WorldWideScience

Sample records for californium 256

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. 17 CFR 256.931 - Rents.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Rents. 256.931 Section 256.931 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS... 1935 2. Expense § 256.931 Rents. This account shall include rents, including taxes, paid for the...

  8. 17 CFR 256.184 - Clearing accounts.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Clearing accounts. 256.184 Section 256.184 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM... COMPANY ACT OF 1935 4. Deferred Debits § 256.184 Clearing accounts. This account shall include...

  9. 17 CFR 256.307 - Equipment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Equipment. 256.307 Section 256... COMPANY ACT OF 1935 Service Company Property Accounts § 256.307 Equipment. This account shall include the cost of equipment owned by the service company and used in rendering services such as micro-wave...

  10. 37 CFR 2.56 - Specimens.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Specimens. 2.56 Section 2.56 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.56 Specimens. (a) An application under section 1(a) of...

  11. 40 CFR 96.256 - Account error.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Account error. 96.256 Section 96.256... Tracking System § 96.256 Account error. The Administrator may, at his or her sole discretion and on his or her own motion, correct any error in any CAIR SO2 Allowance Tracking System account. Within 10...

  12. 256Mbit NAND type EEPROM; 256Mbit NAND gata EEPROM

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Development has been made on a 256Mbit NAND type EEPROM (read-out only memory capable of electrical and collective erasure and rewriting) having the world`s smallest chip size of about 130 mm {sup 2} and having the industry`s largest capacity. The development was made possible by using a technology for micro fine processing of 0.25 {mu} m and a shallow trench isolation (STI) technology to provide slots between elements and isolate the elements. The NAND type EEPROM is used widely for memory media for image data of electronic still cameras, memory cards, and semiconductor disks. Replacement of magnetic disks (MD) into a semiconductor memory (SmartMedia{sub TM}) is intended in the future music market, where demand is predicted to increase for the NAND type EEPROM of large capacity. The product package lined up include the SmartMedia{sub TM} as small flash memory card and the Thin Small Outline Package (TSOP). The SmartMedia{sub TM} mounting two 256 Mbit chips, scheduled of commercialization in the spring of 1999, can record as much as one CD can, and will be a product that will open up a new music market. (translated by NEDO)

  13. Imaging by photon counting with 256 x 256 pixel matrix

    CERN Document Server

    Tlustos, Lukas; Heijne, Erik H M; Llopart-Cudie, Xavier

    2004-01-01

    Using 0.25 mum standard CMOS we have developed 2-D semiconductor matrix detectors with sophisticated functionality integrated inside each pixel of a hybrid sensor module. One of these sensor modules is a matrix of 256 multiplied by 256 square 55mum pixels intended for X- ray imaging. This device is called 'Medipix2' and features a fast amplifier and two-level discrimination for signals between 1000 and 100000 equivalent electrons, with overall signal noise similar to 150 e- rms. Signal polarity and comparator thresholds are programmable. A maximum count rate of nearly 1 MHz per pixel can be achieved, which corresponds to an average flux of 3 multiplied by 10exp10 photons per cm2. The selected signals can be accumulated in each pixel in a 13- bit register. The serial readout takes 5-10 ms. A parallel readout of similar to 300 mus could also be used. Housekeeping functions such as local dark current compensation, test pulse generation, silencing of noisy pixels and threshold tuning in each pixel contribute to t...

  14. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  15. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  16. Improved security analysis of Fugue-256 (poster)

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Knudsen, Lars Ramkilde; Bagheri, Nasoor

    2011-01-01

    We present some improved analytical results as part of the ongoing work on the analysis of Fugue-256 hash function, a second round candidate in the NIST's SHA3 competition. First we improve Aumasson and Phans' integral distinguisher on the 5.5 rounds of the final transformation of Fugue-256 to 16.......5 rounds. Next we improve the designers' meet-in-the-middle preimage attack on Fugue-256 from 2480 time and memory to 2416. Finally, we comment on possible methods to obtain free-start distinguishers and free-start collisions for Fugue-256. © 2011 Springer-Verlag....

  17. 17 CFR 256.301 - Organization.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Organization. 256.301 Section... COMPANY ACT OF 1935 Service Company Property Accounts § 256.301 Organization. This account shall include... incident to organizing a corporation or other form of organization and putting it into readiness to do...

  18. Improved security analysis of Fugue-256

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Bagheri, Nasour; Knudsen, Lars Ramkilde

    2011-01-01

    in the G transform. Next we improve the designers’ meet-in-the-middle preimage attack on Fugue-256 from 2480 time and memory to 2416. Next we study the security of Fugue-256 against free-start distinguishers and free-start collisions. In this direction, we use an improved variant of the differential...

  19. 30 CFR 256.11 - Helium.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Helium. 256.11 Section 256.11 Mineral Resources... Helium. (a) Each lease issued or continued under these regulations shall be subject to a reservation by the United States, under section 12(f) of the Act, of the ownership of and the right to extract helium...

  20. 17 CFR 256.924 - Property insurance.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Property insurance. 256.924... COMPANY ACT OF 1935 2. Expense § 256.924 Property insurance. (a) This account shall include the cost of insurance premiums to protect the service company against losses and damages to owned or leased property...

  1. 30 CFR 256.26 - General.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false General. 256.26 Section 256.26 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS...-use conflicts, resource potential, industry interest and other relevant information. Comments received...

  2. Nuclear Data Sheets for A=256

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Balraj

    2017-03-15

    Available nuclear structure information for the known A=256 nuclei (Cf, Es, Fm, Md, No, Lr, Rf and Db) is presented together with Adopted properties of levels and gamma rays. This evaluation supersedes data in the previous evaluations of A=256 nuclides by 1999Ak02, 1989Sc26, 1981Sc06 and 1976Sc02.

  3. 40 CFR 97.256 - Account error.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Account error. 97.256 Section 97.256... Account error. The Administrator may, at his or her sole discretion and on his or her own motion, correct any error in any CAIR SO2 Allowance Tracking System account. Within 10 business days of making such...

  4. Dicty_cDB: CHF256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF256 (Link to dictyBase) - - - Contig-U15603-1 CHF256P (Link to Original site) CHF...256F 601 CHF256Z 649 CHF256P 1230 - - Show CHF256 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF2-C/CHF256Q.Seq.d/ Representative seq. ID CHF...256P (Link to Original site) Representative DNA sequence >CHF256 (CHF256Q) /CSM/CH/CHF2-C/CHF...SM-cDNA Score E Sequences producing significant alignments: (bits) Value CHF256 (CHF256Q) /CSM/CH/CHF

  5. 256-slice wide-detector computed tomography.

    Science.gov (United States)

    2007-11-01

    This article provides opinions and predictions about an emerging technology-256-slice wide-detector computed tomography-to help healthcare facilities decide whether the technology is worth tracking and when it might be ready for adoption. We believe 256-slice CT is worth monitoring based on its predicted clinical and business impact. We consider it unlikely, however, that more than a few select facilities will begin adopting this technology within the next three years.

  6. A Cache Timing Analysis of HC-256

    DEFF Research Database (Denmark)

    Zenner, Erik

    2009-01-01

    In this paper, we describe a cache-timing attack against the stream cipher HC-256, which is the strong version of eStream winner HC-128. The attack is based on an abstract model of cache timing attacks that can also be used for designing stream ciphers. From the observations made in our analysis,...

  7. 24 CFR 234.256 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 234.256... Substitute mortgagors. (a) Selling mortgagor. The requirements for the selling mortgagor are set forth in... Commissioner's approval of a substitute mortgagor only if the mortgage executed by the original mortgagor met...

  8. 32 CFR 256.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... INSTALLATIONS COMPATIBLE USE ZONES § 256.4 Policy. (a) General. As a first priority step, all reasonable... developed and no requirement for a fee interest in the land exists except to prevent incompatible use... with local agencies will be in accordance with OMB Circular A-95. ...

  9. Cache Timing Analysis of HC-256

    DEFF Research Database (Denmark)

    Zenner, Erik

    2008-01-01

    In this paper, we describe an abstract model of cache timing attacks that can be used for designing ciphers. We then analyse HC-256 under this model, demonstrating a cache timing attack under certain strong assumptions. From the observations made in our analysis, we derive a number of design...... principles for hardening ciphers against cache timing attacks....

  10. Elliptical Undulators HU256 for Synchrotron SOLEIL

    Science.gov (United States)

    Batrakov, A.; Briquez, F.; Chubar, O.; Churkin, I.; Dael, A.; Ilyin, I.; Kolokolnikov, Yu.; Marcouile, O.; Marteau, F.; Roux, G.; Rouvinski, E.; Semenov, E.; Steshov, A.; Valleau, M.; Vobly, P.

    2007-01-01

    Three elliptical undulators HU256 of electromagnetic type were produced, tested and magnetically measured by the Budker Institute of Nuclear Physics (Russia) for Synchrotron Soleil (France). The undulators have a new design of a Bx & Bz closed structure for insertion vacuum chamber. In the elliptical undulator HU256 with period of the magnetic fields of 256 mm, the vertical magnetic field (Bzmax=0.44 T) formed by 27 Bz laminated dipole magnets is symmetric, and the horizontal magnetic field (Bxmax=0.33 T) formed by 28 Bx laminated dipole magnets is asymmetric. The undulator can work in standard mode as well as in a quasi-periodical mode. The vertical magnetic field may be modulated by switching on the modulation coils placed on the Bz dipoles. Two power supply systems allow us to modulate the horizontal magnetic field, and change the radiation spectrum. The magnetic calculations of the individual dipoles and dipoles in "undulator" environment were executed by means of Mermaid 3D Code. The magnetic measurements of the individual dipoles had confirmed the magnetic calculations. On basis of semiempirical dependences from the mechanical characteristics the estimates of the magnetic parameters for all dipoles were calculated. Sorting of dipoles in the undulators have been done, and it has improved the magnetic parameters of the assembled undulators in comparison with the statistical estimations. The magnetic measurements of the undulators HU256 were carried out at Budker INP by Hall probes and at Soleil by Hall probes and Stretched Wire. Now the 1st undulator HU256 is installed at Soleil Storage Ring.

  11. Long-Wavelength 256 x 256 QWIP Hand-Held Camera

    Science.gov (United States)

    Gunapala, S. D.; Liu, J. K.; Sundaram, M.; Bandara, S. V.; Shott, C. A.; Hoelter, T.; Maker, P. D.; Muller, R. E.

    1996-01-01

    In this paper, we discuss the development of very sensitive long wavelength infrared (LWIR) GaAs/Al(x)Ga(l-x)As quantum well infrared photodetectors (QWIPs), fabrication of random reflectors for efficient light coupling, and the demonstration of the first hand-held long-wavelength 256 x 256 QWIP focal plane array camera. Excellent imagery, with a noise equivalent differential temperature (NE Delta T) of 25 mK has been achieved.

  12. Long Wavelength 256 X 256 Quantum Well Infrared Photodetector Portable Camera

    Science.gov (United States)

    Gunapala, S. D.; Liu, J. K.; Shott, C. A.; Hoelter, T.; Sundaram, M.; Park, J. S.; Laband, S.; James, J.

    1996-01-01

    In this paper, we discuss the development of very sensitive long wavelength infrared (LWIR) GaAs/AlGal-xAs Quantum well infrared photodetectors (QWIPS), fabrication of random reflectors for efficient light coupling, and the demonstration of a LWIR 256 X 256 focal plane array imaging camera. Excellent imagery, with a noise equivalent differential temperature (NE-delta-T) of 25 mK has been achieved.

  13. 32 CFR 256.6 - Runway classification by aircraft type.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Runway classification by aircraft type. 256.6 Section 256.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS AIR INSTALLATIONS COMPATIBLE USE ZONES § 256.6 Runway classification by aircraft...

  14. 17 CFR 256.123 - Investment in associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.123 Section 256.123 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 2. Investments § 256.123 Investment in associate companies. This...

  15. 17 CFR 256.146 - Accounts receivable from associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. 256.146 Section 256.146 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.146 Accounts...

  16. 17 CFR 256.457 - Services rendered to associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.457 Section 256.457 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.457 Services rendered to associate...

  17. 17 CFR 256.234 - Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.234 Section 256.234 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.234 Accounts payable to...

  18. 17 CFR 256.233 - Notes payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.233 Section 256.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.233 Notes payable to...

  19. 17 CFR 256.223 - Advances from associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.223 Section 256.223 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 6. Long-Term Debt § 256.223 Advances from associate companies. This...

  20. 17 CFR 256.458 - Services rendered to nonassociate companies.

    Science.gov (United States)

    2010-04-01

    ... nonassociate companies. 256.458 Section 256.458 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.458 Services...

  1. 38 CFR 17.256 - Amended or supplemental applications.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Amended or supplemental applications. 17.256 Section 17.256 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.256 Amended or supplemental applications. An amended...

  2. 30 CFR 256.25 - Areas near coastal States.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Areas near coastal States. 256.25 Section 256... SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Call for Information and Nominations § 256.25 Areas near coastal States. (a) At the time information is solicited for leasing of areas within 3...

  3. 28 CFR 2.56 - Disclosure of Parole Commission file.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Disclosure of Parole Commission file. 2.56 Section 2.56 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.56 Disclosure of Parole Commission file....

  4. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  5. 42 CFR 84.256 - Quality control requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Quality control requirements. 84.256 Section 84.256... § 84.256 Quality control requirements. (a) In addition to the construction and performance requirements specified in §§ 84.251, 84.252, 84.253, 84.254, and 84.255, the quality control requirements in paragraphs...

  6. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  7. 17 CFR 256.411.5 - Investment tax credit.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment tax credit. 256.411... HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.411.5 Investment tax credit. (a) This account shall be debited with the amounts of investment tax credits related to service company property...

  8. 17 CFR 256.925 - Injuries and damages.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Injuries and damages. 256.925... COMPANY ACT OF 1935 2. Expense § 256.925 Injuries and damages. (a) This account shall include the cost of premiums for insurance to protect the service company against claims for injury, liability and damage...

  9. 25 CFR 256.24 - Will I need flood insurance?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Will I need flood insurance? 256.24 Section 256.24... Will I need flood insurance? You will need flood insurance if your dwelling is located in an area..., 87 Stat. 977). Your servicing housing office will advise you. ...

  10. 17 CFR 256.922 - Administrative expenses transferred-credit.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Administrative expenses transferred-credit. 256.922 Section 256.922 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... transferred—credit. This account shall be credited with administrative expenses recorded in accounts 920 and...

  11. 17 CFR 256.921 - Office supplies and expenses.

    Science.gov (United States)

    2010-04-01

    .... Bank messenger and service charges. 3. Books, periodicals, bulletins and subscriptions to newspapers... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Office supplies and expenses. 256.921 Section 256.921 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  12. 17 CFR 256.101 - Service company property.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Service company property. 256...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Balance Sheet Accounts: Assets and Other Debit Accounts § 256.101 Service...

  13. 20 CFR 632.256 - Submission of applications.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Submission of applications. 632.256 Section 632.256 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND... youth allocation at the same time section 401 allocations are announced. The summer plan will be a...

  14. 17 CFR 256.920 - Salaries and wages.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Salaries and wages. 256.920... COMPANY ACT OF 1935 2. Expense § 256.920 Salaries and wages. (a) This account shall include salaries, wages, bonuses and other consideration for services, with the exception of director's fees paid directly...

  15. 27 CFR 24.256 - Bottle aging wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottle aging wine. 24.256... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and Labeling of Wine § 24.256 Bottle aging wine. Wine bottled or packed and stored for the purpose of aging need...

  16. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  17. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  18. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  19. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  20. 30 CFR 256.79 - Effect of regulations on lease.

    Science.gov (United States)

    2010-07-01

    ... SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Section 6 Leases § 256.79 Effect of regulations on... continue in effect, and, in the event of any conflict or inconsistency, shall take precedence over these...

  1. 76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256

    Science.gov (United States)

    2011-03-02

    ... Hash Algorithm (SHA)-256 AGENCY: Department of Defense (DoD), General Services Administration (GSA... agencies about ways for the acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256... Hash Algorithm SHA-256'' in all correspondence related to this public meeting. FOR FURTHER INFORMATION...

  2. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  3. 15 CFR 256.2 - The Research Associate Program.

    Science.gov (United States)

    2010-01-01

    ... ASSOCIATE PROGRAM § 256.2 The Research Associate Program. The Bureau provides its facilities, scientific competence, and technical supervision for defined scientific or technical research by a Research Associate when such research is complementary to and compatible with scientific or technical research being...

  4. Magnetic design and manufacture of elliptical undulators HU256

    Science.gov (United States)

    Batrakov, A.; Briquez, F.; Chubar, O.; Churkin, I.; Couprie, M.-E.; Dael, A.; Ilyin, I.; Kolokolnikov, Yu.; Roux, G.; Rouvinski, E.; Semenov, E.; Steshov, A.; Valleau, M.; Vobly, P.

    2007-05-01

    Three elliptical undulators HU256 (period 256 mm) of electromagnetic type were produced, tested and magnetically measured by the Budker Institute of Nuclear Physics (Russia) for Synchrotron SOLEIL (France). The undulators have a new design of a Bx and Bz closed structure for insertion vacuum chamber. The magnetic calculations of the individual dipoles and undulator structures were executed by means of Mermaid 3D Code. The expected magnetic parameters for all manufactured dipoles were fulfilled on basis of these model dependences from the mechanical characteristics (pole gap, yoke width, and coil position). The estimated 1st integral of all dipoles had been used in an optimal arrangement of the dipoles in undulators (sorting). Owing to the realized sorting, the 1st integral of the magnetic field and phase error of the assembled undulators had been decreased in comparison with the statistic estimations. The special Hall probes systems for the magnetic measurements of the undulators HU256 were designed and manufactured by the BINP. All three HU256 undulators were magnetically measured at the BINP and re-measured at the SOLEIL after transportation. The results of magnetic measurements and model estimates are compared and analyzed.

  5. 17 CFR 256.311 - Other service company property.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Other service company property... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Service Company Property Accounts § 256.311 Other service company...

  6. 17 CFR 256.163 - Stores expense undistributed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Stores expense undistributed... UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.163 Stores expense undistributed... nonassociate companies. items (b)(1) Supervision of purchasing and stores department to extent assignable to...

  7. Phenotype abnormality: 256 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 256 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u762i disfunctional f...lower during process named flower development stage ... flower ... disfunctional ... flower development stage ...

  8. 17 CFR 256.403 - Depreciation and amortization expense.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Depreciation and amortization... UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.403 Depreciation and amortization expense. This account shall include the amount of depreciation and amortization for all service plant, and...

  9. Instruction sequence expressions for the secure hash algorithm SHA-256

    NARCIS (Netherlands)

    Bergstra, J.A.; Middelburg, C.A.

    2013-01-01

    The secure hash function SHA-256 is a function on bit strings. This means that its restriction to the bit strings of any given length can be computed by a finite instruction sequence that contains only instructions to set and get the content of Boolean registers, forward jump instructions, and a

  10. 38 CFR 3.256 - Eligibility reporting requirements.

    Science.gov (United States)

    2010-07-01

    ....256 Eligibility reporting requirements. (a) Obligation to report changes in factors affecting...) School enrollment status of a child 18 years of age or older; or (6) Any other factor that affects... circumstances: (i) If the Social Security Administration has not verified the beneficiary's Social Security...

  11. 17 CFR 256.01-6 - Departmental classification required.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-6 Departmental classification required. The importance of “salaries and wages” as an element of cost requires analysis of this item of expense... lines which will provide a readily available basis for analysis. ...

  12. 15 CFR 256.5 - Duration of projects.

    Science.gov (United States)

    2010-01-01

    ... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE FELLOWSHIPS AND RESEARCH ASSOCIATES RESEARCH ASSOCIATE PROGRAM § 256.5 Duration of projects. The work of a Research Associate is generally conducted on a full-time basis. Typically, Research Associates are in residence at NIST for 6 to 18 months; longer...

  13. 17 CFR 256.930.1 - General advertising expenses.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false General advertising expenses... UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.930.1 General advertising expenses. This account shall include the cost of materials used and expenses incurred in advertising and related activities...

  14. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  15. 6 CFR 25.6 - Procedures for designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ...-terrorism technologies. 25.6 Section 25.6 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.6 Procedures for designation of qualified anti-terrorism technologies. (a) Application Procedure. Any person, firm or other...

  16. 17 CFR 256.01-2 - Application to service companies doing business with nonassociate companies.

    Science.gov (United States)

    2010-04-01

    ... companies doing business with nonassociate companies. 256.01-2 Section 256.01-2 Commodity and Securities... COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-2 Application to service companies doing business with nonassociate companies. While this...

  17. 17 CFR 256.108 - Accumulated provision for depreciation and amortization of service company property.

    Science.gov (United States)

    2010-04-01

    ... depreciation and amortization of service company property. 256.108 Section 256.108 Commodity and Securities... Accounts: Assets and Other Debit Accounts § 256.108 Accumulated provision for depreciation and amortization... 403, Depreciation and amortization expense. (b) At the time of retirement of depreciable service...

  18. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  19. Decay properties of {sup 256-339}Ds superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

    2017-09-15

    The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

  20. On Possibility of Sorting of Electromagnetic Undulators HU256

    Science.gov (United States)

    Churkin, I.; Steshov, A.

    2007-01-01

    It is known that the magnetic parameters of the permanent and hybrid magnet undulators may be improved by sorting on basis of the magnetic measurements of individual magnetic blocks and applying of the optimization criteria. The procedure of sorting for the electromagnetic undulators HU256 is described in the article. The magnetic calculations of the individual dipoles and dipoles in "undulator environment" executed by means of Mermaid 3D Code and the magnetic measurements of the representative dipoles confirmed these magnetic calculations, and it allows us to get the main dependencies of the magnetic parameters of all dipoles from the mechanical characteristics (pole gap, yoke width, coil position). The criteria of optimization were conditions of weak influence of the insertion device on electron beam in the Storage Ring and high quality of undulator radiation. The 1st integral of the magnetic field and phase error have been minimized for sorting of the dipoles in undulators. The limitation of sorting connected with accuracy of mechanical measurements of individual dipoles is discussed.

  1. 42 CFR 422.256 - Review, negotiation, and approval of bids.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Review, negotiation, and approval of bids. 422.256... Information and Plan Approval § 422.256 Review, negotiation, and approval of bids. (a) Authority. Subject to... submitted under § 422.252 and conduct negotiations with MA organizations regarding these bids (including the...

  2. 31 CFR 256.52 - How does FMS issue a payment?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false How does FMS issue a payment? 256.52 Section 256.52 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... to 31 CFR part 208, Judgment Fund payments are to be made by electronic funds transfer (EFT). FMS...

  3. 17 CFR 256.430 - Interest on debt to associate companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Interest on debt to associate companies. 256.430 Section 256.430 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... by the accrual, the rate of interest and the principal amount of the advances or other obligations on...

  4. 17 CFR 256.457-1 - Direct costs charged to associate companies.

    Science.gov (United States)

    2010-04-01

    ... charged to associate companies. This account shall include those direct costs which can be identified through a work order system as being applicable to services performed for associate companies. This... associate companies. 256.457-1 Section 256.457-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

  5. 17 CFR 256.457-2 - Indirect costs charged to associate companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Indirect costs charged to associate companies. 256.457-2 Section 256.457-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY...

  6. 17 CFR 256.458-2 - Indirect costs charged to nonassociate companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Indirect costs charged to nonassociate companies. 256.458-2 Section 256.458-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPAN...

  7. 17 CFR 256.01-5 - Determination of service cost accounting.

