson; Lacapère, François; Danovaro-Holliday, M Carolina; Mubalama, Jean-Claude; Nandy, Robin

    2013-12-01

    The earthquake that struck Haiti in January 2010 caused 1.5 million people to be displaced to temporary camps. The Haitian Ministry of Public Health and Population and global immunization partners developed a plan to deliver vaccines to those residing in these camps. A strategy was needed to determine whether the immunization targets set for the campaign were achieved. Following the vaccination campaign, staff from the Ministry of Public Health and Population interviewed convenience samples of households - in specific predetermined locations in each of the camps - regarding receipt of the emergency vaccinations. A camp was targeted for "mop-up vaccination" - i.e. repeat mass vaccination - if more than 25% of the children aged 9 months to 7 years in the sample were found not to have received the emergency vaccinations. Rapid monitoring was implemented in camps located in the Port-au-Prince metropolitan area. Camps that housed more than 5000 people were monitored first. By the end of March 2010, 72 (23%) of the 310 vaccinated camps had been monitored. Although 32 (44%) of the monitored camps were targeted for mop-up vaccination, only six of them had received such repeat mass vaccination when checked several weeks after monitoring. Rapid monitoring was only marginally beneficial in achieving immunization targets in the temporary camps in Port-au-Prince. More research is needed to evaluate the utility of conventional rapid monitoring, as well as other strategies, during post-disaster vaccination campaigns that involve mobile populations, particularly when there is little capacity to conduct repeat mass vaccination.

  6. Some Accounting Aspects regarding the Elections Campaigns in Romania

    Directory of Open Access Journals (Sweden)

    Riana Iren Radu

    2016-07-01

    Full Text Available The objective of this paper is to present the legal framework for financing the election campaigns in Romania and in the world. There are different systems of campaign finance across the world. Some of these systems rely mainly on private funds, some are based mainly on public funds, but most systems are a combination of both. In all cases a certain degree of limitations on contributions and expenditures are a standard characteristic of the campaign finance system. Limitations on contributions can be means to reduce the corruption and limitations on expenditures may be imposed to guarantee egalitarianism among the various political forces.

  7. The VERB campaign: applying a branding strategy in public health.

    Science.gov (United States)

    Asbury, Lori D; Wong, Faye L; Price, Simani M; Nolin, Mary Jo

    2008-06-01

    A branding strategy was an integral component of the VERB Youth Media Campaign. Branding has a long history in commercial marketing, and recently it has also been applied to public health campaigns. This article describes the process that the CDC undertook to develop a physical activity brand that would resonate with children aged 9-13 years (tweens), to launch an unknown brand nationally, to build the brand's equity, and to protect and maintain the brand's integrity. Considerations for branding other public health campaigns are also discussed.

  8. The Israeli Digital Rights Movement's campaign for privacy

    Directory of Open Access Journals (Sweden)

    Efrat Daskal

    2017-09-01

    Full Text Available This study explores the persuasion techniques used by the Israeli Digital Rights Movement in its campaign against Israel’s biometric database. The research was based on analysing the movement's official publications and announcements and the journalistic discourse that surrounded their campaign within the political, judicial, and public arenas in 2009-2017. The results demonstrate how the organisation navigated three persuasion frames to achieve its goals: the unnecessity of a biometric database in democracy; the database’s ineffectiveness; and governmental incompetence in securing it. I conclude by discussing how analysing civil society privacy campaigns can shed light over different regimes of privacy governance.

  9. Political Bots on Twitter in #Ecuador2017 Presidential Campaigns

    Directory of Open Access Journals (Sweden)

    Iria Puyosa

    2017-09-01

    Full Text Available We studied the behavior of campaign hashtags on Twitter in the second round of Ecuador 2017 presidential elections. The study analyzed 10 trending hashtags attacking opponents. The data was captured and analyzed with NodeXL, an application used to analyze social network. The analysis verifies the central role of automated accounts or botnets in the creation of hashtags. The campaign against the opposing binomial, which combined real accounts of government party activists with botnets, was more effective versus the less coordinated opposition campaign against candidate Lenin Moreno. It also verifies the use of localized botnets, mainly in Argentina and Venezuela.

  10. Campaigning and contestation: Comments on politicians’ Facebook pages during the 2011 Danish general election campaign

    Directory of Open Access Journals (Sweden)

    Sander Andreas Schwartz

    2015-12-01

    Full Text Available This article is a critical study of the Facebook pages of politicians as public spheres using Dahlberg’s notion of contestation. A method is implemented inspired by qualitative content analysis and including focus groups in order to study citizen comments on eight main political candidates’ Facebook pages during the 2011 Danish election campaign. An analytical framework is presented that conceptualizes the particular platform as a dinner party, with a dinner table, a host, and the invited guests. The dinner party exhibits the interplay between these elements and how they limit the option of contesting the dominating discourse in favor of a supportive marketing logic.

  11. Recall of "The Real Cost" Anti-Smoking Campaign Is Specifically Associated With Endorsement of Campaign-Targeted Beliefs.

    Science.gov (United States)

    Kranzler, Elissa C; Gibson, Laura A; Hornik, Robert C

    2017-10-01

    Though previous research suggests the FDA's "The Real Cost" anti-smoking campaign has reduced smoking initiation, the theorized pathway of effects (through targeted beliefs) has not been evaluated. This study assesses the relationship between recall of campaign television advertisements and ad-specific anti-smoking beliefs. Respondents in a nationally representative survey of nonsmoking youths age 13-17 (n = 4,831) reported exposure to four The Real Cost advertisements and a fake ad, smoking-relevant beliefs, and nonsmoking intentions. Analyses separately predicted each targeted belief from specific ad recall, adjusting for potential confounders and survey weights. Parallel analyses with non-targeted beliefs showed smaller effects, strengthening claims of campaign effects. Recall of four campaign ads (but not the fake ad) significantly predicted endorsement of the ad-targeted belief (Mean β = .13). Two-sided sign tests indicated stronger ad recall associations with the targeted belief relative to the non-targeted belief (p campaign-targeted beliefs were more likely to have no intention to smoke (p campaign and the theorized pathway of effects (through targeted beliefs). These analyses also provide a methodological template for showing campaign effects despite limitations of available data.

  12. Conceptual Design - Polar Drive Ignition Campaign

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, R

    2012-04-05

    Review (CDR) remain to be defined. In all cases, the facility modifications represent functional changes to existing systems or capabilities. The bulk of the scope yet to be identified is associated with the DPR's and MultiFM beam smoothing. Detailed development plans for these two subsystems are provided in Appendices H and I; additional discussion of subsystem requirements based on the physics of PD ignition is given in Section 3. Accordingly, LLE will work closely with LLNL to develop detailed conceptual designs for the PD-specific facility modifications, including assessments of the operational impact of implementation (e.g., changing optics for direct rather than indirect-drive illumination and swapping from a hohlraum-based ITIC to one that supports PD). Furthermore, the experimental implementation plan represents the current best understanding of the experimental campaigns required to achieve PD ignition. This plan will evolve based on the lessons learned from the National Ignition Campaign (NIC) and ongoing indirect-drive ignition experiments. The plan does not take the operational realities of the PD configuration into account; configuration planning for the proposed PD experiments is beyond the scope of this document.

  13. The Australian national binge drinking campaign: campaign recognition among young people at a music festival who report risky drinking

    Directory of Open Access Journals (Sweden)