    Science.gov (United States)

    2010-04-01

    ... accounting. Service at cost and fair allocation of costs require, first of all, an accurate accounting for... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Determination of service cost accounting. 256.01-5 Section 256.01-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  8. Incidental sinus abnormalities in 256 patients referred for brain MRI

    Directory of Open Access Journals (Sweden)

    Ghanaati H

    2007-06-01

    Full Text Available Background: Imaging abnormalities in the paranasal sinuses are regularly noted as incidental findings on MRI, however, little is known about their prevalence in the Iranian population. The purpose of this study was to classify these findings in the paranasal sinuses as seen on MRI and to investigate the prevalence, according to site and type of paranasal abnormality. Methods: In this cross-sectional study, the T2-weighted axial MRI of 256 patients with diseases unrelated to their paranasal sinuses were reviewed between May 2002 and June 2003. The findings were categorized according to the anatomic location and the imaging characteristics of the abnormality. The abnormalities recorded included total sinus opacification, mucoperiosteal thickening >5mm, air fluid levels and retention cysts or polyps. Unilateral or bilateral involvement and septal deviation were also noted. A sinus was considered normal if it was fully aerated and no soft-tissue density was apparent within the cavity. Results: Among our cases, 111 (43.5% were male and 145 (56.5% were female. Of these patients, abnormalities in one or more of the sinus groups were found in 110 subjects (42.9%, 55.5% of which were male and 44.5% were female (P=0.001. Maxillary sinus abnormalities were observed in 66.4% of the patients, while ethmoid sinus abnormalities were found in 63.6%. Of the ethmoid abnormalities, 21% were found in the anterior section, 9% in the middle ethmoid, and 8% in the posterior ethmoid. The most common abnormality found was mucosal thickening. Among our cases, 23.4% had septal deviation, which was significantly higher among those with sinusitis (29% versus 19.1%; P<0.01. Of those patients with sinus involvement, 16% were involved in the sphenoid sinus and 5% in the frontal sinus. The results obtained from the patients with sinus abnormality revealed that 85% suffered from cough, nasal obstruction, runny nose, facial pain and post nasal discharge and 24% had been diagnosed

  9. (abstract) Applications of Long-wavelength 256x256 GaAs/Al&subx;Ga&sub1-x;As Quantum Well Infrared Photodetector Hand-held Camera

    Science.gov (United States)

    Gunapala, S. D.; Bandara, S. V.; Liu, J. K.; Sundaram, M.; Hong, W.; Shott, C. A.; Hoelter, T.; Laband, S.; James, J. B.

    1997-01-01

    A 9 (micro)m 256x256 hand-held quantum well infrared photodetector (QWIP) camera has been demonstrated. Excellent imagery, with a noise equivalent differential temperature (NE(gamma)) of 26 mK has been achieved. In this presentation, we discuss the development of this very sensitive long wavelength infrared (LWIR) camera based on a GaAs/AlGaAs QWIP focal plane array, its performance in quantum efficience, NA(gamma), minimum resolvable temperature (MRTD), uniformity, operability, and its applications.

  10. High-Speed, Low Power 256 Channel Gamma Radiation Array Detector ASIC Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Building on prior success in detector electronics, we propose to design and fabricate a 256 channel readout ASIC for solid state gamma radiation array detectors...

  11. Biclique Cryptanalysis on the Full Crypton-256 and mCrypton-128

    Directory of Open Access Journals (Sweden)

    Junghwan Song

    2014-01-01

    Full Text Available Biclique cryptanalysis is an attack which reduces the computational complexity by finding a biclique which is a kind of bipartite graph. We show a single-key full-round attack of the Crypton-256 and mCrypton-128 by using biclique cryptanalysis. In this paper, 4-round bicliques are constructed for Crypton-256 and mCrypton-128. And these bicliques are used to recover master key for the full rounds of Crypton-256 and mCrypton-128 with the computational complexities of 2253.78 and 2126.5, respectively. This is the first known single-key full-round attack on the Crypton-256. And our result on the mCrypton-128 has superiority over known result of biclique cryptanalysis on the mCrypton-128 which constructs 3-round bicliques in terms of computational time complexity.

  12. Investigation of antioxidative and anticancer potentials of Streptomyces sp. MUM256 isolated from Malaysia mangrove soil

    Directory of Open Access Journals (Sweden)

    Tan Loh eTeng Hern

    2015-11-01

    Full Text Available A Streptomyces strain, MUM256 was isolated from Tanjung Lumpur mangrove soil in Malaysia. Characterization of the strain showed that it has properties consistent with those of the members of the genus Streptomyces. In order to explore the potential bioactivities, extract of the fermented broth culture of MUM256 was prepared with organic solvent extraction method. DPPH and SOD activity were utilized to examine the antioxidant capacity and the results have revealed the potency of MUM256 in superoxide anion scavenging activity in dose-dependent manner. The cytotoxicity of MUM256 extract was determined using cell viability assay against 8 different panels of human cancer cell lines. Among all the tested cancer cells, HCT116 was the most sensitive toward the extract treatment. At the highest concentration of tested extract, the result showed 2.3, 2.0 and 1.8 folds higher inhibitory effect against HCT116, HT29 and Caco-2 respectively when compared to normal cell line. This result has demonstrated that MUM256 extract was selectively cytotoxic towards colon cancer cell lines. In order to determine the constituents responsible for its bioactivities, the extract was then subjected to chemical analysis using GC-MS. The analysis resulted in the identification of chemical constituents including phenolic and pyrrolopyrazine compounds which may responsible for antioxidant and anticancer activities observed. Based on the findings of this study, the presence of bioactive constituents in MUM256 extract could be a potential source for the development of antioxidative and chemopreventive agents.

  13. Aquaporin-2 Ser-261 phosphorylation is regulated in combination with Ser-256 and Ser-269 phosphorylation.

    Science.gov (United States)

    Yui, Naofumi; Sasaki, Sei; Uchida, Shinichi

    2017-01-22

    Aquaporin-2 (AQP2) is a water channel in collecting duct principal cells in the kidney. Vasopressin catalyzes AQP2 phosphorylation at several serine sites in its C-terminus: Ser-256, Ser-261, and Ser-269. Upon stimulation by vasopressin, Ser-269 phosphorylation increases and Ser-261 phosphorylation decreases. Ser-256 phosphorylation is relatively constant. However, whether these types of phospho-regulation occur independently in distinct AQP2 populations or sequentially in the same AQP2 population is unclear. Especially, the manner of vasopressin-mediated Ser-261 phospho-regulation has been in controversy. In this study, we established phospho-specific AQP2 immunoprecipitation assays and investigated how pS256-positive AQP2 and pS269-positive AQP2 are catalyzed by forskolin or vasopressin, focusing on their Ser-261 phosphorylation status in polarized Madin-Darby canine kidney (MDCK) cells and in mice. In forskolin-treated MDCK cells, Ser-269 phosphorylation preceded Ser-261 dephosphorylation and Ser-256 phosphorylation was constant. In both MDCK cells and mouse kidney, phospho-specific immunoprecipitation revealed that the regulated Ser-269 phosphorylation occurred in the pS256-positive AQP2 population. Importantly, basal-state Ser-261 phosphorylation and its regulated dephosphorylation occurred in the pS256- and pS269-positive AQP2 population. These results provide the direct evidence that the Ser-261 dephosphorylation is involved in the pS256- and pS269-related AQP2 regulation. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  15. PERBANDINGAN APLIKASI MENGGUNAKAN METODE CAMELLIA 128 BIT KEY DAN 256 BIT KEY

    Directory of Open Access Journals (Sweden)

    Lanny Sutanto

    2014-01-01

    Full Text Available The rapid development of the Internet today to easily exchange data. This leads to high levels of risk in the data piracy. One of the ways to secure data is using cryptography camellia. Camellia is known as a method that has the encryption and decryption time is fast. Camellia method has three kinds of scale key is 128 bit, 192 bit, and 256 bit.This application is created using the C++ programming language and using visual studio 2010 GUI. This research compare the smallest and largest key size used on the file extension .Txt, .Doc, .Docx, .Jpg, .Mp4, .Mkv and .Flv. This application is made to comparing time and level of security in the use of 128-bit key and 256 bits. The comparison is done by comparing the results of the security value of avalanche effect 128 bit key and 256 bit key.

  16. Algebraic Cryptanalysis Scheme of AES-256 Using Gröbner Basis

    Directory of Open Access Journals (Sweden)

    Kaixin Zhao

    2017-01-01

    Full Text Available The zero-dimensional Gröbner basis construction is a crucial step in Gröbner basis cryptanalysis on AES-256. In this paper, after performing an in-depth study on the linear transformation and the system of multivariate polynomial equations of AES-256, the zero-dimensional Gröbner basis construction method is proposed by choosing suitable term order and variable order. After giving a detailed construction process of the zero-dimensional Gröbner basis, the necessary theoretical proof is presented. Based on this, an algebraic cryptanalysis scheme of AES-256 using Gröbner basis is proposed. Analysis shows that the complexity of our scheme is lower than that of the exhaustive attack.

  17. 30 CFR 256.52 - Bond requirements for an oil and gas or sulphur lease.

    Science.gov (United States)

    2010-07-01

    ... value. If its market value falls below the level of bond coverage required under this subpart, you must... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Bond requirements for an oil and gas or sulphur... OFFSHORE LEASING OF SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Bonding § 256.52 Bond...

  18. 40 CFR 256.02 - Scope of the State solid waste management plan.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.02 Scope of the State solid waste management plan. (a)(1) The... plan shall consider the following aspects of solid waste management: (i) Resource conservation; (ii...

  19. 30 CFR 256.70 - Extension of lease by drilling or well reworking operations.

    Science.gov (United States)

    2010-07-01

    ..., and Extensions § 256.70 Extension of lease by drilling or well reworking operations. The term of a lease shall be extended beyond the primary term so long as drilling or well reworking operations are... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Extension of lease by drilling or well...

  20. Genetic Fingerprinting of Wheat and Its Progenitors by Mitochondrial Gene orf256

    Directory of Open Access Journals (Sweden)

    Mona M. Elseehy

    2012-04-01

    Full Text Available orf256 is a wheat mitochondrial gene associated with cytoplasmic male sterility (CMS that has different organization in various species. This study exploited the orf256 gene as a mitochondrial DNA marker to study the genetic fingerprint of Triticum and Aegilops species. PCR followed by sequencing of common parts of the orf256 gene were employed to determine the fingerprint and molecular evolution of Triticum and Aegilops species. Although many primer pairs were used, two pairs of orf256 specific primers (5:-94/C: 482, 5:253/C: 482, amplified DNA fragments of 576 bp and 230 bp respectively in all species were tested. A common 500 bp of nine species of Triticum and Aegilops were aligned and showed consistent results with that obtained from other similar chloroplast or nuclear genes. Base alignment showed that there were various numbers of base substitutions in all species compared to S. cereal (Sc (the outgroup species. Phylogenetic relationship revealed similar locations and proximity on phylogenetic trees established using plastid and nuclear genes. The results of this study open a good route to use unknown function genes of mitochondria in studying the molecular relationships and evolution of wheat and complex plant genomes.

  1. Den danske Rødliste opdateret med 1.256 arter af planter og dyr

    DEFF Research Database (Denmark)

    Pedersen, Jens Christian; Wind, Peter

    2009-01-01

    I dag offentliggør Danmarks Miljøundersøgelser (DMU) ved Aarhus Universitet rødlistestatus for i alt 1.256 arteraf danske insekter, svampe og karplanter. Status viser at hver tredje af de arter hvor der findes tilstrækkelige data er kategoriseret som truet i mindre eller større grad eller som for...

  2. 40 CFR 256.26 - Requirement for schedules leading to compliance with the prohibition of open dumping.

    Science.gov (United States)

    2010-07-01

    ... compliance with the prohibition of open dumping. 256.26 Section 256.26 Protection of Environment... compliance with the prohibition of open dumping. In implementing the section 4005(c) prohibition on open dumping, the State plan shall provide that any entity which demonstrates that it has considered other...

  3. 40 CFR 256.27 - Recommendation for schedules leading to compliance with the prohibition of open dumping.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommendation for schedules leading to compliance with the prohibition of open dumping. 256.27 Section 256.27 Protection of Environment... to compliance with the prohibition of open dumping. In reviewing applications for compliance...

  4. Progress towards a 256 channel multi-anode microchannel plate photomultiplier system with picosecond timing.

    Science.gov (United States)

    Lapington, J S; Ashton, T J R; Ross, D; Conneely, T

    2012-12-11

    Despite the rapid advances in solid state technologies such as the silicon photomultiplier (SiPM), microchannel plate (MCP) photomultipliers still offer a proven and practical technological solution for high channel count pixellated photon-counting systems with very high time resolution. We describe progress towards a 256 channel optical photon-counting system using CERN-developed NINO and HTDC ASICs, and designed primarily for time resolved spectroscopy in life science applications. Having previously built and demonstrated a 18 mm diameter prototype tube with an 8×8 channel readout configuration and detector and electronics design and operation, and present performance measurements from the 256 channel development system. We discuss enhancements to the system including higher channel count and the use of application specific on-board signal processing capabilities.

  5. Binary fragmentation based studies for the near super-heavy compound nucleus {sup 256}Rf

    Energy Technology Data Exchange (ETDEWEB)

    Thakur, Meenu; Behera, B.R.; Mahajan, Ruchi; Kaur, Gurpreet; Sharma, Priya; Kapoor, Kushal; Rani, Kavita [Panjab University, Department of Physics, Chandigarh (India); Saneesh, N.; Dubey, R.; Yadav, A.; Sugathan, P.; Jhingan, A.; Chatterjee, A.; Chatterjee, M.B. [Inter University Accelerator Centre, New Delhi (India); Kumar, Neeraj; Mandal, S. [University of Delhi, Department of Physics and Astrophysics, Delhi (India); Kumar, S. [Andhra University, Department of Nuclear Physics, Visakhapatnam (India); Saxena, A.; Kailas, S. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India); Pal, Santanu [CS, Kolkata (India); Nasirov, Avazbek [JINR, Bogoliubov Laboratory of Theoretical Physics, Dubna (Russian Federation); National University, Department of Physics, Tashkent (Uzbekistan); Kayumov, Bakhodir [National University, Department of Physics, Tashkent (Uzbekistan)

    2017-06-15

    Binary fragmentation of the near super-heavy compound nucleus {sup 256}Rf has been studied through the reaction {sup 48}Ti + {sup 208}Pb at a bombarding energy well above the Coulomb barrier. For a better understanding of its reaction dynamics, the mass distribution, mass-energy distribution and mass-angle distribution of the fission fragments produced from {sup 256}Rf have been investigated thoroughly. The masses and kinetic energies of the fission fragments were reconstructed event-by-event from their measured velocities and emission angles. From the mass-energy analysis, a sizeable contribution from the asymmetric fission was observed on the edges of symmetric mass distribution. Evidence of asymmetric fission was also clued from the observed correlation between the masses and emission angles of the fission fragments. Contribution of the quasi-fission products has also been estimated by performing the theoretical dinuclear system calculations. (orig.)

  6. Evaluation of Bone Cancer Pain Induced by Different Doses of Walker 256 Mammary Gland Carcinoma Cells.

    Science.gov (United States)

    Dong, Changsheng; Wu, RuiXin; Wu, Jing; Guo, Jing; Wang, Fangyuan; Fu, Yanli; Wang, Qing; Xu, Ling; Wang, Juyong

    2016-01-01

    Cancer pain is a complex medical syndrome. Understanding its underlying mechanisms relies on the use of animal models which can mimic the human condition. A crucial component of this model is the quantity of tumor cells; however, the exact relationship between the doses of tumor cells on bone cancer pain is yet unknown. We explored the relationship of different doses of Walker 256 carcinoma cells using a bone cancer pain model in rats, and evaluated its success and stability. Experimental animal study using a comparative design. Experimental Animal Center and Tumor Institute of Traditional Chinese Medicine. We constructed the bone cancer pain model by implanting Walker 256 carcinoma cells into the right tibia of Sprague-Dawley (SD) rats (150 - 170 g). Spontaneous pain, mechanical threshold, and paw withdrawal latency (PWL) were measured and x-ray, bone mineral density (BMD), histological, interleukin-1 beta (IL-1beta) mRNA, carboxyterminal telopeptide of type I collagen (ICTP), and bone alkaline phosphatase (BAP) were analyzed for bone pain model evaluation. The results showed that: (1) the 3 doses (3×105, 3.5×105, 4×105) of Walker 256 carcinoma cells can induce bone cancer pain from day 7 to day 21 after implantation into the right tibia of SD rats; (2) compared to the control group, 3×105, 3.5×105, and 4×105 Walker 256 carcinoma cells produced different pain manifestations, where the 3.5×105 dose of Walker 256 carcinoma cells resulted in the greatest bone cancer pain response; (3) the 3.5×105 dose induced the lowest mortality rate in rats; (4) Walker 256 carcinoma cells (3×105, 3.5×105, and 4×105) resulted in a significant decrease in the general condition and body weight of rats, where the 3.5×105 and 4×105 doses of carcinoma cells produced a greater effect than 3×105 dose of carcinoma cells; (5) progressive spontaneous pain, PWL, and mechanical threshold were exacerbated by 3.5×105 and 4×105 doses of carcinoma cells; (6) implantation of 3.5×105

  7. Influence of ciprofloxacin and vancomycin on mutation rate and transposition of IS256 in Staphylococcus aureus.

    Science.gov (United States)

    Nagel, Michael; Reuter, Tina; Jansen, Andrea; Szekat, Christiane; Bierbaum, Gabriele

    2011-03-01

    In Staphylococcus aureus, the development of intermediate resistance to vancomycin is due to an accumulation of mutations. To elucidate the mechanisms involved here, a standard laboratory strain (S. aureus HG001) and a clinical MRSA mutator strain (S. aureus SA1450/94, which is characterized by a spontaneous insertion of IS256 into the gene of the mismatch repair enzyme MutS) were incubated at subinhibitory concentrations of ciprofloxacin and vancomycin. Ciprofloxacin increased the mutation rates of both strains, but this effect was inhibited when the SOS response was blocked by the presence of a non-cleavable variant of the LexA repressor. In the presence of vancomycin, the mutation rate was slightly elevated in the mutator strain, and this increase also depended on the strain's ability to induce the SOS response. Furthermore, treatment with subinhibitory concentrations of both antibiotics resulted in an activation of transposition frequency of the insertion element IS256 in S. aureus HG001. Transposition was dependent on the presence of a functional transposase, and the activation of transposition depended on the presence of the functional phosphatase RsbU, which activates SigB transcription activity. An in silico analysis indicated a putative antisense sigma B promoter sequence within the transposase gene. Scrambling of this promoter resulted in an about 20-fold activation of transposition activity of IS256. These data indicate that sigma B is involved in the regulation of IS256 activity by generation of an antisense RNA. Copyright © 2010 Elsevier GmbH. All rights reserved.

  8. Nonlinear Phase Noise Compensation in Experimental WDM Systems with 256QAM

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2017-01-01

    Nonlinear phase noise (NLPN) is studied in an experimental wavelength division multiplexed (WDM) system operating at 256QAM. Extremely narrow linewidth lasers (... on the experimental data, the autocorrelation function of the NLPN is estimated and it matches the theoretical predictions. Several algorithms are examined as candidates for tracking and compensating the NLPN. It is shown that algorithms which exploit the distribution of the NLPN achieve higher gains than standard...

  9. Performance of a 256 pad hybrid photon detector for ring imaging

    Science.gov (United States)

    Chesi, E.; Martinengo, P.; Weilhammer, P.; Roe, S.; Jobez, J. P.; Seguinot, J.; Ypsilantis, T.; Dulinski, W.; Zichichi, A.

    1997-02-01

    We report a detailed experimental investigation of a proximity focused HPD with 256 pads of 4 × 4 mm 2 for applications to RICH detectors. A signal to noise ratio of 16 is obtained for single photoelectrons with a low noise (ENC ≤ 200 e) front-end electronics and 15.7 kV acceleration voltage. A single photoelectron detection efficiency of 95% is achieved with about 1% bias from electron back scattering.

  10. Performance of a 256 pad hybrid photon detector for ring imaging

    CERN Document Server

    Chesi, Enrico Guido; Roe, S; Weilhammer, Peter; Jobez, J P; Séguinot, Jacques; Ypsilantis, Thomas; Dulinski, W

    1997-01-01

    We report a detailed experimental investigation of a proximity focused JiIPD with 256 pads of 4 x 4 mm2 for applications on RICH detectors. A signal to noise ratio of 16 is obtained for single photoelectrons with a low noise (ENC I 200 e) front-end electronics and 15.7 kV acceleration voltage. A single photoelectron detection efficiency of 95% is achieved with about 1% bias from electron back scattering.

  11. Protective Effect of Metformin Against Walker 256 Tumor Growth is Not Dependent on Metabolism Improvement

    Directory of Open Access Journals (Sweden)

    Claudinéia Conationi da Silva Franco

    2014-11-01

    Full Text Available Background/Aims: The objective of the current work was to test the effect of metformin on the tumor growth in rats with metabolic syndrome. Methods: We obtained pre-diabetic hyperinsulinemic rats by neonatal treatment with monosodium L-glutamate (MSG, which were chronically treated every day, from weaning to 100 day old, with dose of metformin (250 mg/kg body weight. After the end of metformin treatment, the control and MSG rats, treated or untreated with metformin, were grafted with Walker 256 carcinoma cells. Tumor weight was evaluated 14 days after cancer cell inoculation. The blood insulin, glucose levels and glucose-induced insulin secretion were evaluated. Results: Chronic metformin treatment improved the glycemic homeostasis in pre-diabetic MSG-rats, glucose intolerance, tissue insulin resistance, hyperinsulinemia and decreased the fat tissue accretion. Meanwhile, the metformin treatment did not interfere with the glucose insulinotropic effect on isolated pancreatic islets. Chronic treatment with metformin was able to decrease the Walker 256 tumor weight by 37% in control and MSG rats. The data demonstrated that the anticancer effect of metformin is not related to its role in correcting metabolism imbalances, such as hyperinsulinemia. However, in morphological assay to apoptosis, metformin treatment increased programmed cell death. Conclusion: Metformin may have a direct effect on cancer growth, and it may programs the rat organism to attenuate the growth of Walker 256 carcinoma.

  12. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  13. Modelo experimental de tumor na cavidade oral de ratos com carcinossarcoma de Walker 256 Experimental model of Walker 256 carcinosarcoma developed in the oral cavity of rats

    Directory of Open Access Journals (Sweden)

    Ana Paula Negreiros Nunes Alves

    2004-08-01

    Full Text Available OBJETIVO: Estabelecer um modelo experimental de desenvolvimento tumoral na cavidade oral de ratos, permitindo, assim, o estudo da osteólise induzida pelo tumor nos ossos do complexo maxilomandibular como também nas estruturas dentais, através da caracterização histomorfológica da reabsorção óssea e dentária. MÉTODOS: Uma suspensão de células tumorais (0,1mL do Carcinossarcoma de Walker 256, na concentração de 10(6 células/mL foi implantado na cavidade alveolar de ratos previamente aberta por exodontia. Os animais foram observados durante 12 (doze dias consecutivos para determinação da curva de peso corpóreo, sendo posteriormente sacrificados e as mandíbulas removidas para exames radiográfico e histológico. RESULTADOS: No exame radiográfico foi verificada área lítica, sem evidência de reparo, na região dos alvéolos. No exame microscópico foi identificada infiltração óssea, periférica e central, de pequenas células hipercromáticas e pleomórficas, com leve infiltrado inflamatório mononuclear associado e áreas de necrose. O índice de pega foi de 100%. CONCLUSÃO: O modelo animal de invasão óssea, do tumor de Walker na cavidade oral, possibilita a avaliação in vivo de drogas antitumorais e esquemas terapêuticos no tratamento do câncer bucal.PURPOSE: To estabilish an experimental model of tumor development in the oral cavity of rats, that would enable to study the tumor-induced autolysis in the maxillomandibular bone complex as well as of the dental structures, through histomorphological characterization of bone and dental resorption. METHODS: Walker 256 carcinossarcoma cell suspension (0,1 mL containing 10(6 cell/mL was implanted in the alveoli of first and second molars. The animals were observed during twelve consecutive days and the body weigth were determined. Later, the animals were sacrificed and their mandibles removed to radiographic and hystologic analysis. RESULTS: The radiographic image

  14. Relating induced changes in EEG signals to orientation of visual stimuli using the ESI-256 machine.

    Science.gov (United States)

    Suarez, E; Viegas, M D; Adjouadi, M; Barreto, A

    2000-01-01

    The focus of this study is to investigate the relations that exist between changes in the orientation of simple visual stimuli displayed to a subject and the induced changes in brain activity recorded as EEG signals. These signals are recorded using the Electric Source Imaging with 256 electrodes (ESI-256). The 256-channel EEG signals of four subjects were measured monopolarly. Each subject was stimulated visually for approximately 7.5 minutes. The stimuli consisted of a series of 300 images depicting four basic orientations of a simple graphical element: a white bar on a black background, with each one of the four orientations (horizontal, vertical, +45 degrees and -45 degrees) shown a total of 75 times in a random order. The notion of missing information under certain orientations is not addressed at this juncture. The EEG signals produced by each subject were recorded in a continuous mode using a sampling rate of 1 kHz. Pre-processing of the raw EEG data obtained consisted of epoching, exclusion of faulty electrodes, and reduction of electro-oculogram (EOG) noise due to eye blinks. Topographical maps displaying brain activities and their individual electrode recordings are used as two different means for assessing these changes. It is important to note that the simplicity of the visual stimuli was considered in view of the massive data collected for interpretation. Our goal is to observe and determine new measures that would allow for the quantification and interpretation of such EEG brain activities. Such findings might prove useful for the later use of more complex stimuli and the potential development of size and orientation independent algorithms in image processing.

  15. Robust spinal neuroinflammation mediates mechanical allodynia in Walker 256 induced bone cancer rats

    Directory of Open Access Journals (Sweden)

    Mao-Ying Qi-Liang

    2012-05-01

    Full Text Available Abstract It has been reported that remarkable and sustained activation of astrocytes and/or microglia occurs in cancer induced pain (CIP, which is different from neuropathic and inflammatory pain. The present study was designed to investigate the role of spinal Toll-like receptor 4 (TLR4 induced glial neuroinflammation in cancer induced pain using a modified rat model of bone cancer. The rat model of CIP consisted of unilateral intra-tibial injection with Walker 256 mammary gland carcinoma. Nine days after Walker 256 inoculation, a robust activation of both astrocytes and microglia in bilateral spinal dorsal horn was observed together with significant bilateral mechanical allodynia. This neuroinflammation was characterized by enhanced immunostaining of both glial fibrillary acidic protein (GFAP, astrocyte marker and OX-42 (microglia marker, and an elevated level of IL-1β, IL-6 and TNF-α mRNA. I.t. administration of fluorocitrate (an inhibitor of glial metabolism, 1 nmol or minocycline (an inhibitor of microglia, 100 μg has significant anti-allodynic effects on day 12 after Walker 256 inoculation. Naloxone (a nonstereoselective TLR4 signaling blocker, 60 μg, i.t. also significantly alleviated mechanical allodynia and simultaneously blocked the increased inflammatory cytokine mRNA. The results suggested that spinal TLR4 might play an important role in the sustained glial activation that critically contributed to the robust and sustained spinal neuroinflammation in CIP. This result could potentially help clinicians and researchers to better understand the mechanism of complicated cancer pain.

  16. The influence of septal lesions on sodium and water retention induced by Walker 256 tumor

    Directory of Open Access Journals (Sweden)

    F. Guimarães

    1999-03-01

    Full Text Available In the course of studies on the effects of septal area lesions on neuroimmunomodulation and Walker 256 tumor development, it was observed that tumor-induced sodium and water retention was less marked in lesioned than in non-lesioned rats. In the present study possible mechanisms involved in this phenomenon were investigated. The experiments were performed in septal-lesioned (LW; N = 15 and sham-operated (SW; N = 7 8-week-old male Wistar rats, which received multifocal simultaneous subcutaneous (sc inoculations of Walker 256 tumor cells about 30 days after the stereotaxic surgery. Control groups (no tumor, sham-operated food-restricted (SFR, N = 7 and lesioned food-restricted (LFR, N = 10 were subjected to a feeding pattern similar to that observed in tumor-bearing animals. Multifocal inoculation of Walker 256 tumor rapidly induces anorexia, which is paradoxically accompanied by an increase in body weight, as a result of renal Na+ and fluid retention. These effects of the tumor were also seen in LW rats, although the rise in fractional sodium balance during the early clinical period was significantly smaller than in SW rats (day 4: SW = 47.6 ± 6.4% and LW = 13.8 ± 5.2%; day 5: SW = 57.5 ± 3.5% and LW = 25.7 ± 4.8%; day 6: SW = 54.4 ± 3.8% and LW = 32.1 ± 4.4%; P<0.05, suggesting a temporary reduction in tumor-induced sodium retention. In contrast, urine output was significantly reduced in SW rats and increased in LW rats (LW up to -0.85 and SW up to 4.5 ml/100 g body weight, with no change in osmolar excretion. These temporary changes in the tumor's effects on LW rats may reflect a "reversal" of the secondary central antidiuretic response induced by the tumor (from antidiuretic to diuretic.

  17. In vitro evaluation of 56 coronary artery stents by 256-slice multi-detector coronary CT

    Energy Technology Data Exchange (ETDEWEB)

    Steen, Henning, E-mail: henning.steen@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Andre, Florian, E-mail: Florian.Andre@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Korosoglou, Grigorios, E-mail: Grigorios.Korosoglou@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Mueller, Dirk, E-mail: Dirk.Mueller@philips.com [Philips GmbH Healthcare Division, Luebeckertordamm 5, Hamburg 20099 (Germany); Hosch, Waldemar, E-mail: Waldemar.Hosch@med.uni-heidelberg.de [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Kauczor, Hans-Ulrich, E-mail: Hans-Ulrich.Kauczor@med.uni-heidelberg.de [University of Heidelberg, Department of Diagnostic and Interventional Radiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Giannitsis, Evangelos, E-mail: Evangelos.Giannitsis@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany); Katus, Hugo A., E-mail: Hugo.Katus@med.uni-heidelberg.de [University of Heidelberg, Department of Cardiology, Im Neuenheimer Feld 410, Heidelberg 69120 (Germany)

    2011-10-15

    Objective: We sought to investigate stent lumen visibility of 56 coronary stents with the newest 256-multi-slice-CT (256-MDCT) technology for different reconstruction algorithms in an in vitro model. Background: Early identification of in-stent restenosis (ISR) is important to avoid recurrent ischemia and prevent acute myocardial infarction (AMI). Since angiography has the disadvantage of high costs and its invasiveness, MDCT could be a convenient and safe non-invasive alternative for detection of ISR. Material and methods: Percentages of in-stent lumen diameter and in-stent signal attenuation (measured as contrast-to-noise ratio (CNR)) of 56 coronary stents (group A {<=}2.5 mm; group B = 2.75-3.0 mm; group C = 3.5-4.0 mm) were evaluated in a coronary vessel in vitro phantom (iodine-filled plastic tubes) employing four different reconstruction algorithms (XCD, CC, CD, XCB) on a novel 256-MDCT (Philips-iCT, collimation = 128 mm x 0.625 mm; rotation time = 270 ms; tube current = 800 mA s with 120 kV). Analysis was conducted with the semi-automatical full-width-at-half-maximum (FWHM) method. P-values <0.05 were regarded statistically significant. Results: In-stent lumen diameter >60% for group C stents was significantly larger and CNR was significantly lower (both p < 0.05) for sharp kernels (CD; XCD) when compared to groups A/B. The FWHM-method showed significantly smaller in-stent lumen diameter (p < 0.05) when compared to the manual method. Conclusion: 256-MDCT could potentially be employed for clinical assessment of stent patency in stents >3.0 mm when analysed with cardio-dedicated sharp kernels, although clinical studies corroborating this claim should be performed. However, stents {<=}3.0 mm reconstructed by soft kernels revealed insufficient in-stent lumen visualisation and should not be used in clinical practice. Further improvements in spatial and temporal image resolution as well as reductions of radiation exposure and image noise have to be accomplished

  18. Optimized Configurable Architectures for Scalable Soft-Input Soft-Output MIMO Detectors with 256-QAM

    OpenAIRE

    Mansour, Mohammad M.; Louay M. A. Jalloul

    2015-01-01

    This paper presents an optimized low-complexity and high-throughput multiple-input multiple-output (MIMO) signal detector core for detecting spatially-multiplexed data streams. The core architecture supports various layer configurations up to 4, while achieving near-optimal performance, as well as configurable modulation constellations up to 256-QAM on each layer. The core is capable of operating as a soft-input soft-output log-likelihood ratio (LLR) MIMO detector which can be used in the con...

  19. Terezine derivatives from the fungus Phoma herbarum PSU-H256.

    Science.gov (United States)

    Maha, Athip; Rukachaisirikul, Vatcharin; Saithong, Saowanit; Phongpaichit, Souwalak; Poonsuwan, Wimarak; Sakayaroj, Jariya; Saparpakorn, Patchreenart; Hannongbua, Supa

    2016-02-01

    Investigation of the fungus Phoma herbarum PSU-H256 isolated from a leaf of Hevea brasiliensis resulted in the isolation of eight terezine derivatives (E-L) together with four known compounds. Their structures were established by analysis of spectroscopic evidence. For terezines E and H, their structures were confirmed by single-crystal X-ray diffraction crystallography. In addition, the absolute configuration at C-7 in terezine E was established by Mosher's method. Terezines K and L were tested for antibacterial, antimalarial, antimycobacterial and cytotoxic activities, but were inactive. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Structural Variations of Human Glucokinase Glu256Lys in MODY2 Condition Using Molecular Dynamics Study

    Directory of Open Access Journals (Sweden)

    Nanda Kumar Yellapu

    2013-01-01

    Full Text Available Glucokinase (GK is the predominant hexokinase that acts as glucose sensor and catalyses the formation of Glucose-6-phosphate. The mutations in GK gene influence the affinity for glucose and lead to altered glucose levels in blood causing maturity onset diabetes of the young type 2 (MODY2 condition, which is one of the prominent reasons of type 2 diabetic condition. In view of the importance of mutated GK resulting in hyperglycemic condition, in the present study, molecular dynamics simulations were carried out in intact and 256 E-K mutated GK structures and their energy values and conformational variations were correlated. Energy variations were observed in mutated GK (3500 Kcal/mol structure with respect to intact GK (5000 Kcal/mol, and it showed increased γ-turns, decreased β-turns, and more helix-helix interactions that affected substrate binding region where its volume increased from 1089.152 Å2 to 1246.353 Å2. Molecular docking study revealed variation in docking scores (intact = −12.199 and mutated = −8.383 and binding mode of glucose in the active site of mutated GK where the involvement of A53, S54, K56, K256, D262 and Q286 has resulted in poor glucose binding which probably explains the loss of catalytic activity and the consequent prevailing of high glucose levels in MODY2 condition.

  1. One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography

    Energy Technology Data Exchange (ETDEWEB)

    Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Kyushu University, Department of Molecular Imaging and Diagnosis, Graduate School of Medical Sciences, Fukuoka (Japan); Sakamoto, Ichiro [Kyushu University, Department of Cardiovascular Medicine, Graduate School of Medical Sciences, Fukuoka (Japan); Yamamura, Kenichiro [Kyushu University, Department of Pediatrics, Graduate School of Medical Sciences, Fukuoka (Japan); Yabuuchi, Hidetake [Kyushu University, Department of Health Sciences, Graduate School of Medical Sciences, Fukuoka (Japan)

    2017-02-15

    To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)

  2. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  3. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  4. The oophorectomy effect on Walker 256 tumor inoculated into the vagina and uterine cervix of female rats Efeito da ooforectomia no tumor de Walker 256 inoculado em vagina e colo de útero de ratos fêmeas

    Directory of Open Access Journals (Sweden)

    Nara Macedo Botelho Brito

    2009-02-01

    Full Text Available PURPOSE: Verify the effect of oophorectomy on the evolution of the Walker 256 tumor inoculated into the vagina and cervix of female rats. METHODS: Ten Wistar, female rats were used, distributed into two groups with 05 animals each: Tumor group (TG: Rats inoculated with Walker 256 tumor; Oophorectomy group (OG: oophorectomized rats inoculated with Walker 256 tumor. The day before the tumor vaginal inoculation, acetic acid was inoculated into the vaginas of both groups of rats; the following day, the vaginal walls were scarified with an endocervix brush, and then Walker 256 tumor was inoculated. After 12 days, the tumor was removed together with the vagina and uterine horns for macro and microscopic analyses. The data were submitted to statistical analyses. RESULTS: There was no statistical difference between the two groups; however it was observed that the behavior of tumor growth on the OG group presented greater invasion, compromising the uterine horns. CONCLUSION: The results of the study on the GO group presented a macroscopic behavior different from the TG group, however, both of them presented similar development in terms of tumor mass.OBJETIVO: Verificar o efeito da ooforectomia à inoculação do tumor de Walker 256 em vagina e colo de útero de ratas. MÉTODOS: Foram utilizadas 10 ratas Wistar, fêmeas, virgens, adultas, distribuídas em dois grupos de estudo com 05 animais cada: grupo tumor (GT: ratas inoculadas com tumor de Walker 256, e grupo Ooforectomia (GO: ratas ooforectomizadas e inoculadas com tumor de Walker 256. No dia anterior à inoculação vaginal do tumor, foram inoculados 0,3ml de ácido acético na vagina das ratas de ambos os grupos; no dia seguinte, foi realizada a escarificação da parede vaginal com uma escova de endocérvice e inoculado tumor de Walker 256. Após 12 dias, foi removido o tumor em bloco com vagina e cornos uterinos para análise macro e microscópica. Os dados foram submetidos à análise estat

  5. Fabrication and total dose testing of a 256K x 1 radiation-hardened SRAM

    Science.gov (United States)

    Kushner, R. A.; Kohler, R. A.; Steenwyk, S. D.; Desko, J. C.; Alchesky, L. C.

    1988-12-01

    A 256K x 1 radiation-hard SRAM and the process enhancements that resulted in its successful fabrication are described, and total-dose-exposure results are presented. Typical performance values include an address-activated access time of 36 nsec and a write time of 34 nsec. Soft-error studies predict the memory cell to be SEU-insensitive, and rail-span collapse simulations estimate transient dose immunity to greater than 4 Grad(Si)/sec. The technology used was a standard 1.0-micron two-level metal, non-SORT CMOS, radiation-hard process. SORT (selective oxidation to reduce topography) is a process that uses silicon nitride masking of active device areas during field oxide growth to reduce vertical dimensions. To improve reliability and cosmetic quality, the process has been modified to provide about 50-percent metal step coverage at both metal levels.

  6. Optimized Configurable Architectures for Scalable Soft-Input Soft-Output MIMO Detectors With 256-QAM

    Science.gov (United States)

    Mansour, Mohammad M.; Jalloul, Louay M. A.

    2015-09-01

    This paper presents an optimized low-complexity and high-throughput multiple-input multiple-output (MIMO) signal detector core for detecting spatially-multiplexed data streams. The core architecture supports various layer configurations up to 4, while achieving near-optimal performance, as well as configurable modulation constellations up to 256-QAM on each layer. The core is capable of operating as a soft-input soft-output log-likelihood ratio (LLR) MIMO detector which can be used in the context of iterative detection and decoding. High area-efficiency is achieved via algorithmic and architectural optimizations performed at two levels. First, distance computations and slicing operations for an optimal 2-layer maximum a posteriori (MAP) MIMO detector are optimized to eliminate the use of multipliers and reduce the overhead of slicing in the presence of soft-input LLRs. We show that distances can be easily computed using elementary addition operations, while optimal slicing is done via efficient comparisons with soft decision boundaries, resulting in a simple feed-forward pipelined architecture. Second, to support more layers, an efficient channel decomposition scheme is presented that reduces the detection of multiple layers into multiple 2-layer detection subproblems, which map onto the 2-layer core with a slight modification using a distance accumulation stage and a post-LLR processing stage. Various architectures are accordingly developed to achieve a desired detection throughput and run-time reconfigurability by time-multiplexing of one or more component cores. The proposed core is applied as well to design an optimal multi-user MIMO detector for LTE. The core occupies an area of 1.58MGE and achieves a throughput of 733 Mbps for 256-QAM when synthesized in 90 nm CMOS.

  7. Product Improvement Program to Increase the Nerve Agent Sensitivity of the M256 Chemical Agent Detector Kit

    Science.gov (United States)

    1987-06-01

    with the product- improved M256El kit using eel enzyme as a component of the nerve agent detectio system are desc r i bed in this report. The te sts...the Technical Data Package for the M256E1 kit. 14 &mtm&ms^^ LITERATURE CITED 1. Materiel Need ( Enginnering Development) MN (ED...5066 Director U.S. Army Materiel Systems Analysis Activity ATTN: AMXSY-CR (Mrs. F. Liu) AMXSY-GC (Mr. F. Campbell) AMXSY-MP (Mr. H

  8. Full-duplex transmission of 256-QAM WiMAX signals over an 80-km long-reach PON

    DEFF Research Database (Denmark)

    Prince, Kamau; Osadchiy, Alexey Vladimirovich; Tafur Monroy, Idelfonso

    2009-01-01

    We present bi-directional transmission of WiMAXcompliant signaling over an 80-km PON, using a single optical wavelength. Colorless, bi-directional transmission of 256-QAM modulation on a 2.4-GHz RF carrier was achieved at 100- Mb/s (downlink) and 64-Mb/s (uplink).......We present bi-directional transmission of WiMAXcompliant signaling over an 80-km PON, using a single optical wavelength. Colorless, bi-directional transmission of 256-QAM modulation on a 2.4-GHz RF carrier was achieved at 100- Mb/s (downlink) and 64-Mb/s (uplink)....

  9. Experimental analysis of pilot-based equalization for probabilistically shaped WDM systems with 256QAM/1024QAM

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Porto da Silva, Edson; Da Ros, Francesco

    2017-01-01

    Pilot based equalization is studied in a 5x10 Gbaud WDM transmission experiment. The equalization is independent of the modulation format and is demonstrated for 256/1024QAM with uniform and probabilistically optimized distribution using an optimized pilot insertion rate of 2-5%.......Pilot based equalization is studied in a 5x10 Gbaud WDM transmission experiment. The equalization is independent of the modulation format and is demonstrated for 256/1024QAM with uniform and probabilistically optimized distribution using an optimized pilot insertion rate of 2-5%....

  10. Demonstration of DFT-spread 256QAM-OFDM signal transmission with cost-effective directly modulated laser.

    Science.gov (United States)

    Li, Fan; Yu, Jianjun; Fang, Yuan; Dong, Ze; Li, Xinying; Chen, Lin

    2014-04-07

    We experimentally demonstrated a 256-ary quadrature amplitude modulation (256QAM) direct-detection optical orthogonal frequency division multiplexing (DDO-OFDM) transmission system utilizing a cost-effective directly modulated laser (DML). Intra-symbol frequency-domain averaging (ISFA) is applied to suppress in-band noise while the channel response estimation and Discrete Fourier Transform-spread (DFT-spread) is used to reduce the peak-to-average power ratio (PAPR) of the transmitted OFDM signal. The bit-error ratio (BER) of 15-Gbit/s 256QAM-OFDM signal has been measured after 20-km SSMF transmission that is less than 7% forward-error-correction (FEC) threshold of 3.8 × 10(-3) as the launch power into fiber is set at 6dBm. For 11.85-Gbit/s 256QAM-OFDM signal, with the aid of ISFA-based channel estimation and PAPR reduction enabled by DFT-spread, the BER after 20-km SSMF transmission can be improved from 6.4 × 10(-3) to 6.8 × 10(-4) when the received optical power is -6dBm.

  11. 32 CFR 256.9 - Real estate interests to be considered for clear zones and accident potential zone.

    Science.gov (United States)

    2010-07-01

    ...) of this section. (l) The right to disapprove land uses not in accordance with § 256.8. (m) The right... to make low and frequent flights over said land and to generate noises associated with: (1) Aircraft in flight, whether or not while directly over said land, (2) Aircraft and aircraft engines operating...

  12. An Evaluation and Development Environment for an ARM7-Based Autopilot Using the Atmel SAM7S256 Microcontroller

    Science.gov (United States)

    2009-08-01

    size. These microcontrollers provide more computational ability than smaller Microchip peripheral interface controllers or AVR microcontrollers , while...An Evaluation and Development Environment for an ARM7-Based Autopilot Using the Atmel SAM7S256 Microcontroller by Justin L. Shumaker and... Microcontroller Justin L. Shumaker Vehicle Technology Directorate, ARL Ainsmar X. Brown National Institute of Aerospace

  13. Gas chromatographic determination of chlorothalonil and its metabolite 4-hydroxy-2,5,6-trichloroisophtalonitrile (HTI) in water

    NARCIS (Netherlands)

    Doorn, C. van; Vink, M.; Poll, J.M. van der

    1995-01-01

    A gas chromatographic method, with electron capture detection and mass spectrometric confirmation, is described for the determination of chlorothalonil and its metabolite 4-hydroxy-2,5,6-trichloroisophtalonitrile (HTI) in water samples. Water is saturated with sodium chloride and acidified to pH < 2

  14. Spatial mapping and statistical reproducibility of an array of 256 one-dimensional quantum wires

    Energy Technology Data Exchange (ETDEWEB)

    Al-Taie, H., E-mail: ha322@cam.ac.uk; Kelly, M. J. [Centre for Advanced Photonics and Electronics, Electrical Engineering Division, Department of Engineering, 9 J. J. Thomson Avenue, University of Cambridge, Cambridge CB3 0FA (United Kingdom); Cavendish Laboratory, Department of Physics, University of Cambridge, J. J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Smith, L. W.; Lesage, A. A. J.; Griffiths, J. P.; Beere, H. E.; Jones, G. A. C.; Ritchie, D. A.; Smith, C. G. [Cavendish Laboratory, Department of Physics, University of Cambridge, J. J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom); See, P. [National Physical Laboratory, Hampton Road, Teddington, Middlesex TW11 0LW (United Kingdom)

    2015-08-21

    We utilize a multiplexing architecture to measure the conductance properties of an array of 256 split gates. We investigate the reproducibility of the pinch off and one-dimensional definition voltage as a function of spatial location on two different cooldowns, and after illuminating the device. The reproducibility of both these properties on the two cooldowns is high, the result of the density of the two-dimensional electron gas returning to a similar state after thermal cycling. The spatial variation of the pinch-off voltage reduces after illumination; however, the variation of the one-dimensional definition voltage increases due to an anomalous feature in the center of the array. A technique which quantifies the homogeneity of split-gate properties across the array is developed which captures the experimentally observed trends. In addition, the one-dimensional definition voltage is used to probe the density of the wafer at each split gate in the array on a micron scale using a capacitive model.