    Sacks-Davis Rachel

    2011-06-01

    Full Text Available Abstract Background The Australian Government launched a mass media campaign in 2009 to raise awareness of the harms and costs associated risky drinking among young Australians. The aim of this study was to assess if young people attending a music festival who report frequent risky single occasions of drinking (RSOD recognise the key message of the campaign, "Binge drinking can lead to injuries and regrets", compared to young people who report less frequent RSOD. Methods A cross-sectional behavioural survey of young people (aged 16-29 years attending a music festival in Melbourne, Australia, was conducted in January 2009. We collected basic demographics, information on alcohol and other drug use and sexual health and behaviour during the previous 12 months, and measured recognition of the Australian National Binge Drinking Campaign key message. We calculated the odds of recognition of the key slogan of the Australian National Binge Drinking Campaign among participants who reported frequent RSOD (defined as reported weekly or more frequent RSOD during the previous 12 months compared to participants who reported less frequent RSOD. Results Overall, three-quarters (74.7% of 1072 participants included in this analysis recognised the campaign message. In the adjusted analysis, those reporting frequent RSOD had significantly lower odds of recognising the campaign message compared to those not reporting frequent RSOD (OR 0.7, 95% CI 0.5-0.9, whilst females had significantly greater odds of recognising the campaign message compared to males (OR 1.8, 95% CI 1.4-2.1. Conclusions Whilst a high proportion of the target group recognised the campaign, our analysis suggests that participants that reported frequent RSOD - and thus the most important group to target - had statistically significantly lower odds of recognising the campaign message.

  14. The Australian national binge drinking campaign: campaign recognition among young people at a music festival who report risky drinking.

    Science.gov (United States)

    van Gemert, Caroline; Dietze, Paul; Gold, Judy; Sacks-Davis, Rachel; Stoové, Mark; Vally, Hassan; Hellard, Margaret

    2011-06-20

    The Australian Government launched a mass media campaign in 2009 to raise awareness of the harms and costs associated risky drinking among young Australians. The aim of this study was to assess if young people attending a music festival who report frequent risky single occasions of drinking (RSOD) recognise the key message of the campaign, "Binge drinking can lead to injuries and regrets", compared to young people who report less frequent RSOD. A cross-sectional behavioural survey of young people (aged 16-29 years) attending a music festival in Melbourne, Australia, was conducted in January 2009. We collected basic demographics, information on alcohol and other drug use and sexual health and behaviour during the previous 12 months, and measured recognition of the Australian National Binge Drinking Campaign key message. We calculated the odds of recognition of the key slogan of the Australian National Binge Drinking Campaign among participants who reported frequent RSOD (defined as reported weekly or more frequent RSOD during the previous 12 months) compared to participants who reported less frequent RSOD. Overall, three-quarters (74.7%) of 1072 participants included in this analysis recognised the campaign message. In the adjusted analysis, those reporting frequent RSOD had significantly lower odds of recognising the campaign message compared to those not reporting frequent RSOD (OR 0.7, 95% CI 0.5-0.9), whilst females had significantly greater odds of recognising the campaign message compared to males (OR 1.8, 95% CI 1.4-2.1). Whilst a high proportion of the target group recognised the campaign, our analysis suggests that participants that reported frequent RSOD - and thus the most important group to target - had statistically significantly lower odds of recognising the campaign message.

  15. Manus Water Isotope Investigation Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Conroy, Jessica L [University of Illinois, Urbana-Champaign; Cobb, Kim M [Georgia Institute of Technology; Noone, David [University of Colorado, Boulder

    2016-03-01

    The objective of this field campaign was to investigate climatic controls on the stable isotopic composition of water vapor, precipitation, and seawater in the western tropical Pacific. Simultaneous measurements of the stable isotopic composition of vapor and precipitation from April 28 to May 8, 2013, at the Manus Tropical Western Pacific Atmospheric Radiation Measurement site, provided several key insights into the nature of the climate signal archived in precipitation and vapor isotope ratios. We observed a large shift from lower to higher isotopic values in vapor and precipitation because of the passage of a mesoscale convective system west of the site and a transition from a regional stormy period into a more quiescent period. During the quiescent period, the stable isotopic composition of vapor and precipitation indicated the predominance of oceanic evaporation in determining the isotopic composition of boundary-layer vapor and local precipitation. There was not a consistent relationship between intra-event precipitation amount at the site and the stable isotopic composition of precipitation, thus challenging simplified assumptions about the isotopic “amount effect” in the tropics on the time scale of individual storms. However, some storms did show an amount effect, and deuterium excess values in precipitation had a significant relationship with several meteorological variables, including precipitation, temperature, relative humidity, and cloud base height across all measured storms. The direction of these relationships points to condensation controls on precipitation deuterium excess values on intra-event time scales. The relationship between simultaneous measurements of vapor and precipitation isotope ratios during precipitation events indicates the ratio of precipitation-to-vapor isotope ratios can diagnose precipitation originating from a vapor source unique from boundary-layer vapor and rain re-evaporation.