  15. Morphologic classification of the right auricule on 256-slice computed tomography.

    Science.gov (United States)

    Li, Cai-Ying; Gao, Bu-Lang; Pan, Tong; Xiang, Cheng; Liu, Xiao-Wei; Yang, Hai-Qing; Yi, Lan-Ying; Liao, Qi-Bin

    2017-06-01

    To investigate the shape of right auricule on 256-slice computed tomography (CT). Five hundred people (250 men, age range 16-84 years) who had cardiac multidetector CT angiography were recruited in this study. All patients had normal sinus rhythm with normal blood pressure (right auricule was studied and compared after reconstruction of the raw images. All patients successfully had cardiac CT angiography (100%), and the right auricule morphology was divided into five types and nine subtypes, including Type I of triangular shape (Ia and Ib), Type II of M shape (IIa and IIb), Type III of L shape (IIIa and IIIb), Type IV of reverse L shape (IVa and IVb), and Type V of balanced shape. The most common type of right auricule is Type IV (28.4%) followed by Type II (24.0%), whereas the least common is Type V (11.0%). Type Ia was present significantly (P  0.05) sex difference existed in the constitution ratio of the types. The normal angle was greater in Type Ib than in Ia. The greater the normal angle in Type I, the greater the deviation of the right auricule tip towards the left. A good understanding of the right auricule anatomical morphology can better guide atrial pacing, radiofrequency ablation and other surgical procedures while preventing possible intra-procedural complications.

  16. Chronic Glibenclamide Treatment Attenuates Walker-256 Tumour Growth in Prediabetic Obese Rats

    Directory of Open Access Journals (Sweden)

    Claudinéia Conationi da Silva Franco

    2017-05-01

    Full Text Available Background/Aims: The sulphonylurea glibenclamide (Gli is widely used in the treatment of type 2 diabetes. In addition to its antidiabetic effects, low incidences of certain types of cancer have been observed in Gli-treated diabetic patients. However, the mechanisms underlying this observation remain unclear. The aim of the present work was to evaluate whether obese adult rats that were chronically treated with an antidiabetic drug, glibenclamide, exhibit resistance to rodent breast carcinoma growth. Methods: Neonatal rats were treated with monosodium L-glutamate (MSG to induce prediabetes. Control and MSG groups were treated with Gli (2 mg/kg body weight/day from weaning to 100 days old. After Gli treatment, the control and MSG rats were grafted with Walker-256 tumour cells. After 14 days, grafted rats were euthanized, and tumour weight as well as glucose homeostasis were evaluated. Results: Treatment with Gli normalized tissue insulin sensitivity and glucose tolerance, suppressed fasting hyperinsulinaemia, reduced fat tissue accretion in MSG rats, and attenuated tumour growth by 27% in control and MSG rats. Conclusions: Gli treatment also resulted in a large reduction in the number of PCNA-positive tumour cells. Although treatment did improve the metabolism of pre-diabetic MSG-rats, tumour growth inhibition may be a more direct effect of glibenclamide.

  17. [Purification of extracellular proteinases from B. subtilis SKB 256 by biospecific chromatography].

    Science.gov (United States)

    Radzhabov, U R; Davranov, K D; Rakhimov, M M

    2011-01-01

    Abstract-A simple and efficient method of preparing highly purified extracellular proteinases of B. subtilis B-1 (SKB 256) has been developed. A sorbent based on sorsilen impregnated with hemoglobin or cytochrome c has been synthesized for this purpose. A significant difference between the efficiency of hemoglobin and cytochrome c as biospecific ligands has been observed: the enzyme yield amounted to 40.6 and 65.6% of the total amount of enzyme adsorbed, respectively. The culture was shown to contain two major proteinase forms with different molecular masses that could be separated by chromatography on a Sephadex G-50 but gave only one band with MW 27 kDa upon denaturing electrophoresis in 12.5% PAG in the presence of 0.1% SDS. The influence of eluent pH, ionic strength and ethanol concentration on the sorption of the proteinases on the biospecific sorbent, as well as on the desorption from it, has been investigated. Positive influence of 20% ethanol on proteinase desorption has been demonstrated.

  18. Digital electronics for 256 anode Hamamatsu H9500 PSPMT arrays in full-volume Compton imagers

    Science.gov (United States)

    Harris, J. T.; Grudberg, P. M.; Warburton, W. K.

    2014-07-01

    Ziock et al.'s [1] recent Monte Carlo study of a proposed ``full-volume'' Compton Imaging Camera concluded that simultaneously locating a Compton scatter event's multiple interaction points within a single large scintillator crystal might be possible at 1 mm spatial resolution using a coded aperture mask sandwiched between two light guides and coupled to a position sensitive photomultiplier (PSPMT) to record the output light pattern. The method promises high efficiency at a relatively low cost. They are currently developing a lower resolution prototype using a large cubic scintillator (25.4 cm/side) whose masked face will be tiled with 25 Hamamatsu H9500 PSPMTs (6,400 outputs). XIA has contracted to develop and produce the readout electronics, which present several significant design challenges, including capturing all 6,400 anode outputs individually, with single photon sensitivity, in a compact format that will fit behind the tiled PSPMTs. 10,000 event/sec operation is desired, as is a cost of less than about 50/channel. In our approach, each PSPMT front end integrates the 256 anode signals and 8-1 multiplexes them to 32 differential outputs that are digitized in a PXI card using 4 octal 50 MHz ADCs. The multiplexers run at 8 MHz, sampling each anode at 1 MHz, which becomes the image frame rate. The ADC signals are demultiplexed and digitally filtered to extract the number of photons in each pixel in the full 2-D image. The design has been completed and built and is undergoing evaluation tests at the single PSPMT level.

  19. Quantitative analysis of the right auricle with 256-slice computed tomography.

    Science.gov (United States)

    Li, Cai-Ying; Gao, Bu-Lang; Pan, Tong; Xiang, Cheng; Zhang, Xue-Jing; Liu, Xiao-Wei; Fan, Qiong-Ying

    2017-04-01

    To quantitatively measure the morphology parameters of the right auricle with 256-slice multidetector computed tomography angiography (MDCTA) in healthy people. A retrospective analysis of 200 patients who had undergone coronary MDCTA with negative findings was performed. The raw imaging data were reconstructed and the right auricular volume, right atrial volume, right auricle height, base long and short axes, base perimeter and area, normal angle, and distance were quantitatively measured. Men had significantly (P right auricular volume (13.3 ± 4.0 vs. 11.7 ± 3.7 mL) and height (33.0 ± 5.0 vs. 30.5 ± 5.2 mm), the base long axis (34.4 ± 4.1 vs. 33.2 ± 3.9 mm), area (787.6 ± 177.6 vs. 771.0 ± 143.2 mm 2 ) and perimeter (119.2 ± 17.5 vs. 115.0 ± 13.0), and the normal distance (22.4 ± 6.6 vs. 20.2 ± 6.7 mm). The normal 95 % reference range for the right auricular parameters was put forward. The right auricular parameters had a good correlation with the right atrium volume, aortic diameter, the body weight, height, and body surface area but a bad correlation with the vertebral body height. Significantly (P  0.05) difference existed in the other right auricular parameters. Quantitative measurements of the right auricle can help us get a good understanding of the right auricular morphology and its relationship with surrounding structures and are helpful for cardiac interventions of electrophysiology and radiofrequency ablation.

  20. KOI-256's Magnetic Activity Under the Influence of the White Dwarf

    Science.gov (United States)

    Yoldaş, Ezgi; Dal, Hasan Ali

    2017-11-01

    We present the findings about chromospheric activity nature of KOI-256 obtained from the Kepler Mission data. First, it was found that there are some sinusoidal variations out-of-eclipses due to cool spot activity. The sinusoidal variations modelled by the spotmodel program indicate that the active component has two different active regions. Their longitudinal variation revealed that one of them has a migration period of 3.95 yrs, while the other has a migration period of 8.37 yrs. Second, 225 flares were detected from the short cadence data in total. The parameters, such as increase (T r) and decay (T d) times, total flare time (T t), equivalent durations (P), were calculated for each flare. The distribution of equivalent durations versus total flare times in logarithmic scale is modelled to find flare activity level. The Plateau value known as the saturation level of the active component was calculated to be 2.3121 ± 0.0964 s, and the Half-life value, which is required flare total time to reach the saturation, was computed to be 2233.6 s. In addition, the frequency of N 1, which is the number of flares per an hour in the system, was found to be 0.05087 h-1, while the flare frequency N 2 that the flare-equivalent duration emitting per an hour was found to be 0.00051. Contrary to the spot activity, it has been found that the flares are in tends to appear at specific phases due to the white dwarf component.

  1. Use of LC-MS/MS and Bayes' theorem to identify protein kinases that phosphorylate aquaporin-2 at Ser256.

    Science.gov (United States)

    Bradford, Davis; Raghuram, Viswanathan; Wilson, Justin L L; Chou, Chung-Lin; Hoffert, Jason D; Knepper, Mark A; Pisitkun, Trairak

    2014-07-15

    In the renal collecting duct, binding of AVP to the V2 receptor triggers signaling changes that regulate osmotic water transport. Short-term regulation of water transport is dependent on vasopressin-induced phosphorylation of aquaporin-2 (AQP2) at Ser256. The protein kinase that phosphorylates this site is not known. We use Bayes' theorem to rank all 521 rat protein kinases with regard to the likelihood of a role in Ser256 phosphorylation on the basis of prior data and new experimental data. First, prior probabilities were estimated from previous transcriptomic and proteomic profiling data, kinase substrate specificity data, and evidence for kinase regulation by vasopressin. This ranking was updated using new experimental data describing the effects of several small-molecule kinase inhibitors with known inhibitory spectra (H-89, KN-62, KN-93, and GSK-650394) on AQP2 phosphorylation at Ser256 in inner medullary collecting duct suspensions. The top-ranked kinase was Ca2+/calmodulin-dependent protein kinase II (CAMK2), followed by protein kinase A (PKA) and protein kinase B (AKT). Liquid chromatography-tandem mass spectrometry (LC-MS/MS)-based in vitro phosphorylation studies compared the ability of three highly ranked kinases to phosphorylate AQP2 and other inner medullary collecting duct proteins, PKA, CAMK2, and serum/glucocorticoid-regulated kinase (SGK). All three proved capable of phosphorylating AQP2 at Ser256, although CAMK2 and PKA were more potent than SGK. The in vitro phosphorylation experiments also identified candidate protein kinases for several additional phosphoproteins with likely roles in collecting duct regulation, including Nedd4-2, Map4k4, and 3-phosphoinositide-dependent protein kinase 1. We conclude that Bayes' theorem is an effective means of integrating data from multiple data sets in physiology.

  2. Caliste 256: A CdTe imaging spectrometer for space science with a 580 {mu}m pixel pitch

    Energy Technology Data Exchange (ETDEWEB)

    Limousin, O., E-mail: olimousin@cea.fr [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Lugiez, F.; Gevin, O. [CEA/Saclay, DSM/Irfu/Service d' Electronique Detecteurs et Informatique, F-91191 Gif-sur-Yvette (France); Meuris, A.; Blondel, C. [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Delagnes, E. [CEA/Saclay, DSM/Irfu/Service d' Electronique Detecteurs et Informatique, F-91191 Gif-sur-Yvette (France); Donati, M.; Le Mer, I.; Martignac, J.; Pinsard, F. [CEA/Saclay, DSM/Irfu/Service d' Astrophysique, F-91191 Gif-sur-Yvette (France); Vassal, M.C.; Bocage, R.; Soufflet, F. [3D Plus, 641 rue Helene Boucher, F-78532 Buc (France)

    2011-08-11

    Caliste project aims at hybridizing 1 cm{sup 2} CdTe or CdZnTe pixel detectors with low-noise full custom front-end electronics, in a single component standing in a 1x1x2 cm{sup 3} volume. Caliste device is 4-side buttable and can be used as elementary detection unit of a large mosaic to form a hard X-ray focal plane of any size and shape. Caliste is especially designed to match astronomical space mission requirements and its design takes into account environmental constraints, radiation environment in particular. This new imaging spectrometer for hard X-rays detection offers high spectral and spatial resolution together with accurate time-tagging capability and low dead time. Caliste concept relies on a 3D hybridization technology that consists in stacking full custom ASICs perpendicular to the detection surface into a single component. This technique simultaneously permits to realize a buttable imager and to enhance performance and uniformity response. Our last prototype is called Caliste 256 and integrates 16x16 pixels array, 580 {mu}m pitch and 256 corresponding independent spectroscopy channels. This paper presents Caliste 256 design and properties. We emphasize spectral performance and demonstrate spectral resolution capabilities better than 1 keV FWHM at 60 keV.

  3. Genome Anatomy of Pyrenochaeta unguis-hominis UM 256, a Multidrug Resistant Strain Isolated from Skin Scraping.

    Science.gov (United States)

    Toh, Yue Fen; Yew, Su Mei; Chan, Chai Ling; Na, Shiang Ling; Lee, Kok Wei; Hoh, Chee-Choong; Yee, Wai-Yan; Ng, Kee Peng; Kuan, Chee Sian

    2016-01-01

    Pyrenochaeta unguis-hominis is a rare human pathogen that causes infection in human skin and nail. P. unguis-hominis has received little attention, and thus, the basic biology and pathogenicity of this fungus is not fully understood. In this study, we performed in-depth analysis of the P. unguis-hominis UM 256 genome that was isolated from the skin scraping of a dermatitis patient. The isolate was identified to species level using a comprehensive multilocus phylogenetic analysis of the genus Pyrenochaeta. The assembled UM 256 genome has a size of 35.5 Mb and encodes 12,545 putative genes, and 0.34% of the assembled genome is predicted transposable elements. Its genomic features propose that the fungus is a heterothallic fungus that encodes a wide array of plant cell wall degrading enzymes, peptidases, and secondary metabolite biosynthetic enzymes. Antifungal drug resistance genes including MDR, CDR, and ERG11/CYP51 were identified in P. unguis-hominis UM 256, which may confer resistance to this fungus. The genome analysis of P. unguis-hominis provides an insight into molecular and genetic basis of the fungal lifestyles, understanding the unrevealed biology of antifungal resistance in this fungus.

  4. Qualitative and quantitative assessment of adenosine triphosphate stress whole-heart dynamic myocardial perfusion imaging using 256-slice computed tomography.

    Directory of Open Access Journals (Sweden)

    Akira Kurata

    Full Text Available BACKGROUND: The aim of this study was to investigate the correlation of the qualitative transmural extent of hypoperfusion areas (HPA using stress dynamic whole-heart computed tomography perfusion (CTP imaging by 256-slice CT with CTP-derived myocardial blood flow (MBF for the estimation of the severity of coronary artery stenosis. METHODS AND RESULTS: Eleven patients underwent adenosine triphosphate (0.16 mg/kg/min, 5 min stress dynamic CTP by 256-slice CT (coverage: 8 cm, 0.27 s/rotation, and 9 of the 11 patients underwent coronary angiography (CAG. Stress dynamic CTP (whole-heart datasets over 30 consecutive heart beats in systole without spatial and temporal gaps was acquired with prospective ECG gating (effective radiation dose: 10.4 mSv. The extent of HPAs was visually graded using a 3-point score (normal, subendocardial, transmural. MBF (ml/100g/min was measured by deconvolution. Differences in MBF (mean ± standard error according to HPA and CAG results were evaluated. In 27 regions (3 major coronary territories in 9 patients, 11 coronary stenoses (> 50% reduction in diameter were observed. In 353 myocardial segments, HPA was significantly related to MBF (P 70%], 119 ± 69. CONCLUSION: The qualitative transmural extent of HPA using stress whole-heart dynamic CTP imaging by 256-slice CT exhibits a good correlation with quantitative CTP-derived MBF and may aid in assessing the hemodynamic significance of coronary artery disease.

  5. Metabolic effects of Hedyotis diffusa on rats bearing Walker 256 tumor revealed by NMR-based metabolomics.

    Science.gov (United States)

    Wang, Zhiyong; Gao, Kuo; Xu, Can; Gao, Jian; Yan, Yujing; Wang, Yingfeng; Li, Zhongfeng; Chen, Jianxin

    2017-08-28

    Hedyotis diffusa, a traditional Chinese herbal medicine, is widely used for oncotherapy and shows a positive effect in the clinical treatment. But its mechanism of anticancer activities is complicated and unclear. This study was undertaken to assess the therapeutic effects and reveal detailed mechanisms of H. diffusa for oncotherapy. A Walker 256 tumor-bearing rat model was established, and metabolomic profiles of plasma and urine were obtained from (1) H NMR technique. Multivariate statistical analysis methods were used to characterize the discriminating metabolites between control (C), Walker 256 tumor-bearing rats model (M), and H. diffusa treatment (H) groups. Finally, 13 and 10 metabolomic biomarkers in urine and plasma samples were further identified as characteristic metabolites in M group, whereas H group showed a partial metabolic balance recovered, such as ornithine, N-acetyl-l-aspartate, l-aspartate, and creatinine in urine samples, and acetate, lactate, choline, l-glutamine, and 3-hydroxybutyrate in plasma samples. On the basis of the methods above, we hypothesized H. diffusa treatment reduced the injury caused by Walker 256 tumor and maintained a metabolic balance. Our study demonstrated that this method provided new insights into metabolic alterations in tumor-bearing biosystems and researching on the effects of H. diffusa on the endogenous metabolism in tumor-bearing rats. Copyright © 2017 John Wiley & Sons, Ltd.

  6. Expanded phenotypes and outcomes among 256 LGI1/CASPR2-IgG-positive patients.

    Science.gov (United States)

    Gadoth, Avi; Pittock, Sean J; Dubey, Divyanshu; McKeon, Andrew; Britton, Jeff W; Schmeling, John E; Smith, Aurelia; Kotsenas, Amy L; Watson, Robert E; Lachance, Daniel H; Flanagan, Eoin P; Lennon, Vanda A; Klein, Christopher J

    2017-07-01

    To describe an expanded phenotypic spectrum and longitudinal outcome in 256 LGI1-IgG-seropositive and/or CASPR2-IgG-seropositive patients. Patients were identified through service neural autoantibody evaluation. Ninety-five had longitudinal follow-up (7-456 months; median = 35). Among 3,910 patients tested, 196 were LGI1-IgG positive, 51 were CASPR2-IgG positive, and 9 were dual positive. Cerebrospinal fluid testing was less sensitive than serum testing, detecting only 24 of 38 (63%) LGI1-IgG-positive and 5 of 6 (83%) CASPR2-IgG-positive patients. LGI1-IgG-positive specimens had higher voltage-gated potassium channel-IgG immunoprecipitation values (0.33nmol/l, range = 0.02-5.14) than CASPR2-IgG-positive specimens (0.10nmol/l, range = 0.00-0.45, p IgG seropositive (7% had solely neuropathy or pain). Multivariate analysis identified age as the only significant predictor of central nervous system (CNS) versus PNS involvement (>50 years; odds ratio = 15, p IgG accompaniment (14% of patients), frequently delayed the diagnosis. T2-mesiotemporal hyperintensity was more common in LGI1-IgG-positive (41%) than in CASPR2-IgG-positive patients (p = 0.033). T1-bright basal ganglia were confined to LGI1-IgG-positive patients with faciobrachial-dystonic seizures (9 of 39, 31%). Cancer was found in 44% of LGI1-IgG/CASPR2-IgG dual seropositive patients (one-third thymoma). Response to initial immunotherapy was favorable in 97%; mean modified Rankin score was 3 (range = 1-5) at onset and 1.74 (range = 0-6) at last follow-up, with 9% having severe refractory disability, 20% being asymptomatic, 28% receiving immunotherapy, and 58% receiving antiepileptic medication. Older age is a strong predictor of CNS involvement in patients seropositive for CASPR2-IgG or LGI1-IgG. Pain, peripheral manifestations, and stereotypic paroxysmal dizziness spells are common with LGI1-IgG. Response to initial immunotherapy is often favorable, but some patients remain severely disabled, requiring long

  7. Experimental inoculation model of Walker 256 carcinoma into vagina and cervix uteri of female rats Modelo experimental de Tumor de Walker 256 em vagina e colo de útero de ratas

    Directory of Open Access Journals (Sweden)

    Nara Macedo Botelho Brito

    2007-12-01

    Full Text Available PURPOSE: To establish an inoculation model of Walker 256 carcinoma on cervix uteri and vagina of rats. METHODS: Fifteen female rats were used, and assigned to three groups each one with five rats: group A - rats with 4x10(6 cells of Walker 256 carcinoma without acid acetic inoculation; group B - rats with 2x10(6 cells of Walker 256 carcinoma with acid acetic inoculation and group C: rats with 4x10(6 cells of Walker 256 carcinoma with acid acetic inoculation. The day before tumor cells inoculation the rats from groups B and C were anaesthetized with diethylether and 0,3 ml of acetic acid was inoculated into their vaginas. Tumor cell inoculation into the vagina and cervix was done under general anesthesia with diethylether. Then a endocervical brush was used to scrape the vaginal wall and after that 0,3 ml of the liquid containing tumor cells was inoculated on the vagina and cervix. For the tumor analysis, animals were euthanized at day 12 following tumor cell implantation by an excessive inhalation of diethylether. Tumor was resected entirely and weighed and the tumors were then sectioned and counter stained with hematoxylin and eosin for histopathologic evaluation. It was also calculated the percentage of tumor equivalent to the body weight by the formula: P= tumor weight / body weight x 100. Data were analyzed by one-way analysis of variance - ANOVA. P values OBJETIVO: Estabelecer um modelo de inoculação de Tumor de Walker 256 em vagina e colo de útero de ratas. MÉTODOS: Foram utilizadas 15 ratas fêmeas, virgens, adultas, pesando entre 200-250g, distribuídas em três grupos de estudo com cinco animais cada: grupo A (GA: ratas com tumor de Walker 256 em concentração de 4x10(6 sem ácido acético; grupo B (GB: ratas com tumor de Walker 256 em concentração de 2x10(6 células com ácido acético; grupo C (GC: ratas com tumor de Walker 256 em concentração de 4x10(6 células com ácido acético. No dia anterior à inoculação do tumor

  8. Simultaneous transmission of 256-QAM WIMAX at 5.7GHz and optically generated impulse radio UWB over fiber for indoor wireless multi-services

    DEFF Research Database (Denmark)

    Yu, Xianbin; Yin, Xiaoli; Gibbon, Timothy Braidwood

    2010-01-01

    Fiber transmission of simultaneous optically generated FCC compliant 625Mbps impulse radio UWB and 80Mbps 256-QAM IEEE 802.16 WIMAX signals is experimentally demonstrated by using a single directly modulated light source.......Fiber transmission of simultaneous optically generated FCC compliant 625Mbps impulse radio UWB and 80Mbps 256-QAM IEEE 802.16 WIMAX signals is experimentally demonstrated by using a single directly modulated light source....

  9. Assessment of coronary artery by prospective ECG-triggered 256 multi-slice CT on children with congenital heart disease.

    Science.gov (United States)

    Yao, Li-Ping; Zhang, Li; Li, Hui-Ming; Ding, Ming; Yu, Ling-Wei; Yang, Xin; Li, Xiao-Ming; Sun, Kun

    2017-12-01

    This study aims to investigate the imaging quality and radiation dose of prospective ECG-triggered 256 multi-slice computer tomography (MSCT) in accessing the coronary artery (CA) in children. Coronary arteries of 149 children were evaluated using prospective ECG-triggered 256 MSCT with the same system settings. A four-point scoring system was applied to study the capability of MSCT in detecting CA in these patients. Signal, noise and contrast-to-noise ratios (CNR) were analyzed to investigate the association of image quality with age. Then, volumetric CT dose index (CTDI vol ), dose-length product (DLP), and effective dose (ED) were utilized to study the association of radiation dose with age. The detection rate for original, proximal, middle, distal and the 11 segments of CA was 100, 97, 92, 81 and 92%, respectively; and there was no influence on age during the detection (all, P < 0.05). A negative correlation was found between ED and age (r = -0.664, P < 0.001). Significantly larger EDs were found in younger patients (age: <3 years; 1.2 ± 0.5 and 0.6 ± 0.2 mSv; P < 0.001), while higher DLPs were found in elder patients, although no correlation was found between ages versus DLP (r = 0.092, P = 0.262). Prospective ECG-triggered 256 MSCT has considerable performance for the evaluation of CA in children. However, great caution is needed for children under the age of three in the selection of this examination. Furthermore, the tube current could be further reduced for the examination of children ≥8 years.