  16. Negative campaign in the presidential debates of democratic Romania

    Directory of Open Access Journals (Sweden)

    Roxana Miron

    2015-12-01

    Full Text Available This work aims to present the evolution of Romanian’s elections presidential campaigns from 1990 to 2014, focusing on how the main candidates (the two arrived in the second round used negative campaign techniques to build their visibility, their image of future President of the State. The analysis of their participation in final political debates on TV will be directed towards identifying those negative campaigning elements, negative aspects, disadvantages, minuses, weaknesses that each candidate attributes to his opponent. If sometimes the negative campaigning can be constructive, by amplifying the competitiveness between the candidates, more often it is responsible for guiding the electoral race to another level – that of the tabloid scandals, by invoking arguments that look ridiculous, inconsistent and irrelevant.

  17. Project LEAN: a national campaign to reduce dietary fat consumption.

    Science.gov (United States)

    Samuels, S E

    1990-01-01

    The Henry J. Kaiser Family Foundation initiated a social marketing campaign in 1987, to reduce the nation's risk for heart disease and some cancers. Project LEAN (Low-Fat Eating for America Now) encourages reduction in dietary fat consumption to 30 percent of total calories, by 1998, through public service advertising, publicity, and point-of-purchase programs in restaurants, supermarkets, and school and worksite cafeterias. The campaign has joined efforts with the Partners for Better Health, a coalition of over thirty national health and consumer organizations that are working towards a common goal of improved health through nutrition. Project LEAN has provided funds to states and communities to initiate local campaigns and work with chefs, food professionals, and the food industry to change norms and customs in food preparation and manufacturing. The goal of the campaign is to accelerate the trend in fat reduction and to stimulate the greater availability of low-fat food choices in the marketplace.

  18. Done 4: analysis of a failed social norms marketing campaign.

    Science.gov (United States)

    Russell, Cristel Antonia; Clapp, John D; Dejong, William

    2005-01-01

    College students commonly believe their peers engage in higher levels of dangerous drinking than is actually the case. Social norms marketing campaigns attempt to correct these misperceptions, decrease the perceived normative pressure to drink, and thereby drive down high-risk alcohol consumption. In this case study, we critically examined "Done 4," an unsuccessful social norms marketing campaign conducted as part of a comprehensive prevention trial at a large urban university. As part of this analysis, undergraduate marketing students were shown the principal print advertisement used in the campaign and asked to complete an advertising analysis questionnaire. The results of this case study suggest that the advertisement was poorly constructed, which decreased its effectiveness and led to confusion about the social norms message. We discuss implications of these findings for future prevention campaigns and new research.

  19. Images and bodies subject: sexuality in advertising campaign be stupid

    National Research Council Canada - National Science Library

    Douglas Luiz Menegazzi

    2013-01-01

    This paper discusses the portrayal of sexuality and gender in contemporary advertising by the image and it focuses on visual analysis of the case study of the campaign Be Stupid, the clothing brand Diesel...

  20. [Vaccination campaigns against poliomyelitis in Spain in 1963].

    Science.gov (United States)

    Rodríquez Sánchez, Juan Antonio; Seco Calvo, Jesús

    2009-01-01

    Two anti-poliomyelitic vaccination campaigns coexisted in 1963: the Salk vaccine used by the Compulsory Health Insurance and the pilot experience with the oral Sabin vaccine promoted by the Health General Office. This simultaneity of campaigns was due to the interest that both bodies had to control the Preventive Medicine in Spain. The Compulsory Sickness Insurance used the anti-polio vaccine to promote itself socially in a time when the Basic Law on Social Security was being developed. Under these circumstances, the Health General Office allegedly brought forward its vaccine campaign by using a test of an innovative oral trivalent vaccine in the province of León, something which was hidden to the public. The Health General Office's claim of competence in prevention and the need of a massive response to a voluntary vaccine led to a singular advertising campaign with old messages in innovative means of communication.