  10. Power fading mitigation of 40-Gbit/s 256-QAM OFDM carried by colorless laser diode under injection-locking.

    Science.gov (United States)

    Tsai, Cheng-Ting; Chi, Yu-Chieh; Lin, Gong-Ru

    2015-11-02

    The pre-compensation on power fading effect of a colorless laser diode (CLD) carried 40-Gbit/s 256-QAM OFDM transmission during 25-km is demonstrated. By offsetting the DC bias to thrice the threshold (I(th)) and increasing the injection to 0 dBm, the CLD not only enhances its coherence but also suppresses modulation throughput declination and reduces the relative intensity related noise floor to -50 dBm. Modeling the receiving power of the delivered 256-QAM OFDM subcarriers is established, indicating that raising the bias to 3I(th) down-shifts the power fading induced notch to 8.8 GHz. This further degrades the OFDM subcarrier peak power by -2.9 dB after 25-km transmission, and the corresponded signal-to-noise ratio (SNR), error vector magnitude (EVM) and bit-error-rate (BER) are 26.1 dB, 4.9% and 6.5 × 10(-3), respectively. Pre-leveling the OFDM subcarrier as well as the modulation throughput effectively compromises the over-bias enlarged power fading to promote transmission. With a pre-leveled power slope of 1.5 dB/GHz for 256-QAM OFDM data, the modulation throughput declination of the high biased CLD significantly mitigates under BtB transmission, enabling the receiving sensitivity at -7.2 dBm with SNR, EVM and BER of 29.9 dB, 3.1% and 1.5 × 10(-4), respectively. Increasing the pre-leveling slope to 3.2 dB/GHz minimizes the fiber dispersion induced power fading, which improves the receiving SNR, EVM and BER to 27.4 dB, 4.2% and 2.6 × 10(-3), respectively, with receiving sensitivity of -3 dBm and power penalty of 4.2 dB after 25-km SMF transmission.

  11. Respiratory-gated segment reconstruction for radiation treatment planning using 256-slice CT-scanner during free breathing

    Science.gov (United States)

    Mori, Shinichiro; Endo, Masahiro; Kohno, Ryosuke; Minohara, Shinichi; Kohno, Kazutoshi; Asakura, Hiroshi; Fujiwara, Hideaki; Murase, Kenya

    2005-04-01

    The conventional respiratory-gated CT scan technique includes anatomic motion induced artifacts due to the low temporal resolution. They are a significant source of error in radiotherapy treatment planning for the thorax and upper abdomen. Temporal resolution and image quality are important factors to minimize planning target volume margin due to the respiratory motion. To achieve high temporal resolution and high signal-to-noise ratio, we developed a respiratory gated segment reconstruction algorithm and adapted it to Feldkamp-Davis-Kress algorithm (FDK) with a 256-detector row CT. The 256-detector row CT could scan approximately 100 mm in the cranio-caudal direction with 0.5 mm slice thickness in one rotation. Data acquisition for the RS-FDK relies on the assistance of the respiratory sensing system by a cine scan mode (table remains stationary). We evaluated RS-FDK in phantom study with the 256-detector row CT and compared it with full scan (FS-FDK) and HS-FDK results with regard to volume accuracy and image noise, and finally adapted the RS-FDK to an animal study. The RS-FDK gave a more accurate volume than the others and it had the same signal-to-noise ratio as the FS-FDK. In the animal study, the RS-FDK visualized the clearest edges of the liver and pulmonary vessels of all the algorithms. In conclusion, the RS-FDK algorithm has a capability of high temporal resolution and high signal-to-noise ratio. Therefore it will be useful when combined with new radiotherapy techniques including image guided radiation therapy (IGRT) and 4D radiation therapy.

  12. Sesquiterpene lactones of Moquiniastrum polymorphum subsp. floccosum have antineoplastic effects in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Martins, Gracianny Gomes; Lívero, Francislaine Aparecida dos Reis; Stolf, Aline Maria; Kopruszinski, Caroline Machado; Cardoso, Cibele Campos; Beltrame, Olair Carlos; Queiroz-Telles, José Ederaldo; Strapasson, Regiane Lauriano Batista; Stefanello, Maria Élida Alves; Oude-Elferink, Ronald; Acco, Alexandra

    2015-02-25

    This study aimed to evaluate the in vivo antitumor actions and toxicity of the dichloromethane fraction (F1B) of Moquiniastrum polymorphum subsp. floccosum (formerly Gochnatia polymorpha ssp. floccosa), composed of sesquiterpene lactones, against Walker-256 carcinosarcoma in rats. Male Wistar rats received 100 mg kg(-1) F1B per day orally for 16 days after subcutaneous inoculation of Walker-256 cells in the pelvic limb. The tumor progression was monitored, and after treatment, tumor weight, oxidative stress, plasma biochemistry, inflammatory parameters, gene expression and histology of tumor and/or liver were evaluated. The toxicity of F1B was analyzed through the relative weight of organs. Additionally, an LD50 test was performed in mice. F1B treatment significantly reduced tumor volume and weight. There was no difference in oxidative stress in tumor tissue after treatment. F1B treatment modified hepatic glutathione and superoxide dismutase, and normalized plasma glucose, alkaline phosphatase, and amylase. F1B did not affect the activity of myeloperoxidase and N-acetylglucosaminidase or the nitric oxide levels in tumor tissue. However, F1B decreased the tumor necrosis factor (TNF)-α levels. Additionally, F1B increased apoptosis in the tumor, mediated by up-regulation of the p53 and Bax gene expression. No clinical signs of toxicity or death were observed in the rats treated with F1B. The LD50 calculated for mice was 1209 mg kg(-1). F1B, which is rich in sesquiterpene lactones, showed antitumor activity against Walker-256 carcinosarcoma. This effect may be, at least in part, related to the induction of apoptosis and inhibition of TNF-α signaling. Copyright © 2015. Published by Elsevier Ireland Ltd.

  13. CT Angiography of Peripheral Arterial Disease by 256-Slice Scanner: Accuracy, Advantages and Disadvantages Compared to Digital Subtraction Angiography.

    Science.gov (United States)

    Mishra, Atul; Jain, Narendra; Bhagwat, Anand

    2017-07-01

    Peripheral arterial occlusive disease (PAOD) may cause disabling claudication or critical limb ischemia. Multidetector computed tomography (CT) technology has evolved to the level of 256-slice CT scanners which has significantly improved the spatial and temporal resolution of the images. This has provided the capability of chasing the contrast bolus at a fast speed enabling angiographic imaging of long segments of the body. These images can be reconstructed in various planes and various modes for detailed analysis of the peripheral vascular diseases which helps in making treatment decision. The aim of this retrospective study was to compare the CT angiograms (CTAs) of all cases of PAOD done by 256-slice CT scanner at a tertiary care vascular center and comparing these images with the digital subtraction angiograms (DSAs) of these patients. The retrospective study included 53 patients who underwent both CTA and DSA at our center over a period of 3 years from March 2013 to March 2016. The CTA showed high sensitivity (93%) and specificity (92.7%) for overall assessment of degree of stenosis in a vascular segment in cases of aortic and lower limb occlusive disease. The assessment of lesions of infrapopliteal segment was comparatively inferior (sensitivity 91.6%, accuracy 73.3%, and positive predictive value 78.5%), more so in the presence of significant calcification. The advantages of CTA were its noninvasive nature, ability to image large area of body, almost no adverse effects to the patients, and better assessment of vessel wall disease. However, the CTA assessment of collaterals was inferior with a sensitivity of only 62.7% as compared to DSA. Overall, 256-slice CTA provides fast and accurate imaging of vascular tree which can restrict DSA only in few selected cases as a problem-solving tool where clinico-radiological mismatch is present.

  14. N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imid-azol-2-ylbenzeneamine

    Directory of Open Access Journals (Sweden)

    Monika Dziełak

    2018-01-01

    Full Text Available N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imidazol-2-ylbenzeneamine was obtained by condensation of N-(4-bromobenzyl-3,1-benzoxazine-2,4-dione (N-(4-bromobenzylisatoic anhydride with 4,5-dimethyl-1,2-phenylenediamine in refluxing acetic acid. This is a rare example of condensation of N-substituted 3,1-benzoxazine-2,4-dione with 1,2-phenylenediamine, which resulted in the formation of a benzimidazole derivative with a moderate yield. Crystallographic studies and initial biological screening were performed for the obtained product.

  15. Brain perfusion CT for acute stroke using a 256-slice CT: improvement of diagnostic information by large volume coverage.

    Science.gov (United States)

    Dorn, F; Muenzel, D; Meier, R; Poppert, H; Rummeny, E J; Huber, A

    2011-09-01

    To compare a 256-slice CT with a simulated standard CT for brain CT perfusion (CTP). CTP was obtained in 51 patients using a 256-slice CT (128 detector rows, flying z-focus, 8-cm detector width, 80 kV, 120mAs, 20 measurements, 1 CT image/2.5 s). Signal-to-noise ratios (SNR) were compared in grey and white matter. Perfusion maps were evaluated for cerebral blood flow (CBF), cerebral blood volume (CBV) and mean transit time (MTT) in hypoperfused areas and corresponding contralateral regions. Two reconstructed 10-mm slices for simulation of a standard CT (SDCT) were compared with the complete data sets (large-volume CT, LVCT). Adequate image quality was achieved in 50/51 cases. SNR were significantly different in grey and white matter. A perfusion deficit was present in 27 data sets. Differences between the hypoperfusions and the control regions were significant for MTT and CBF, but not for CBV. Three lesions were missed by SDCT but detected by LVCT; 24 lesions were covered incompletely by SDCT, and 6 by LVCT. 21 lesions were detected completely by LVCT, but none by SDCT. CTP imaging of the brain using an increased detector width can detect additional ischaemic lesions and cover most ischaemic lesions completely.

  16. Brain perfusion CT for acute stroke using a 256-slice CT: improvement of diagnostic information by large volume coverage

    Energy Technology Data Exchange (ETDEWEB)

    Dorn, F. [Technical University, Department of Radiology, Klinikum rechts der Isar, Munich (Germany); Institut fuer Radiologie, Klinikum rechts der Isar der Technischen Universitaet Muenchen, Muenchen (Germany); Muenzel, D.; Meier, R.; Rummeny, E.J.; Huber, A. [Technical University, Department of Radiology, Klinikum rechts der Isar, Munich (Germany); Poppert, H. [Technical University, Department of Neurology, Klinikum rechts der Isar, Munich (Germany)

    2011-09-15

    To compare a 256-slice CT with a simulated standard CT for brain CT perfusion (CTP). CTP was obtained in 51 patients using a 256-slice CT (128 detector rows, flying z-focus, 8-cm detector width, 80 kV, 120mAs, 20 measurements, 1 CT image/2.5 s). Signal-to-noise ratios (SNR) were compared in grey and white matter. Perfusion maps were evaluated for cerebral blood flow (CBF), cerebral blood volume (CBV) and mean transit time (MTT) in hypoperfused areas and corresponding contralateral regions. Two reconstructed 10-mm slices for simulation of a standard CT (SDCT) were compared with the complete data sets (large-volume CT, LVCT). Adequate image quality was achieved in 50/51 cases. SNR were significantly different in grey and white matter. A perfusion deficit was present in 27 data sets. Differences between the hypoperfusions and the control regions were significant for MTT and CBF, but not for CBV. Three lesions were missed by SDCT but detected by LVCT; 24 lesions were covered incompletely by SDCT, and 6 by LVCT. 21 lesions were detected completely by LVCT, but none by SDCT. CTP imaging of the brain using an increased detector width can detect additional ischaemic lesions and cover most ischaemic lesions completely. (orig.)

  17. Implementation of RSA 2048-bit and AES 256-bit with Digital Signature for Secure Electronic Health Record Application

    Directory of Open Access Journals (Sweden)

    Mohamad Ali Sadikin

    2016-10-01

    Full Text Available This research addresses the implementation of encryption and digital signature technique for electronic health record to prevent cybercrime such as robbery, modification and unauthorised access. In this research, RSA 2048-bit algorithm, AES 256-bit and SHA 256 will be implemented in Java programming language. Secure Electronic Health Record Information (SEHR application design is intended to combine given services, such as confidentiality, integrity, authentication, and nonrepudiation. Cryptography is used to ensure the file records and electronic documents for detailed information on the medical past, present and future forecasts that have been given only to the intended patients. The document will be encrypted using an encryption algorithm based on NIST Standard. In the application, there are two schemes, namely the protection and verification scheme. This research uses black-box testing and whitebox testing to test the software input, output, and code without testing the process and design that occurs in the system.We demonstrated the implementation of cryptography in SEHR. The implementation of encryption and digital signature in this research can prevent archive thievery.

  18. IS256 abolishes gelatinase activity and biofilm formation in a mutant of the nosocomial pathogen Enterococcus faecalis V583.

    Science.gov (United States)

    Perez, Marta; Calles-Enríquez, Marina; del Rio, Beatriz; Ladero, Victor; Martín, María Cruz; Fernández, María; Alvarez, Miguel A

    2015-07-01

    Enterococcus faecalis is one of the most controversial species of lactic acid bacteria. Some strains are used as probiotics, while others are associated with severe and life-threatening nosocomial infections. Their pathogenicity depends on the acquisition of multidrug resistance and virulence factors. Gelatinase, which is required in the first steps of biofilm formation, is an important virulence determinant involved in E. faecalis pathogenesis, including endocarditis and peritonitis. The gene that codes for gelatinase (gelE) is controlled by the Fsr quorum-sensing system, whose encoding genes (fsrA, fsrB, fsrC, and fsrD) are located immediately upstream of gelE. The integration of a DNA fragment into the fsr locus of a derived mutant of E. faecalis V583 suppressed the gelatinase activity and prevented biofilm formation. Sequence analysis indicated the presence of IS256 integrated into the fsrC gene at nucleotide position 321. Interestingly, IS256 is also associated with biofilm formation in Staphylococcus epidermidis and Staphylococcus aureus. This is the first description of an insertion sequence that prevents biofilm formation in E. faecalis.

  19. Multiplexed 256 element InGaAs detector arrays for 0.8-1.7-micron room-temperature operation

    Science.gov (United States)

    Olsen, G. H.; Joshi, A. M.; Ban, V. S.; Woodruff, K. M.; Gasparian, G. A.

    1988-01-01

    InGaAs photodetectors have been configured into linear arrays of 30 x 30 micron photodetectors spaced 50 microns apart. The devices have typical responsivities of 0.9 A/W (86-percent QE) at 1.3 microns and exhibit room temperature dark currents below 100 pA. A 256-element array has been mounted in a Reticon multiplexer and configured into a PAR optical multichannel analyzer to extend spectral response out to 1.7 microns. Individual InGaAs detectors have been fabricated for response out to 2.2 microns with dark current below 1 microA (-1V) and 50-percent QE at room temperature.

  20. Experimental Comparison of Gains in Achievable Information Rates from Probabilistic Shaping and Digital Backpropagation for DP-256QAM/1024QAM WDM Systems

    DEFF Research Database (Denmark)

    Porto da Silva, Edson; Yankov, Metodi Plamenov; Da Ros, Francesco

    2016-01-01

    Gains in achievable information rates from probabilistic shaping and digital backpropagation are compared for WDM transmission of 5 × 10 GBd DP-256QAM/1024QAM up to 1700 km of reach. The combination of both techniques its shown to provide gains of up to ∼0.5 bits/QAM symbol......Gains in achievable information rates from probabilistic shaping and digital backpropagation are compared for WDM transmission of 5 × 10 GBd DP-256QAM/1024QAM up to 1700 km of reach. The combination of both techniques its shown to provide gains of up to ∼0.5 bits/QAM symbol...

  1. Characterization of a Wavelength Converter for 256-QAM Signals Based on an AlGaAs-On-Insulator Nano-waveguide

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Yankov, Metodi Plamenov; Porto da Silva, Edson

    2016-01-01

    High efficiency and broadband wavelength conversion in a 9-mm AlGaAs-On-Insulator waveguide is shown to provide high-quality (OSNR > 30 dB) idler generation over a 28-nm bandwidth enabling error-free conversion of 10-GBd 256-QAM with OSNR penalty below 2.5 dB.......High efficiency and broadband wavelength conversion in a 9-mm AlGaAs-On-Insulator waveguide is shown to provide high-quality (OSNR > 30 dB) idler generation over a 28-nm bandwidth enabling error-free conversion of 10-GBd 256-QAM with OSNR penalty below 2.5 dB....

  2. The optimal dose reduction level using iterative reconstruction with prospective ECG-triggered coronary CTA using 256-slice MDCT

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Yang; Xu, Shu; Guo, Wenli; Vembar, Mani [Department of Radiology, Shengjing Hospital of China Medical University, Shenyang 110004 (China); Guo, Qiyong, E-mail: guoqy@sj-hospital.org [Department of Radiology, Shengjing Hospital of China Medical University, Shenyang 110004 (China)

    2012-12-15

    Aim: To assess the image quality (IQ) of an iterative reconstruction (IR) technique (iDose{sup 4}) from prospective electrocardiography (ECG)-triggered coronary computed tomography angiography (coronary CTA) on a 256-slice multi-detector CT (MDCT) scanner and determine the optimal dose reduction using IR that can provide IQ comparable to filtered back projection (FBP). Method and materials: 110 consecutive patients (69 men, 41 women; age: 54 ± 10 years) underwent coronary CTA on a 256-slice MDCT (Brilliance iCT, Philips Healthcare). The control group (Group A, n = 21) were scanned using the conventional tube output (120 kVp, 210 mAs) and reconstructed using FBP. The other 4 groups were scanned with the same kVp but successively reduced tube output as follows: B[n = 15]: 125 mAs; C[n = 22]: 105 mAs; D[n = 36]: 84 mAs: E[n = 16]: 65 mAs) and reconstructed using IR levels of L3 (Group B), L4 (Group C) and L5 (Groups D and E), to compensate for the noise increase. All images were reconstructed using the same kernel (XCB). Two radiologists graded IQ in a blinded fashion on a 4-point scale (4 – excellent, 3 – good, 2 – fair and 1 – poor). Quantitative measurements of CT values, image noise and contrast-to-noise (CNR) were measured in each group. A receiver-operating characteristic (ROC) analysis was performed to determine a radiation reduction threshold up to which excellent IQ was maintained. Results: There were no significant differences in objective noise, SNR and CNR values among Groups A, B, C, D, and E (P = 0.14, 0.09, 0.17, respectively). There were no significant differences in the scores of the subjective IQ between Group A, and Groups B, C, D, E (P = 0.23–0.97). Significant differences in image sharpness and study acceptability were observed between groups A and E (P < 0.05). Using the criterion of excellent IQ (score 4), the ROC curve of dose levels and IQ acceptability established a reduction of 60% of tube output (Group D) as optimum cutoff point

  3. Ser-261 phospho-regulation is involved in pS256 and pS269-mediated aquaporin-2 apical translocation.

    Science.gov (United States)

    Yui, Naofumi; Ando, Fumiaki; Sasaki, Sei; Uchida, Shinichi

    2017-08-26

    Vasopressin catalyzes aquaporin-2 phosphorylation at several serine sites in the C-terminal region. Compared with Ser-256 and Ser-269 phosphorylation, the role of Ser-261 phospho-regulation on vasopressin-regulated AQP2 apical translocation is largely unknown. In addition, recent discovery of transcytotic apical delivery of AQP2 made the concept of its intracellular trafficking even more complicated. In this study, we evaluated how intact phospho-AQP2 signals fit with the transcytosis trafficking model in Madin-Darby canine kidney cells. PS256 and pS269 signals were intracellularly detectable in wild-type AQP2 at the beginning of forskolin stimulation (1 min). These phospho-signals were detectable in basolateral membranes even after 10 min of stimulation. AQP2 stably inserted in the apical membrane increased pS269 and decreased pS261 signals. In an NDI-causing mutant P262L-AQP2, in which Ser-261 phospho-regulation is impaired, the pS256 and pS269 signals were detectable in the basolateral membranes with increased pS261 signals after forskolin stimulation. These results suggest that Ser-261 phospho-regulation is involved in pS256- and pS269-mediated AQP2 apical translocation. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Optimal temporal windows and dose-reducing strategy for coronary artery bypass graft imaging with 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Kun-Mu [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Lee, Yi-Wei [Department of Radiology, Kaohsiung Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Guan, Yu-Xiang [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Law, Wei-Yip, E-mail: m002325@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Su, Chen-Tau, E-mail: m005531@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China)

    2013-12-11

    Objective: To determine the optimal image reconstruction windows in the assessment of coronary artery bypass grafts (CABGs) with 256-slice computed tomography (CT), and to assess their associated optimal pulsing windows for electrocardiogram-triggered tube current modulation (ETCM). Methods: We recruited 18 patients (three female; mean age 68.9 years) having mean heart rate (HR) of 66.3 beats per minute (bpm) and a heart rate variability of 1.3 bpm for this study. A total of 36 CABGs with 168 segments were evaluated, including 12 internal mammary artery (33.3%) and 24 saphenous vein grafts (66.7%). We reconstructed 20 data sets in 5%-step through 0–95% of the R–R interval. The image quality of CABGs was assessed by a 5-point scale (1=excellent to 5=non-diagnostic) for each segment (proximal anastomosis, proximal, middle, distal course of graft body, and distal anastomosis). Two reviewers discriminated optimal reconstruction intervals for each CABG segment in each temporal window. Optimal windows for ETCM were also evaluated. Results: The determined optimal systolic and diastolic reconstruction intervals could be divided into 2 groups with threshold HR=68. The determined best reconstruction intervals for low heart rate (HR<68) and high heart rate (HR>68) were 76.0±2.5% and 45.0±0% respectively. Average image quality scores were 1.7±0.6 with good inter-observer agreement (Kappa=0.79). Image quality was significantly better for saphenous vein grafts versus arterial grafts (P<0.001). The recommended windows of ETCM for low HR, high HR and all HR groups were 40–50%, 71–81% and 40–96% of R-R interval, respectively. The corresponding dose savings were about 60.8%, 58.7% and 22.7% in that order. Conclusions: We determined optimal reconstruction intervals and ETCM windows representing a good compromise between radiation and image quality for following bypass surgery using a 256-slice CT.

  5. Mutations of residues 249 and 256 in VP2 are involved in the replication and virulence of infectious Bursal disease virus.

    Directory of Open Access Journals (Sweden)

    Xiaole Qi

    Full Text Available Infectious bursal disease virus (IBDV is a pathogen of worldwide significance to the poultry industry. Although the PDE and PFG domains of the capsid protein VP2 contribute significantly to virulence and fitness, the detailed molecular basis for the pathogenicity of IBDV is still not fully understood. Because residues 253 and 284 of VP2 are not the sole determinants of virulence, we hypothesized that other residues involved in virulence and fitness might exist in the PDE and PFG domains of VP2. To test this, five amino acid changes selected by sequence comparison of the PDE and PFG domains of VP2 were introduced individually using a reverse genetics system into the virulent strain (rGx-F9VP2. Then reverse mutations of the selected residues 249 and 256 were introduced individually into the attenuated strain (rGt. Seven modified viruses were generated and evaluated in vitro (CEF cells and in vivo (SPF chicken. For residue 249, Q249R could elevate in vitro and reduce in vivo the replication of rGx-F9VP2 while R249Q could reduce in vitro and elevate in vivo the replication of rGt; meanwhile Q249R reduced the virulence of rGx-F9VP2 while R249Q increased the virulence of rGt, which indicated that residue 249 significantly contributed to the replication and virulence of IBDV. For residue 256, I256V could elevate in vitro and reduce in vivo the replication of rGx-F9VP2 while V256I could reduce in vitro but didn't change in vivo the replication of rGt; although V256I didn't increase the virulence of rGt, I256V obviously reduced the virulence of virulent IBDV. The present results demonstrate for the first time, to different extent, residues 249 and 256 of VP2 are involved in the replication efficiency and virulence of IBDV; this is not only beneficial to further understanding of pathogenic mechanism but also to the design of newly tailored vaccines against IBDV.

  6. A Re-configurable On-line Learning Spiking Neuromorphic Processor comprising 256 neurons and 128K synapses

    Directory of Open Access Journals (Sweden)

    Ning eQiao

    2015-04-01

    Full Text Available Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm 2 , and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities.

  7. 256 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    meropenem and levofloxacin (Sigma-Aldrich, St. Louis, USA) were determined by agar dilution method according to EUCAST[7] and CLSI guidelines. [8]. Interpretation of the diameter of inhibition zones for meropenem, ceftazidime and TMP-SMX was done according to. Kirby-Bauer zone diameter interpretative standardsas ...

  8. Prospective ECG triggering reduces prosthetic heart valve-induced artefacts compared with retrospective ECG gating on 256-slice CT.

    Science.gov (United States)

    Symersky, Petr; Habets, Jesse; Westers, Paul; de Mol, Bas A J M; Prokop, Mathias; Budde, Ricardo P J

    2012-06-01

    Multidetector computed tomography (MDCT) has diagnostic value for the evaluation of prosthetic heart valve (PHV) dysfunction but it is hampered by artefacts. We hypothesised that image acquisition using prospective triggering instead of retrospective gating would reduce artefacts related to pulsating PHV. In a pulsatile in vitro model, a mono- and bileaflet PHV were imaged using 256 MDCT at 60, 75 and 90 beats per minute (BPM) with either retrospective gating (120 kV, 600 mAs, pitch 0.2, CTDI(vol) 39.8 mGy) or prospective triggering (120 kV, 200 mAs, CTDI(vol) 13.3 mGy). Two thresholds (>175 and <-45HU), derived from the density of surrounding structures, were used for quantification of hyper- and hypodense artefacts. Image noise and artefacts were compared between protocols. Prospective triggering reduced hyperdense artefacts for both valves at every BPM (P = 0.001 all comparisons). Hypodense artefacts were reduced for the monoleaflet valve at 60 (P = 0.009), 75 (P = 0.016) and 90 BPM (P = 0.001), and for the bileaflet valves at 60 (P = 0.001), 90 (P = 0.001) but not at 75 BPM (P = 0.6). Prospective triggering reduced image noise at 60 (P = 0.001) and 75 (P < 0.03) but not at 90 BPM. Compared with retrospective gating, prospective triggering reduced most artefacts related to pulsating PHV in vitro. • Computed tomographic images are often degraded by prosthetic heart valve-induced artefacts • Prospective triggering reduces prosthetic heart valve-induced artefacts in vitro • Artefact reduction at 90 beats per minute occurs without image noise reduction • Prospective triggering may improve CT image quality of moving hyperdense structures.

  9. Effect of hybrid iterative reconstruction technique on quantitative and qualitative image analysis at 256-slice prospective gating cardiac CT.

    Science.gov (United States)

    Utsunomiya, Daisuke; Weigold, Wm Guy; Weissman, Gaby; Taylor, Allen J

    2012-06-01

    To evaluate the effect of hybrid iterative reconstruction on qualitative and quantitative parameters at 256-slice cardiac CT. Prospective cardiac CT images from 20 patients were analysed. Paired image sets were created using 3 reconstructions, i.e. filtered back projection (FBP) and moderate- and high-level iterative reconstructions. Quantitative parameters including CT-attenuation, noise, and contrast-to-noise ratio (CNR) were determined in both proximal- and distal coronary segments. Image quality was graded on a 4-point scale. Coronary CT attenuation values were similar for FBP, moderate- and high-level iterative reconstruction at 293 ± 74-, 290 ± 75-, and 283 ± 78 Hounsfield units (HU), respectively. CNR was significantly higher with moderate- and high-level iterative reconstructions (10.9 ± 3.5 and 18.4 ± 6.2, respectively) than FBP (8.2 ± 2.5) as was the visual grading of proximal vessels. Visualisation of distal vessels was better with high-level iterative reconstruction than FBP. The mean number of assessable segments among 289 segments was 245, 260, and 267 for FBP, moderate- and high-level iterative reconstruction, respectively; the difference between FBP and high-level iterative reconstruction was significant. Interobserver agreement was significantly higher for moderate- and high-level iterative reconstruction than FBP. Cardiac CT using hybrid iterative reconstruction yields higher CNR and better image quality than FBP. • Cardiac CT helps clinicians to assess patients with coronary artery disease • Hybrid iterative reconstruction provides improved cardiac CT image quality • Hybrid iterative reconstruction improves the number of assessable coronary segments • Hybrid iterative reconstruction improves interobserver agreement on cardiac CT.

  10. LOFAR MSSS: Discovery of a 2.56 Mpc giant radio galaxy associated with a disturbed galaxy group

    Science.gov (United States)

    Clarke, A. O.; Heald, G.; Jarrett, T.; Bray, J. D.; Hardcastle, M. J.; Cantwell, T. M.; Scaife, A. M. M.; Brienza, M.; Bonafede, A.; Breton, R. P.; Broderick, J. W.; Carbone, D.; Croston, J. H.; Farnes, J. S.; Harwood, J. J.; Heesen, V.; Horneffer, A.; van der Horst, A. J.; Iacobelli, M.; Jurusik, W.; Kokotanekov, G.; McKean, J. P.; Morabito, L. K.; Mulcahy, D. D.; Nikiel-Wroczyñski, B. S.; Orrú, E.; Paladino, R.; Pandey-Pommier, M.; Pietka, M.; Pizzo, R.; Pratley, L.; Riseley, C. J.; Rottgering, H. J. A.; Rowlinson, A.; Sabater, J.; Sendlinger, K.; Shulevski, A.; Sridhar, S. S.; Stewart, A. J.; Tasse, C.; van Velzen, S.; van Weeren, R. J.; Wise, M. W.

    2017-05-01

    We report on the discovery in the LOFAR Multifrequency Snapshot Sky Survey (MSSS) of a giant radio galaxy (GRG) with a projected size of 2.56 ± 0.07 Mpc projected on the sky. It is associated with the galaxy triplet UGC 9555, within which one is identified as a broad-line galaxy in the Sloan Digital Sky Survey (SDSS) at a redshift of 0.05453 ± 1 × 10-5, and with a velocity dispersion of 215.86 ± 6.34 km s-1. From archival radio observations we see that this galaxy hosts a compact flat-spectrum radio source, and we conclude that it is the active galactic nucleus (AGN) responsiblefor generating the radio lobes. The radio luminosity distribution of the jets, and the broad-line classification of the host AGN, indicate this GRG is orientated well out of the plane of the sky, making its physical size one of the largest known for any GRG. Analysis of the infrared data suggests that the host is a lenticular type galaxy with a large stellar mass (log M/M⊙ = 11.56 ± 0.12), and a moderate star formation rate (1.2 ± 0.3 M⊙/ year). Spatially smoothing the SDSS images shows the system around UGC 9555 to be significantly disturbed, with a prominent extension to the south-east. Overall, the evidence suggests this host galaxy has undergone one or more recent moderate merger events and is also experiencing tidal interactions with surrounding galaxies, which have caused the star formation and provided the supply of gas to trigger and fuel the Mpc-scale radio lobes.

  11. Fetuin-A is Associated to Serum Calcium and AHSG T256S Genotype but Not to Coronary Artery Calcification.

    Science.gov (United States)

    Bellia, Chiara; Agnello, Luisa; Lo Sasso, Bruna; Milano, Salvatore; Bivona, Giulia; Scazzone, Concetta; Pivetti, Alessia; Novo, Giuseppina; Palermo, Chiara; Bonomo, Vito; La Grutta, Ludovico; Midiri, Massimo; Novo, Salvatore; Ciaccio, Marcello

    2016-06-01

    Vascular calcification has been recently associated to an increased cardiovascular risk and mortality. In few studies, Fetuin-A showed an association to coronary artery calcification (CAC), although the physiopathological mechanism underlying this association has not been fully established yet. Seventy-four patients with one or more cardiovascular risk factor and asymptomatic for coronary vasculopathy were included in the study. CAC was evaluated by Agatston score. Serum Fetuin-A levels were determined by ELISA. Molecular analysis of AHSG T256S gene variant (rs4918) was performed by PCR-RFLP. Serum Fetuin-A was correlated to serum calcium (r = 0,321; P = 0,018), but not to serum phosphorous. Multivariate linear regression analysis confirmed this association and showed that calcium and AHSG genotype were independent predictors of Fetuin-A (P = 0.037, P = 0.014, respectively). In particular, subjects carrying the SS genotype had lower levels of Fetuin-A and calcium (P = 0.037 and P = 0.038, respectively). When we compare subjects with CAC 0-10 with subjects with CAC > 10, we found that only age and male gender (P < 0.001, P = 0.035, respectively), but not Fetuin-A, were associated to CAC. Fetuin-A is not associated to CAC in subjects with low cardiovascular risk profile and asymptomatic for coronary vasculopathy, suggesting that in this setting Fetuin-A, although correlated to serum levels of calcium, could be not involved in mineral deposition on coronary vessels.

  12. Whole-brain CT perfusion and CT angiography assessment of Moyamoya disease before and after surgical revascularization: preliminary study with 256-slice CT.

    Directory of Open Access Journals (Sweden)

    Jun Zhang

    Full Text Available BACKGROUND/AIMS: The 256-slice CT enables the entire brain to be scanned in a single examination. We evaluated the application of 256-slice whole-brain CT perfusion (CTP in determining graft patency as well as investigating cerebral hemodynamic changes in Moyamoya disease before and after surgical revascularization. METHODS: Thirty-nine cases of Moyamoya disease were evaluated before and after surgical revascularization with 256-slice CT. Whole-brain perfusion images and dynamic 3D CT angiographic images generated from perfusion source data were obtained in all patients. Cerebral blood flow (CBF, cerebral blood volume (CBV, time to peak (TTP and mean transit time (MTT of one hemisphere in the region of middle cerebral artery (MCA distribution and contralateral mirroring areas were measured. Relative CTP values (rCBF, rCBV, rTTP, rMTT were also obtained. Differences in pre- and post- operation perfusion CT values were assessed with paired t test or matched-pairs signed-ranks test. RESULTS: Preoperative CBF, MTT and TTP of potential surgical side were significantly different from those of contralateral side (P<0.01 for all. All graft patencies were displayed using the 3D-CTA images. Postoperative CBF, rCBF and rCBV values of surgical side in the region of MCA were significantly higher than those before operation (P<0.01 for all. Postoperative MTT, TTP, rMTT and rTTP values of the surgical side in the region of MCA were significantly lower than those before operation (P<0.05 for all. CONCLUSION: The 256-slice whole-brain CTP can be used to evaluate cerebral hemodynamic changes in Moyamoya disease before and after surgery and the 3D-CTA is useful for assessing the abnormalities of intracranial arteries and graft patencies.

  13. Celecoxib and Ibuprofen Restore the ATP Content and the Gluconeogenesis Activity in the Liver of Walker-256 Tumor-Bearing Rats

    Directory of Open Access Journals (Sweden)

    Camila Oliveira de Souza

    2015-07-01

    Full Text Available Background/Aims: The main purpose of this study was to investigate the effects of celecoxib and ibuprofen, both non-steroidal anti-inflammatory drugs (NSAIDs, on the decreased gluconeogenesis observed in liver of Walker-256 tumor-bearing rats. Methods: Celecoxib and ibuprofen (both at 25 mg/Kg were orally administered for 12 days, beginning on the same day when the rats were inoculated with Walker-256 tumor cells. Results: Celecoxib and ibuprofen treatment reversed the reduced production of glucose, pyruvate, lactate and urea from alanine as well as the reduced production of glucose from pyruvate and lactate in perfused liver from tumor-bearing rats. Besides, celecoxib and ibuprofen treatment restored the decreased ATP content, increased triacylglycerol levels and reduced mRNA expression of carnitine palmitoyl transferase 1 (CPT1, while ibuprofen treatment restored the reduced mRNA expression of peroxisome proliferator-activated receptor alpha (PPARα in the liver of tumor-bearing rats. Both treatments tended to decrease TNFα, IL6 and IL10 in the liver of tumor-bearing rats. Finally, the treatment with celecoxib, but not with ibuprofen, reduced the growth of Walker-256 tumor. Conclusion: Celecoxib and ibuprofen restored the decreased gluconeogenesis in the liver of Walker-256 tumor-bearing rats. These effects did not involve changes in tumor growth and probably occurred by anti-inflammatory properties of these NSAIDs, which increased expression of genes associated with fatty acid oxidation (PPARα and CPT1 and consequently the ATP production, normalizing the energy status in the liver of tumor-bearing rats.

  14. Value of knowledge-based iterative model reconstruction in low-kV 256-slice coronary CT angiography.

    Science.gov (United States)

    Yuki, Hideaki; Utsunomiya, Daisuke; Funama, Yoshinori; Tokuyasu, Shinichi; Namimoto, Tomohiro; Hirai, Toshinori; Itatani, Ryo; Katahira, Kazuhiro; Oshima, Shuichi; Yamashita, Yasuyuki

    2014-01-01

    Most current iterative reconstruction algorithms for CT imaging are a mixture of iterative reconstruction and filtered back projection. The value of "fully" iterative reconstruction in coronary CT angiography remains poorly understood. We aimed to assess the value of the knowledge-based iterative model reconstruction (IMR) algorithm on the qualitative and quantitative image quality at 256-slice cardiac CT. We enrolled 21 patients (mean age: 69 ± 11 years) who underwent retrospectively ECG gated coronary CT anhgiography at 100 kVp tube voltage. Images were reconstructed with the filtered back projection (FBP), hybrid iterative reconstruction (IR), and IMR algorithms. CT attenuation and the contrast-to-noise ratio (CNR) of the coronary arteries were calculated. With the use of a 4-point scale, 2 reviewers visually evaluated the coronary arteries and cardiac structures. The mean CT attenuation of the proximal coronary arteries was 369.3 ± 73.6 HU, 363.9 ± 75.3 HU, and 363.3 ± 74.5 HU, respectively, for FBP, hybrid IR, and IMR and was not significantly different. The image noise of the proximal coronary arteries was significantly lower with IMR (11.3 ± 2.8 HU) than FBP (51.9 ± 12.9 HU) and hybrid IR (23.2 ± 5.2 HU). The mean CNR of the proximal coronary arteries was 9.4 ± 2.4, 20.2 ± 4.7, and 41.8 ± 9.5 with FBP, hybrid IR and IMR, respectively; it was significantly higher with IMR. The best subjective image quality for coronary vessels was obtained with IMR (proximal vessels: FBP, 2.6 ± 0.5; hybrid IR, 3.4 ± 0.5; IMR, 3.8 ± 0.4; distal vessels: FBP, 2.3 ± 0.5; hybrid IR. 3.1 ± 0.5; IMR, 3.7 ± 0.5). IMR also yielded the best visualization for cardiac systems, that is myocardium and heart valves. The novel knowledge-based IMR algorithm yields significantly improved CNR and better subjective image quality of coronary vessels and cardiac systems with reliable CT number measurements for cardiac CT imaging. Copyright © 2014 Society of Cardiovascular

  15. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN256 in the Coastal Waters of SE Alaska from 2010-10-23 to 2010-11-03 (NODC Accession 0104361)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104361 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN256 in the Coastal...

  16. Matthew Hammond, ed., New Perspectives on Medieval Scotland 1093-1286. Studies in Celtic History, 32. Woodbridge: The Boydell Press, 2013. Pp. xvi, 256. ISBN 978-1-84383-853-1. £60.00.

    Directory of Open Access Journals (Sweden)

    Elizabeth Ewan

    2014-08-01

    Full Text Available Matthew Hammond, ed., New Perspectives on Medieval Scotland 1093-1286. Studies in Celtic History, 32. Woodbridge: The Boydell Press, 2013. Pp. xvi, 256. ISBN 978-1-84383-853-1. £60.00.

  17. Anti-Inflammatory and Cytoprotective Effects of TMC-256C1 from Marine-Derived Fungus Aspergillus sp. SF-6354 via up-Regulation of Heme Oxygenase-1 in Murine Hippocampal and Microglial Cell Lines

    Directory of Open Access Journals (Sweden)

    Dong-Cheol Kim

    2016-04-01

    Full Text Available In the course of searching for bioactive secondary metabolites from marine fungi, TMC-256C1 was isolated from an ethyl acetate extract of the marine-derived fungus Aspergillus sp. SF6354. TMC-256C1 displayed anti-neuroinflammatory effect in BV2 microglial cells induced by lipopolysaccharides (LPS as well as neuroprotective effect against glutamate-stimulated neurotoxicity in mouse hippocampal HT22 cells. TMC-256C1 was shown to develop a cellular resistance to oxidative damage caused by glutamate-induced cytotoxicity and reactive oxygen species (ROS generation in HT22 cells, and suppress the inflammation process in LPS-stimulated BV2 cells. Furthermore, the neuroprotective and anti-neuroinflammatory activities of TMC-256C1 were associated with upregulated expression of heme oxygenase (HO-1 and nuclear translocation of nuclear factor-E2-related factor 2 (Nrf2 in HT22 and BV2 cells. We also found that TMC-256C1 activated p38 mitogen-activated protein kinases (MAPK and phosphatidylinositol 3-kinase (PI3K/Akt signaling pathways in HT22 and BV2 cells. These results demonstrated that TMC-256C1 activates HO-1 protein expression, probably by increasing nuclear Nrf2 levels via the activation of the p38 MAPK and PI3K/Akt pathways.

  18. Automated Computer-Assisted Diagnosis of Obstructive Coronary Artery Disease in Emergency Department Patients Undergoing 256-Slice Coronary Computed Tomography Angiography for Acute Chest Pain.

    Science.gov (United States)

    Hashoul, Sharbell; Gaspar, Tamar; Halon, David A; Lewis, Basil S; Shenkar, Yuval; Jaffe, Ronen; Peled, Nathan; Rubinshtein, Ronen

    2015-10-01

    A 256-slice coronary computed tomography angiography (CCTA) is an accurate method for detection and exclusion of obstructive coronary artery disease (OBS-CAD). However, accurate image interpretation requires expertise and may not be available at all hours. The purpose of this study was to evaluate the usefulness of a fully automated computer-assisted diagnosis (COMP-DIAG) tool for exclusion of OBS-CAD in patients in the emergency department (ED) presenting with chest pain. Three hundred sixty-nine patients in ED without known coronary disease underwent 256-slice CCTA as part of the assessment of chest pain of uncertain origin. COMP-DIAG (CorAnalyzer II) automatically reported presence or exclusion of OBS-CAD (>50% stenosis, ≥1 vessel). Performance characteristics of COMP-DIAG for exclusion and detection of OBS-CAD were determined using expert reading as the reference standard. Seventeen (5%) studies were unassessable by COMP-DIAG software, and 352 patients (1,056 vessels) were therefore available for analysis. COMP-DIAG identified 33% of assessable studies as having OBS-CAD, but the prevalence of OBS-CAD on CCTA was only 18% (66 of 352 patients) by standard expert reading. However, COMP-DIAG correctly identified 61 of the 66 patients (93%) with OBS-CAD with 21 vessels (2%) with OBS-CAD misclassified as negative. In conclusion, compared to expert reading, automated computer-assisted diagnosis using the CorAnalyzer showed high sensitivity but only moderate specificity for detection of obstructive coronary disease in patients in ED who underwent 256-slice CCTA. The high negative predictive value of this computer-assisted algorithm may be useful in the ED setting. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Characterization and optimization of a high-efficiency AlGaAs-On-Insulator-based wavelength converter for 64- and 256-QAM signals

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Yankov, Metodi Plamenov; Porto da Silva, Edson

    2017-01-01

    In this paper, we demonstrate wavelength conversion of advanced modulation formats such as 10-GBd 64-QAM and 256-QAM with high conversion efficiency over a 29-nm spectral window by using four-wave mixing in an AlGaAs-On-Insulator (AlGaAsOI) nano-waveguide. A thorough characterization...... of the wavelength converter is reported, including the optimization of the AlGaAsOI nano-waveguide in terms of conversion efficiency and associated bandwidth and the analysis of the impact of the converter pump quality and power as well as the signal input power. The optimized converter enables generating idlers...

  20. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256's Spread, and Evolution of Russia ST8-IV.

    Science.gov (United States)

    Wan, Tsai-Wen; Khokhlova, Olga E; Iwao, Yasuhisa; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V; Singur, Olga A; Gostev, Vladimir V; Sidorenko, Sergey V; Peryanova, Olga V; Salmina, Alla B; Reva, Galina V; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256's strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages.

  1. Production of {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sato, N.; Sato, T.K.; Asai, M. [Japan Atomic Energy Agency, Ibaraki (Japan). Advanced Science Research Center; and others

    2014-04-01

    Production cross-sections of the isotope {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions were measured using a He/KCl gas-jet transport system and a rotating wheel a-particle detection apparatus. The α-particle energy of {sup 256}Lr was distributed from 8.3 to 8.7 MeV and its half-life, T{sub 1/2}, was measured to be 28 ± 1 s. The maximum cross sections in the {sup 249}Cf({sup 11}B, 4n){sup 256}Lr and {sup 243}Am({sup 18}O, 5n){sup 256}Lr reactions were determined to be 122 ± 36 nb at the beam energy of 63 MeV and 26 ± 7 nb at 96 MeV, respectively. In the {sup 248}Cm({sup 14}N, 6n){sup 256}Lr reaction, the cross section was measured to be 27 ± 10 nb at 91 MeV. (orig.)

  2. Whole-organ CT perfusion of the pancreas: impact of iterative reconstruction on image quality, perfusion parameters and radiation dose in 256-slice CT-preliminary findings.

    Directory of Open Access Journals (Sweden)

    Qian Xie

    Full Text Available BACKGROUND: This study was performed to assess whether iterative reconstruction can reduce radiation dose while maintaining acceptable image quality, and to investigate whether perfusion parameters vary from conventional filtered back projection (FBP at the low-tube-voltage (80-kVp during whole-pancreas perfusion examination using a 256-slice CT. METHODS: 76 patients with known or suspected pancreatic mass underwent whole-pancreas perfusion by a 256-slice CT. High- and low-tube-voltage CT images were acquired. 120-kVp image data (protocol A and 80-kVp image data (protocol B were reconstructed with conventional FBP, and 80-kVp image data were reconstructed with iDose(4 (protocol C iterative reconstruction. The image noise; contrast-to-noise ratio (CNR relative to muscle for the pancreas, liver, and aorta; and radiation dose of each protocol were assessed quantitatively. Overall image quality was assessed qualitatively. Among 76 patients, 23 were eventually proven to have a normal pancreas. Perfusion parameters of normal pancreas in each protocol including blood volume, blood flow, and permeability-surface area product were measured. RESULTS: In the quantitative study, protocol C reduced image noise by 36.8% compared to protocol B (P<0.001. Protocol C yielded significantly higher CNR relative to muscle for the aorta, pancreas and liver compared to protocol B (P<0.001, and offered no significant difference compared to protocol A. In the qualitative study, protocols C and A gained similar scores and protocol B gained the lowest score for overall image quality (P<0.001. Mean effective doses were 23.37 mSv for protocol A and 10.81 mSv for protocols B and C. There were no significant differences in the normal pancreas perfusion values among three different protocols. CONCLUSION: Low-tube-voltage and iDose(4 iterative reconstruction can dramatically decrease the radiation dose with acceptable image quality during whole-pancreas CT perfusion and have no

  3. Evaluation of image quality and radiation dose at prospective ECG-triggered axial 256-slice multi-detector CT in infants with congenital heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Mei-ping; Liang, Chang-hong; Zhao, Zhen-jun; Liu, Hui; Li, Jing-lei; Zhang, Jin-e; Cui, Yan-hai; Yang, Lin; Liu, Qi-shun [Guangdong Academy of Medical Sciences, Guangdong General Hospital, Department of Radiology, Guangzhou (China); Ivanc, Thomas B.; Vembar, Mani [Philips Healthcare, CT Clinical Science, Highland Heights, OH (United States)

    2011-07-15

    There are a limited number of reports on the technical and clinical feasibility of prospective electrocardiogram (ECG)-gated multi-detector computed tomography (MDCT) in infants with congenital heart disease (CHD). To evaluate image quality and radiation dose at weight-based low-dose prospectively gated 256-slice MDCT angiography in infants with CHD. From November 2009 to February 2010, 64 consecutive infants with CHD referred for pre-operative or post-operative CT were included. All were scanned on a 256-slice MDCT system utilizing a low-dose protocol (80 kVp and 60-120 mAs depending on weight: 60 mAs for {<=}3 kg, 80 mAs for 3.1-6 kg, 100 mAs for 6.1-10 kg, 120 mAs for 10.1-15 kg). No serious adverse events were recorded. A total of 174 cardiac deformities, confirmed by surgery or heart catheterization, were studied. The sensitivity of MDCT for cardiac deformities was 97.1%; specificity, 99.4%; accuracy, 95.9%. The mean heart rate during scan was 136.7 {+-} 14.9/min (range, 91-160) with a corresponding heart rate variability of 2.8 {+-} 2.2/min (range, 0-8). Mean scan length was 115.3 {+-} 11.7 mm (range, 93.6-143.3). Mean volume CT dose index, mean dose-length product and effective dose were 2.1 {+-} 0.4 mGy (range, 1.5-2.8), 24.7 {+-} 5.9 mGy.cm (range, 14.7-35.8) and 1.6 {+-} 0.3 mSv (range, 1.1-2.5), respectively. Diagnostic-quality images were achieved in all cases. Satisfactory diagnostic quality for visualization of all/proximal/distal coronary artery segments was achieved in 88.4/98.8/80.0% of the scans. Low-dose prospectively gated axial 256-slice CT angiography is a valuable tool in the routine clinical evaluation of infants with CHD, providing a comprehensive three-dimensional evaluation of the cardiac anatomy, including the coronary arteries. (orig.)

  4. Coronary Plaque Characteristics Assessed by 256-Slice Coronary CT Angiography and Association with High-Sensitivity C-Reactive Protein in Symptomatic Patients with Type 2 Diabetes.

    Science.gov (United States)

    Zhang, Jinling; Lv, Zhehao; Zhao, Deli; Liu, Lili; Wan, Yong; Fan, Tingting; Li, Huimin; Guan, Ying; Liu, Bailu; Yang, Qi

    2016-01-01

    Little is known regarding plaque distribution, composition, and the association with inflammation in type 2 diabetes mellitus (DM2). This study aimed to assess the relationship between coronary plaque subtypes and high-sensitivity C-reactive protein levels. Coronary CTA were performed in 98 symptomatic DM2 patients and 107 non-DM2 patients using a 256-slice CT. The extent and types of plaque as well as luminal narrowing were evaluated. Patients with DM2 were more likely to have significant stenosis (>50%) with calcified plaques in at least one coronary segment (p DM2 and non-DM2 groups were 31.6% and 4.7%, respectively (p DM2 with calcified plaques were higher compared with values obtained for the non-DM2 group (p DM2 patients.

  5. Walker 256 tumour cells increase substance P immunoreactivity locally and modify the properties of the blood-brain barrier during extravasation and brain invasion.

    Science.gov (United States)

    Lewis, Kate M; Harford-Wright, Elizabeth; Vink, Robert; Nimmo, Alan J; Ghabriel, Mounir N

    2013-01-01

    It is not yet known how tumour cells traverse the blood-brain barrier (BBB) to form brain metastases. Substance P (SP) release is a key component of neurogenic inflammation which has been recently shown to increase the permeability of the BBB following CNS insults, making it a possible candidate as a mediator of tumour cell extravasation into the brain. This study investigated the properties of the BBB in the early stages of tumour cell invasion into the brain, and the possible involvement of SP. Male Wistar rats were injected with Walker 256 breast carcinoma cells via the internal carotid artery and euthanised at 1, 3, 6 and 9 days post tumour inoculation. Culture medium-injected animals served as controls at 1 and 9 days. Evidence of tumour cell extravasation across the BBB was first observed at 3 days post-inoculation, which corresponded with significantly increased albumin (p tumoral area (p cerebral metastases may be a SP-mediated process.

  6. Two novel variants of human medium chain acyl-CoA dehydrogenase (MCAD). K364R, a folding mutation, and R256T, a catalytic-site mutation resulting in a well-folded but totally inactive protein

    DEFF Research Database (Denmark)

    O'Reilly, Linda P; Andresen, Brage S; Engel, Paul C

    2005-01-01

    the gene for K364R was overexpressed in Escherichia coli, the synthesized mutant protein only exhibited activity when the gene for chaperonin GroELS was co-overexpressed. Levels of activity correlated with the amounts of native MCAD protein visible in western blots. The R256T mutant, by contrast, displayed...... no activity either with or without chaperonin, but in this case a strong MCAD protein band was seen in the western blots throughout. The proteins were also purified, and the enzyme function and thermostability investigated. The K364R protein showed only moderate kinetic impairment, whereas the R256T protein...... was again totally inactive. Neither mutant showed marked depletion of FAD. The pure K364R protein was considerably less thermostable than wild-type MCAD. Western blots indicated that, although the R256T mutant protein is less thermostable than normal MCAD, it is much more stable than K364R. Though...

  7. Fundus Autofluorescence and SD-OCT Document Rapid Progression in Autosomal Dominant Vitreoretinochoroidopathy (ADVIRC) Associated with a c.256G > A Mutation in BEST1.

    Science.gov (United States)

    Kellner, Simone; Stöhr, Heidi; Fiebig, Britta; Weinitz, Silke; Farmand, Ghazaleh; Kellner, Ulrich; Weber, Bernhard H F

    2016-06-01

    To report the variability of clinical findings, rapid concentric progression, and successful treatment of macular edema in autosomal dominant vitreoretinochoroidopathy (ADVIRC) associated with a heterozygous c.256G > A missense mutation in the bestrophin-1 (BEST1) gene. Three affected members of a four-generation ADVIRC family were examined with fundus autofluorescence (FAF), near-infrared autofluorescence (NIA) and spectral domain optical coherence tomography (SD-OCT). Direct sequence analysis of coding and flanking intronic regions of the BEST1 gene was performed. Disease manifestations presented with high variability with visual problems manifesting between 10 and 40 years of age. Two probands showed marked signs of peripheral degeneration, while this retinal area was not noticeably affected in the third. Cystoid macular edema was present in one proband, which responded to long-term treatment with topic dorzolamide with improved visual acuity. FAF and NIA revealed mid-peripheral retinal degeneration in areas that appeared normal on ophthalmoscopy. The full-field ERG was markedly reduced in two probands. Within a 5-year period a marked increase in concentric progression of degeneration including the posterior pole was documented with FAF, NIA and SD-OCT in one proband after the age of 63 years. Direct sequence analysis of the BEST1 gene revealed a heterozygous c.256G > A missense mutation in the three affected probands. The findings in this family emphasize the previously noted variability of clinical manifestations in BEST1-associated ADVIRC and the relevance of FAF and NIA imaging. Cystoid macular edema and vascular leakage can be successfully treated using dorzolamide.

  8. Tumor growth reduction is regulated at the gene level in Walker 256 tumor-bearing rats supplemented with fish oil rich in EPA and DHA

    Energy Technology Data Exchange (ETDEWEB)

    Borghetti, G.; Yamazaki, R.K.; Coelho, I.; Pequito, D.C.T.; Schiessel, D.L.; Kryczyk, M.; Mamus, R.; Naliwaiko, K.; Fernandes, L.C. [Departamento de Fisiologia, Setor de Ciências Biológicas, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2013-08-23

    We investigated the effect of fish oil (FO) supplementation on tumor growth, cyclooxygenase 2 (COX-2), peroxisome proliferator-activated receptor gamma (PPARγ), and RelA gene and protein expression in Walker 256 tumor-bearing rats. Male Wistar rats (70 days old) were fed with regular chow (group W) or chow supplemented with 1 g/kg body weight FO daily (group WFO) until they reached 100 days of age. Both groups were then inoculated with a suspension of Walker 256 ascitic tumor cells (3×10{sup 7} cells/mL). After 14 days the rats were killed, total RNA was isolated from the tumor tissue, and relative mRNA expression was measured using the 2{sup -ΔΔCT} method. FO significantly decreased tumor growth (W=13.18±1.58 vs WFO=5.40±0.88 g, P<0.05). FO supplementation also resulted in a significant decrease in COX-2 (W=100.1±1.62 vs WFO=59.39±5.53, P<0.001) and PPARγ (W=100.4±1.04 vs WFO=88.22±1.46, P<0.05) protein expression. Relative mRNA expression was W=1.06±0.022 vs WFO=0.31±0.04 (P<0.001) for COX-2, W=1.08±0.02 vs WFO=0.52±0.08 (P<0.001) for PPARγ, and W=1.04±0.02 vs WFO=0.82±0.04 (P<0.05) for RelA. FO reduced tumor growth by attenuating inflammatory gene expression associated with carcinogenesis.

  9. Minimized Radiation and Contrast Agent Exposure for Coronary Computed Tomography Angiography: First Clinical Experience on a Latest Generation 256-slice Scanner.

    Science.gov (United States)

    Benz, Dominik C; Gräni, Christoph; Hirt Moch, Beatrice; Mikulicic, Fran; Vontobel, Jan; Fuchs, Tobias A; Stehli, Julia; Clerc, Olivier F; Possner, Mathias; Pazhenkottil, Aju P; Gaemperli, Oliver; Buechel, Ronny R; Kaufmann, Philipp A

    2016-08-01

    The aim of the study was to evaluate the impact of the latest coronary computed tomography angiography (CCTA) techniques allowing a radiation- and contrast-sparing protocol on image quality in unselected patients referred for exclusion of suspected coronary artery disease (CAD). This prospective study was approved by the local ethics committee, and all patients provided written informed consent. Between March and June 2015, 89 consecutive patients (61% male; mean age 55 ± 11 years) referred for exclusion of CAD by 256-slice CCTA using prospective electrocardiogram triggering were included. Tube voltage (80-120 kVp), tube current (180-310 mA) as well contrast agent volume (25-45 mL) and flow rate (3.5-5 mL/s) were adapted to body mass index. Signal intensity was measured by placing a region of interest in the aortic root, the left main artery, and the proximal right coronary artery. Image noise was measured in the aortic root. Two independent blinded readers semi-quantitatively assessed the image quality regarding motion, noise, and contrast on a 4-point scale. Median contrast agent volume and median effective radiation dose were 35 mL (interquartile range, 30-40 mL) and 0.5 mSv (interquartile range, 0.4-0.6 mSv), respectively. Mean attenuation in the aortic root was 412 ± 89 Hounsfield units. Diagnostic image quality was obtained in 1050 of 1067 (98.4%) coronary segments and, on an intention-to-diagnosis basis, in 85 of 89 (95.5%) patients. Below a cut-off heart rate of 67 beats/min, only 1 of 974 (0.1%) coronary segments was nondiagnostic. A radiation- and contrast-sparing protocol for CCTA on a latest generation 256-slice computed tomography scanner yields diagnostic image quality in patients referred for CAD exclusion in daily clinical routine. Copyright © 2016 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

  10. Optimization and In Vivo Profiling of a Refined Rat Model of Walker 256 Breast Cancer Cell-Induced Bone Pain Using Behavioral, Radiological, Histological, Immunohistochemical and Pharmacological Methods.

    Science.gov (United States)

    Shenoy, Priyank; Kuo, Andy; Vetter, Irina; Smith, Maree T

    2017-01-01

    In the majority of patients with advanced breast cancer, there is metastatic spread to bones resulting in pain. Clinically available drug treatments for alleviation of breast cancer-induced bone pain (BCIBP) often produce inadequate pain relief due to dose-limiting side-effects. A major impediment to the discovery of novel well-tolerated analgesic agents for the relief of pain due to bony metastases is the fact that most cancer-induced bone pain models in rodents relied on the systemic injection of cancer cells, causing widespread formation of cancer metastases and poor general animal health. Herein, we have established an optimized, clinically relevant Wistar Han female rat model of breast cancer induced bone pain which was characterized using behavioral assessments, radiology, histology, immunohistochemistry and pharmacological methods. In this model that is based on unilateral intra-tibial injection (ITI) of Walker 256 carcinoma cells, animals maintained good health for at least 66 days post-ITI. The temporal development of hindpaw hypersensitivity depended on the initial number of Walker 256 cells inoculated in the tibiae. Hindpaw hypersensitivity resolved after approximately 25 days, in the continued presence of bone tumors as evidenced by ex vivo histology, micro-computed tomography scans and immunohistochemical assessments of tibiae. A possible role for the endogenous opioid system as an internal factor mediating the self-resolving nature of BCIBP was identified based upon the observation that naloxone, a non-selective opioid antagonist, caused the re-emergence of hindpaw hypersensitivity. Bolus dose injections of morphine, gabapentin, amitriptyline and meloxicam all alleviated hindpaw hypersensitivity in a dose-dependent manner. This is a first systematic pharmacological profiling of this model by testing standard analgesic drugs from four important diverse classes, which are used to treat cancer induced bone pain in the clinical setting. Our refined rat

  11. Infections During Induction Therapy of Protocol CCLG-2008 in Childhood Acute Lymphoblastic Leukemia: A Single-center Experience with 256 Cases in China

    Directory of Open Access Journals (Sweden)

    Si-Dan Li

    2015-01-01

    Full Text Available Background: Infections remain a major cause of therapy-associated morbidity and mortality in children with acute lymphoblastic leukemia (ALL. Methods: We retrospectively analyzed the medical charts of 256 children treated for ALL under the CCLG-2008 protocol in Beijing Children′s Hospital. Results: There were 65 infectious complications in 50 patients during vincristine, daunorubicin, L-asparaginase and dexamethasone induction therapy, including microbiologically documented infections (n = 12; 18.5%, clinically documented infections (n = 23; 35.3% and fever of unknown origin (n = 30; 46.2%. Neutropenia was present in 83.1% of the infectious episodes. In all, most infections occurred around the 15 th day of induction treatment (n = 28, and no patients died of infection-associated complications. Conclusions: The infections in this study was independent of treatment response, minimal residual diseases at the end of induction therapy, gender, immunophenotype, infection at first visit, risk stratification at diagnosis, unfavorable karyotypes at diagnosis and morphologic type. The infection rate of CCLG-2008 induction therapy is low, and the outcome of patients is favorable.

  12. Spastic paraplegia mutation N256S in the neuronal microtubule motor KIF5A disrupts axonal transport in a Drosophila HSP model.

    Directory of Open Access Journals (Sweden)

    Petra Füger

    Full Text Available Hereditary spastic paraplegias (HSPs comprise a group of genetically heterogeneous neurodegenerative disorders characterized by spastic weakness of the lower extremities. We have generated a Drosophila model for HSP type 10 (SPG10, caused by mutations in KIF5A. KIF5A encodes the heavy chain of kinesin-1, a neuronal microtubule motor. Our results imply that SPG10 is not caused by haploinsufficiency but by the loss of endogenous kinesin-1 function due to a selective dominant-negative action of mutant KIF5A on kinesin-1 complexes. We have not found any evidence for an additional, more generalized toxicity of mutant Kinesin heavy chain (Khc or the affected kinesin-1 complexes. Ectopic expression of Drosophila Khc carrying a human SPG10-associated mutation (N256S is sufficient to disturb axonal transport and to induce motoneuron disease in Drosophila. Neurofilaments, which have been recently implicated in SPG10 disease manifestation, are absent in arthropods. Impairments in the transport of kinesin-1 cargos different from neurofilaments are thus sufficient to cause HSP-like pathological changes such as axonal swellings, altered structure and function of synapses, behavioral deficits, and increased mortality.

  13. Study of EDFA and Raman system transmission reach with 256 Gb/s PM-16QAM signals over three optical fibers with 100 km spans.

    Science.gov (United States)

    Downie, John D; Hurley, Jason; Pikula, Dragan; Ten, Sergey; Towery, Chris

    2013-07-15

    We compare the transmission performance of three different optical fibers in separate 256 Gb/s PM-16QAM systems amplified with erbium doped fiber amplifiers (EDFAs) and distributed Raman amplification. The span length in each system is 100 km. The fibers studied include standard single-mode fiber, single-mode fiber with ultra-low loss, and ultra-low loss fiber with large effective area. We find that the single-mode fiber with ultra-low loss and the large effective area fiber with ultra-low loss afford reach advantages of up to about 31% and 80%, respectively, over standard fiber measured at distances with 3 dB margin over the forward error correction (FEC) threshold. The Raman amplified systems provide about 50% reach length enhancement over the EDFA systems for all three fibers in the experimental set-up. For the best performing fiber with large effective area and ultra-low loss, the absolute reach lengths with 3 dB margin are greater than 1140 km and 1700 km for the for EDFA and Raman systems, respectively.

  14. Noise properties for three weighted Feldkamp algorithms using a 256-detecotor row CT-scanner: case study for hepatic volumetric cine imaging.

    Science.gov (United States)

    Mori, Shinichiro; Endo, Masahiro; Obata, Takayuki; Kishimoto, Riwa; Kato, Hirotoshi; Kandatsu, Susumu; Tsujii, Hirohiko; Tanada, Shuji

    2006-08-01

    In cone-beam geometry, image quality may be degraded or artifacts may occur if the cone angle is substantially wide. This is because a cone-beam scan along a circular orbit does not collect the complete set of data required to make an exact reconstruction of all volumetric data. To increase temporal resolution and thus image quality in cone-beam geometry, Silver proposed the new half-scan algorithm (NHS-FDK), which extends Parker's weighting function (HS-FDK) by utilizing a larger range up to 2pi. Here, we evaluated these algorithms for hepatic contrast-enhanced CT in cine scan mode using a 256-detector row CT. The full-scan (FS-FDK) images show uniform distribution of the image noise and CT-number uniformity. Image noise and CT-number uniformity with HS-FDK and NHS-FDK images follow the initial projection angle. HS-FDK images therefore have more changeable higher intensity (brighter) and a lower intensity (darker) areas than respective FS-FDK and NHS-FDK images. We concluded that, considering the trade-off between image quality and temporal resolution, the NHS-FDK algorithm is useful in volumetric cine imaging for the abdomen.

  15. Multiresidue determination of 256 pesticides in lavandin essential oil by LC/ESI/sSRM: advantages and drawbacks of a sampling method involving evaporation under nitrogen.

    Science.gov (United States)

    Fillâtre, Yoann; Rondeau, David; Daguin, Antoine; Jadas-Hecart, Alain; Communal, Pierre-Yves

    2014-02-01

    The determination of 256 multiclass pesticides in lavandin essential oil has been performed by liquid chromatography-electrospray ionization tandem mass spectrometry using the scheduled selected reaction monitoring mode available on a quadrupole-linear ion trap mass spectrometer. With the aim of improving the limits of quantification (LOQs) of the target molecules, a sampling step based on evaporation of the essential oil under a nitrogen flow assisted by controlled heating was tested. The LOQs determined in this case were compared with the values obtained with the classic dilution preparation method. With sampling by dilution, 247 pesticides were detected and quantified at low concentration, with 74 % of the pesticides having LOQs of 10 μg L(-1) or less. With the evaporation method, a global improvement of the LOQs was observed, with lower LOQs for 92 active substances and LOQs of 10 μg L(-1) or less for 82.8 % of the pesticides. Almost twice as many active substances had an LOQ of 1 μg L(-1) or less when the evaporation method was used. Some pesticides exhibited poor recovery or high variance caused by volatilization or degradation during the evaporation step. This behavior was evidenced by the case of thiophanate-methyl, which is degraded to carbendazim.

  16. Coronary Plaque Characteristics Assessed by 256-Slice Coronary CT Angiography and Association with High-Sensitivity C-Reactive Protein in Symptomatic Patients with Type 2 Diabetes

    Directory of Open Access Journals (Sweden)

    Jinling Zhang

    2016-01-01

    Full Text Available Little is known regarding plaque distribution, composition, and the association with inflammation in type 2 diabetes mellitus (DM2. This study aimed to assess the relationship between coronary plaque subtypes and high-sensitivity C-reactive protein levels. Coronary CTA were performed in 98 symptomatic DM2 patients and 107 non-DM2 patients using a 256-slice CT. The extent and types of plaque as well as luminal narrowing were evaluated. Patients with DM2 were more likely to have significant stenosis (>50% with calcified plaques in at least one coronary segment (p<0.01; the prevalence rates of diffuse calcified plaques in the DM2 and non-DM2 groups were 31.6% and 4.7%, respectively (p<0.01. Plasma hs-CRP levels in DM2 with calcified plaques were higher compared with values obtained for the non-DM2 group (p<0.01. In conclusion, combination of coronary CTA and hs-CRP might improve risk stratification in symptomatic DM2 patients.

  17. Alterations caused by physical training in pulmonary edema and loss of muscle mass in rats with Walker-256 tumor Alterações promovidas pelo treinamento físico no edema pulmonar e perda de massa muscular em ratos portadores de tumor Walker-256

    Directory of Open Access Journals (Sweden)

    Rubens Cecchini

    2008-10-01

    Full Text Available Walker-256 tumor is a fast-growing tumor and has been studied under several metabolic aspects associated or not to cachexia. It was observed in our laboratory that animals with Walker-256 tumor, after spontaneous death (usually around the fifteenth day, showed significant pulmonary edema with fluid in the pleural cavity. Some studies have suggested that physical training improves the survival of animals with tumor and minimizes the effects of cachexia. The purpose of our work was to assess the pulmonary edema index as well as the cardiac and skeletal muscle mass, besides the survival of rats with Walker-256 tumor submitted previously to physical training through swimming (N. For this study male Wistar rats (200 to 220 g were used, submitted to physical training through swimming (1 hour; 5 days a week, four weeks. One day after the training, sedentary rats (C or trained ones (N were submitted to inoculation on the right flank of 8 x 107 Walker-256 tumor cells (T. Immediately after spontaneous death of these animals, the pulmonary edema index (PEI, cardiac and skeletal muscle mass (gastrocnemius and soleus were evaluated. Pulmonary edema was evaluated through the index calculated by the relation between lung and body weights of each animal, and multiplied by 100 (PP/PC x 100 (LEE et al., 2001. Muscle mass (MM index was calculated similarly. In normal animals the PEI is equal to 0,53±0,02 (n=20. In tumor-bearing rats after spontaneous death the PEI was significantly higher (2,62±0,31, n=18. After the physical training in rats without tumor, the PEI was 0,55±0,03 (n=5. Whereas in tumor-bearing rats previously trained, it was obtained a pulmonary edema index lower than that of the control group with tumor (1,46±0,16, n=5; pO tumor Walker-256 é um carcinoma de crescimento rápido e tem sido estudado sob vários aspectos metabólicos, associados ou não, à caquexia. Foi observado, em nosso laboratório, que em animais portadores de tumor Walker

  18. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  19. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  20. Insulin, not glutamine dipeptide, reduces lipases expression and prevents fat wasting and weight loss in Walker 256 tumor-bearing rats.

    Science.gov (United States)

    de Morais, Hely; de Fatima Silva, Flaviane; da Silva, Francemilson Goulart; Silva, Milene Ortiz; Graciano, Maria Fernanda Rodrigues; Martins, Maria Isabel Lovo; Carpinelli, Ângelo Rafael; Mazucco, Tânia Longo; Bazotte, Roberto Barbosa; de Souza, Helenir Medri

    2017-07-05

    Cachexia is the main cause of mortality in advanced cancer patients. We investigated the effects of insulin (INS) and glutamine dipeptide (GDP), isolated or associated, on cachexia and metabolic changes induced by Walker 256 tumor in rats. INS (NPH, 40 UI/kg, sc) or GDP (1.5g/kg, oral gavage) was once-daily administered during 11 days after tumor cell inoculation. GDP, INS or INS+GDP treatments did not influence the tumor growth. However, INS and INS+GDP prevented retroperitoneal fat wasting and body weight loss of tumor-bearing rats. In consistency, INS and INS+GDP prevented the increased expression of triacylglycerol lipase (ATGL) and hormone sensitive lipase (HSL), without changing the expression of tumor necrosis factor α (TNF-α) and interleukin-6 (IL-6) in the retroperitoneal adipose tissue of tumor-bearing rats. INS and INS+GDP also prevented anorexia and hyperlactatemia of tumor-bearing rats. However, INS and INS+GDP accentuated the loss of muscle mass (gastrocnemius, soleus and long digital extensor) without affecting the myostatin expression in the gastrocnemius muscle and blood corticosterone. GDP treatment did not promote beneficial effects. It can be concluded that treatment with INS (INS or INS+GDP), not with GDP, prevented fat wasting and weight loss in tumor-bearing rats without reducing tumor growth. These effects might be attributed to the reduction of lipases expression (ATGL and LHS) and increased food intake. The results show the physiological function of INS in the suppression of lipolysis induced by cachexia mediators in tumor-bearing rats. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Pharmacokinetic/pharmacodynamic modeling of etoposide tumor growth inhibitory effect in Walker-256 tumor-bearing rat model using free intratumoral drug concentrations.

    Science.gov (United States)

    Pigatto, Maiara Cássia; Roman, Renatha Menti; Carrara, Letizia; Buffon, Andréia; Magni, Paolo; Dalla Costa, Teresa

    2017-01-15

    The purpose of this study was to establish a population pharmacokinetic/pharmacodynamic (PK/PD) model linking etoposide free tumor and total plasma concentrations to the inhibition of solid tumor growth in rats. Walker-256 tumor cells were inoculated subcutaneously in the right flank of Wistar rats, which were randomly divided in control and two treated groups that received etoposide 5 or 10mg/kg i.v. bolus every day for 8 and 4days, respectively, and tumor volume was monitored daily for 30days. The plasma and intratumoral concentrations-time profiles were obtained from a previous study and were modeled by a four-compartment population pharmacokinetic (popPK) model. PK/PD analysis was conducted using MONOLIX v.4.3.3 on average data and by mean of a nonlinear mixed-effect model. PK/PD data were analyzed using a modification of Simeoni Tumor Growth Inhibition (TGI) model by introduction of an Emax function to take into account the concentration dependency of k2variable parameter (variable potency). The Simeoni TGI-Emax model was capable to fit schedule-dependent antitumor effects using the tumor growth curves from the control and two different administered schedules. The PK/PD model was capable of describing the tumor growth inhibition using total plasma or free tumor concentrations, resulting in higher k2max (maximal potency) for free concentrations (25.8mL·μg(-1)·day(-1) - intratumoral vs. 12.6mL·μg(-1)·day(-1) total plasma). These findings indicate that the plasma concentration may not be a good surrogate for pharmacologically active free tumor concentrations, emphasizing the importance of knowing drug tumor penetration to choose the best antitumor therapy. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. The hemolytic component of cancer anemia: effects of osmotic and metabolic stress on the erythrocytes of rats bearing multifocal inoculations of the Walker 256 tumor

    Directory of Open Access Journals (Sweden)

    Vido A.A.

    2000-01-01

    Full Text Available Cancer anemia is classified as an anemia of chronic diseases, although it is sometimes the first symptom of cancer. Cancer anemia includes a hemolytic component, important in the terminal stage when even transfused cells are rapidly destroyed. The presence of a chronic component and the terminal complications of the illness limit studies of the hemolytic component. A multifocal model of tumor growth was used here to simulate the terminal metastatic dissemination stage (several simultaneous inoculations of Walker 256 cells. The hemolytic component of anemia began 3-4 days after inoculation in 100% of the rats and progressed rapidly thereafter: Hb levels dropped from 14.9 ± 0.02 to 8.7 ± 0.06 from days 7 to 11 (~5 times the physiologically normal rate in rats in the absence of bleeding. The development of anemia was correlated (r2 = 0.86 with the development of other systemic effects such as anorexia. There was a significant decrease in the osmotic fragility of circulating erythrocytes: the NaCl concentration causing 50% lysis was reduced from 4.52 ± 0.06 to 4.10 ± 0.01 (P<0.01 on day 7, indicating a reduction in erythrocyte volume. However, with mild metabolic stress (4-h incubation at 37oC, the erythrocytes showed a greater increase in osmotic fragility than the controls, suggesting marked alteration of erythrocyte homeostasis. These effects may be due to primary plasma membrane alterations (transport and/or permeability and/or may be secondary to metabolic changes. This multifocal model is adequate for studying the hemolytic component of cancer anemia since it is rapid, highly reproducible and causes minimal animal suffering.

  3. Diagnostic accuracy of low-dose 256-slice multi-detector coronary CT angiography using iterative reconstruction in patients with suspected coronary artery disease

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Yang; Ma, Yue; Wang, Yuke; Yu, Mei; Guo, Qiyong [Shengjing Hospital of China Medical University, Department of Radiology, Shenyang (China); Fan, Weipeng [Central Hospital of Anshan, Department of Radiology, Anshan (China); Vembar, Mani [CT Clinical Science Philips Healthcare, Cleveland, OH (United States)

    2014-01-15

    To evaluate the accuracy of low-dose coronary CTA with iterative reconstruction (IR) in the diagnosis of coronary artery disease (CAD) in patients with suspected CAD. Ninety-six patients with suspected CAD underwent low-dose prospective electrocardiogram-gated coronary CTA, with images reconstructed using IR. Image quality (IQ) of coronary segments were graded on a 4-point scale (4, excellent; 1, non-diagnostic). With invasive coronary angiography (ICA) considered the ''gold standard'', the sensitivity, specificity, positive predictive value (PPV), negative predictive value (NPV) and accuracy of coronary CTA were calculated on segment-, vessel- and patient-based levels. The patient data were divided into two groups (Agatston scores of ≥ 400 and <400). The differences in diagnostic performance between the two groups were tested. Diagnostic image quality was found in 98.1 % (1,232/1,256) of segments. The sensitivity, specificity, PPV, NPV and accuracy were 90.8 %, 95.3 %, 81.8 %, 97.8 % and 94.3 % (segment-based) and 97.2 %, 83.3 %, 94.6 %, 90.9 % and 93.8 % (patient-based). Significant differences between the two groups were seen in specificity, PPV and accuracy (92.1 % vs. 97.9 %, 76.0 % vs. 86.7 %, 91.7 % vs. 96.6 %, P < 0.05; segment-based). The average effective dose was 1.30 ± 0.15 mSv. Low-dose prospective coronary CTA with IR can acquire satisfactory image quality and show high diagnostic accuracy in patients with suspected CAD; however, blooming continues to pose a challenge in severely calcified segments. (orig.)

  4. Uncaria tomentosa exerts extensive anti-neoplastic effects against the Walker-256 tumour by modulating oxidative stress and not by alkaloid activity.

    Directory of Open Access Journals (Sweden)

    Arturo Alejandro Dreifuss

    Full Text Available This study aimed to compare the anti-neoplastic effects of an Uncaria tomentosa (UT brute hydroethanolic (BHE extract with those of two fractions derived from it. These fractions are choroformic (CHCl3 and n-butanolic (BuOH, rich in pentacyclic oxindole alkaloids (POA and antioxidant substances, respectively. The cancer model was the subcutaneous inoculation of Walker-256 tumour cells in the pelvic limb of male Wistar rat. Subsequently to the inoculation, gavage with BHE extract (50 mg.kg(-1 or its fractions (as per the yield of the fractioning process or vehicle (Control was performed during 14 days. Baseline values, corresponding to individuals without tumour or treatment with UT, were also included. After treatment, tumour volume and mass, plasma biochemistry, oxidative stress in liver and tumour, TNF-α level in liver and tumour homogenates, and survival rates were analysed. Both the BHE extract and its BuOH fraction successfully reduced tumour weight and volume, and modulated anti-oxidant systems. The hepatic TNF-α level indicated a greater effect from the BHE extract as compared to its BuOH fraction. Importantly, both the BHE extract and its BuOH fraction increased the survival time of the tumour-bearing animals. Inversely, the CHCl3 fraction was ineffective. These data represent an in vivo demonstration of the importance of the modulation of oxidative stress as part of the anti-neoplastic activity of UT, as well as constitute evidence of the lack of activity of isolated POAs in the primary tumour of this tumour lineage. These effects are possibly resulting from a synergic combination of substances, most of them with antioxidant properties.

  5. Iterative model reconstruction: improved image quality of low-tube-voltage prospective ECG-gated coronary CT angiography images at 256-slice CT.

    Science.gov (United States)

    Oda, Seitaro; Weissman, Gaby; Vembar, Mani; Weigold, Wm Guy

    2014-08-01

    To investigate the effects of a new model-based type of iterative reconstruction (M-IR) technique, the iterative model reconstruction, on image quality of prospectively gated coronary CT angiography (CTA) acquired at low-tube-voltage. Thirty patients (16 men, 14 women; mean age 52.2 ± 13.2 years) underwent coronary CTA at 100-kVp on a 256-slice CT. Paired image sets were created using 3 types of reconstruction, i.e. filtered back projection (FBP), a hybrid type of iterative reconstruction (H-IR), and M-IR. Quantitative parameters including CT-attenuation, image noise, and contrast-to-noise ratio (CNR) were measured. The visual image quality, i.e. graininess, beam-hardening, vessel sharpness, and overall image quality, was scored on a 5-point scale. Lastly, coronary artery segments were evaluated using a 4-point scale to investigate the assessability of each segment. There was no significant difference in coronary arterial CT attenuation among the 3 reconstruction methods. The mean image noise of FBP, H-IR, and M-IR images was 29.3 ± 9.6, 19.3 ± 6.9, and 12.9 ± 3.3 HU, respectively, there were significant differences for all comparison combinations among the 3 methods (p<0.01). The CNR of M-IR was significantly better than of FBP and H-IR images (13.5 ± 5.0 [FBP], 20.9 ± 8.9 [H-IR] and 39.3 ± 13.9 [M-IR]; p<0.01). The visual scores were significantly higher for M-IR than the other images (p<0.01), and 95.3% of the coronary segments imaged with M-IR were of assessable quality compared with 76.7% of FBP- and 86.9% of H-IR images. M-IR can provide significantly improved qualitative and quantitative image quality in prospectively gated coronary CTA using a low-tube-voltage. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  6. Improved coronary in-stent visualization using a combined high-resolution kernel and a hybrid iterative reconstruction technique at 256-slice cardiac CT-Pilot study.

    Science.gov (United States)

    Oda, Seitaro; Utsunomiya, Daisuke; Funama, Yoshinori; Takaoka, Hiroko; Katahira, Kazuhiro; Honda, Keiichi; Noda, Katsuo; Oshima, Shuichi; Yamashita, Yasuyuki

    2013-02-01

    To investigate the diagnostic performance of 256-slice cardiac CT for the evaluation of the in-stent lumen by using a hybrid iterative reconstruction (HIR) algorithm combined with a high-resolution kernel. This study included 28 patients with 28 stents who underwent cardiac CT. Three different reconstruction images were obtained with: (1) a standard filtered back projection (FBP) algorithm with a standard cardiac kernel (CB), (2) an FBP algorithm with a high-resolution cardiac kernel (CD), and (3) an HIR algorithm with the CD kernel. We measured image noise and kurtosis and used receiver operating characteristics analysis to evaluate observer performance in the detection of in-stent stenosis. Image noise with FBP plus the CD kernel (80.2 ± 15.5 HU) was significantly higher than with FBP plus the CB kernel (28.8 ± 4.6 HU) and HIR plus the CD kernel (36.1 ± 6.4 HU). There was no significant difference in the image noise between FBP plus the CB kernel and HIR plus the CD kernel. Kurtosis was significantly better with the CD- than the CB kernel. The kurtosis values obtained with the CD kernel were not significantly different between the FBP- and HIR reconstruction algorithms. The areas under the receiver operating characteristics curves with HIR plus the CD kernel were significantly higher than with FBP plus the CB- or the CD kernel. The difference between FBP plus the CB- or the CD kernel was not significant. The average sensitivity, specificity, and positive and negative predictive value for the detection of in-stent stenosis were 83.3, 50.0, 33.3, and 91.6% for FBP plus the CB kernel, 100, 29.6, 40.0, and 100% for FBP plus the CD kernel, and 100, 54.5, 40.0, and 100% for HIR plus the CD kernel. The HIR algorithm combined with the high-resolution kernel significantly improved diagnostic performance in the detection of in-stent stenosis. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  7. Improved coronary in-stent visualization using a combined high-resolution kernel and a hybrid iterative reconstruction technique at 256-slice cardiac CT—Pilot study

    Energy Technology Data Exchange (ETDEWEB)

    Oda, Seitaro, E-mail: seisei0430@nifty.com [Department of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Kumamoto 860-8556 (Japan); Utsunomiya, Daisuke, E-mail: utsunomi@kumamoto-u.ac.jp [Department of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Kumamoto 860-8556 (Japan); Funama, Yoshinori, E-mail: funama@kumamoto-u.ac.jp [Department of Medical Physics, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Kumamoto 860-8556 (Japan); Takaoka, Hiroko, E-mail: hiroko_takayoka@yahoo.co.jp [Department of Diagnostic Radiology, Kumamoto Chuo Hospital, 1-5-1 Tainoshima, Kumamoto 862-0965 (Japan); Katahira, Kazuhiro, E-mail: yy26kk@yahoo.co.jp [Department of Diagnostic Radiology, Kumamoto Chuo Hospital, 1-5-1 Tainoshima, Kumamoto 862-0965 (Japan); Honda, Keiichi, E-mail: k-book@osu.bbiq.jp [Department of Diagnostic Radiology, Kumamoto Chuo Hospital, 1-5-1 Tainoshima, Kumamoto 862-0965 (Japan); Noda, Katsuo, E-mail: k-noda@kumachu.gr.jp [Department of Cardiology, Kumamoto Chuo Hospital, 1-5-1 Tainoshima, Kumamoto 862-0965 (Japan); Oshima, Shuichi, E-mail: shuoshima@e-mail.jp [Department of Cardiology, Kumamoto Chuo Hospital, 1-5-1 Tainoshima, Kumamoto 862-0965 (Japan); Yamashita, Yasuyuki, E-mail: yama@kumamoto-u.ac.jp [Department of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Kumamoto 860-8556 (Japan)

    2013-02-15

    Objectives: To investigate the diagnostic performance of 256-slice cardiac CT for the evaluation of the in-stent lumen by using a hybrid iterative reconstruction (HIR) algorithm combined with a high-resolution kernel. Methods: This study included 28 patients with 28 stents who underwent cardiac CT. Three different reconstruction images were obtained with: (1) a standard filtered back projection (FBP) algorithm with a standard cardiac kernel (CB), (2) an FBP algorithm with a high-resolution cardiac kernel (CD), and (3) an HIR algorithm with the CD kernel. We measured image noise and kurtosis and used receiver operating characteristics analysis to evaluate observer performance in the detection of in-stent stenosis. Results: Image noise with FBP plus the CD kernel (80.2 ± 15.5 HU) was significantly higher than with FBP plus the CB kernel (28.8 ± 4.6 HU) and HIR plus the CD kernel (36.1 ± 6.4 HU). There was no significant difference in the image noise between FBP plus the CB kernel and HIR plus the CD kernel. Kurtosis was significantly better with the CD- than the CB kernel. The kurtosis values obtained with the CD kernel were not significantly different between the FBP- and HIR reconstruction algorithms. The areas under the receiver operating characteristics curves with HIR plus the CD kernel were significantly higher than with FBP plus the CB- or the CD kernel. The difference between FBP plus the CB- or the CD kernel was not significant. The average sensitivity, specificity, and positive and negative predictive value for the detection of in-stent stenosis were 83.3, 50.0, 33.3, and 91.6% for FBP plus the CB kernel, 100, 29.6, 40.0, and 100% for FBP plus the CD kernel, and 100, 54.5, 40.0, and 100% for HIR plus the CD kernel. Conclusions: The HIR algorithm combined with the high-resolution kernel significantly improved diagnostic performance in the detection of in-stent stenosis.

  8. Synthesis, radiolabeling and baboon SPECT imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl)tropane ([{sup 123}I]YP256) as a serotonin transporter radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Bois, Frederic; Baldwin, Ronald M.; Amici, Louis; Al-Tikriti, Mohammed S. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Kula, Nora; Baldessarini, Ross [Department of Psychiatry and Neuroscience Program, Harvard Medical School, Mailman Research Center McLean Division of Massachusetts General Hospital, Belmont, MA 02478 (United States); Innis, Robert B.; Staley, Julie K. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Tamagnan, Gilles D. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Institute for Neurodegenerative Disorders, New Haven, CT 06510 (United States)], E-mail: gtamagnan@indd.org

    2008-01-15

    To develop a potential SPECT probe to evaluate the integrity of the serotoninergic system (5-HTT) whose dysfunction is linked to several disease conditions such as Parkinson's disease, Alzheimer's disease and depression, we report the synthesis, radiolabeling and in vivo baboon imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl) tropane (YP256, ). The radiolabeling was performed by iododestannylation using sodium [{sup 123}I]iodide and peracetic acid. Although the ligand displayed high selectivity for 5-HTT over dopamine transporter in vitro, SPECT imaging in baboons did not reveal selective 5-HTT accumulation in brain in vivo.

  9. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256’s Spread, and Evolution of Russia ST8-IV

    Science.gov (United States)

    Wan, Tsai-Wen; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V.; Singur, Olga A.; Gostev, Vladimir V.; Sidorenko, Sergey V.; Peryanova, Olga V.; Salmina, Alla B.; Reva, Galina V.; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256’s strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages. PMID:27741255

  10. The effect of head size/shape, miscentering, and bowtie filter on peak patient tissue doses from modern brain perfusion 256-slice CT: How can we minimize the risk for deterministic effects?

    Energy Technology Data Exchange (ETDEWEB)

    Perisinakis, Kostas; Seimenis, Ioannis; Tzedakis, Antonis; Papadakis, Antonios E.; Damilakis, John [Department of Medical Physics, Faculty of Medicine, University of Crete, P.O. Box 2208, Heraklion 71003, Crete (Greece); Medical Diagnostic Center ' Ayios Therissos,' P.O. Box 28405, Nicosia 2033, Cyprus and Department of Medical Physics, Medical School, Democritus University of Thrace, Panepistimioupolis, Dragana 68100, Alexandroupolis (Greece); Department of Medical Physics, University Hospital of Heraklion, P.O. Box 1352, Heraklion 71110, Crete (Greece); Department of Medical Physics, Faculty of Medicine, University of Crete, P.O. Box 2208, Heraklion 71003, Crete (Greece)

    2013-01-15

    Purpose: To determine patient-specific absorbed peak doses to skin, eye lens, brain parenchyma, and cranial red bone marrow (RBM) of adult individuals subjected to low-dose brain perfusion CT studies on a 256-slice CT scanner, and investigate the effect of patient head size/shape, head position during the examination and bowtie filter used on peak tissue doses. Methods: The peak doses to eye lens, skin, brain, and RBM were measured in 106 individual-specific adult head phantoms subjected to the standard low-dose brain perfusion CT on a 256-slice CT scanner using a novel Monte Carlo simulation software dedicated for patient CT dosimetry. Peak tissue doses were compared to corresponding thresholds for induction of cataract, erythema, cerebrovascular disease, and depression of hematopoiesis, respectively. The effects of patient head size/shape, head position during acquisition and bowtie filter used on resulting peak patient tissue doses were investigated. The effect of eye-lens position in the scanned head region was also investigated. The effect of miscentering and use of narrow bowtie filter on image quality was assessed. Results: The mean peak doses to eye lens, skin, brain, and RBM were found to be 124, 120, 95, and 163 mGy, respectively. The effect of patient head size and shape on peak tissue doses was found to be minimal since maximum differences were less than 7%. Patient head miscentering and bowtie filter selection were found to have a considerable effect on peak tissue doses. The peak eye-lens dose saving achieved by elevating head by 4 cm with respect to isocenter and using a narrow wedge filter was found to approach 50%. When the eye lies outside of the primarily irradiated head region, the dose to eye lens was found to drop to less than 20% of the corresponding dose measured when the eye lens was located in the middle of the x-ray beam. Positioning head phantom off-isocenter by 4 cm and employing a narrow wedge filter results in a moderate reduction of

  11. Low contrast- and low radiation dose protocol for cardiac CT of thin adults at 256-row CT: usefulness of low tube voltage scans and the hybrid iterative reconstruction algorithm.

    Science.gov (United States)

    Nakaura, Takeshi; Kidoh, Masafumi; Sakaino, Naritsugu; Utsunomiya, Daisuke; Oda, Seitaro; Kawahara, Tetsuya; Harada, Kazunori; Yamashita, Yasuyuki

    2013-04-01

    To evaluate the effect on image quality of a low contrast and radiation dose protocol for cardiac computed tomography (CT) using a low tube voltage, the hybrid-iterative reconstruction algorithm, and a 256-row CT scanner. Before clinical study, we performed phantom experiments to evaluate the hybrid iterative reconstruction technique. We randomly assigned 68 patients undergoing cardiac CT to one of two protocols; 33 were scanned with our conventional 120 kVp protocol, the contrast material (370 mgI/kg body weight) was delivered over 15 s. The other 35 patients underwent scanning at a tube voltage of 80 kVp; the contrast dose, reduced by 50 % (185 mgI/kg), was delivered at the same fractional dose (24.7 mgI/kg/s). The 80 kVp images were post-processed with the 60 % hybrid-iterative reconstruction technique. We evaluated the effective dose (ED), image noise, mean attenuation, and contrast-to-noise ratio (CNR) of each protocol. The hybrid-iterative reconstruction technique offers almost same spatial resolution and noise-power-spectrum curve as compared with filtered back projection reconstruction. There were no decrease in spatial resolution and no shift of spatial frequency in noise power spectrum. The average ED was 74 % lower with the 80- than the 120 kVp protocol (1.4 vs 5.4 mSv). Dunnett's test showed that there were no significant differences in the image noise, mean attenuation, and CNR between hybrid-iterative-reconstructed 80 kVp scans and 120 kVp scans (28.6 ± 6.5 vs 25.3 ± 4.5, p = 0.18; 475.0 HU ± 87.0 vs 445.3 HU ± 67.7, p = 0.20; 17.1 HU ± 3.5 vs 17.8 HU ± 3.1, p = 0.53). The low kVp scan and hybrid-iterative reconstruction algorithm can dramatically decrease the radiation dose and contrast dose with adequate image quality at cardiac CT of thin adults using a 256-row CT scanner.

  12. Action of tacrolimus on Wistar rat kidneys implanted with Walker 256 carcinosarcoma Estudo da ação do tacrolimus em rins de ratos Wistar implantados com carcinossarcoma de Walker

    Directory of Open Access Journals (Sweden)

    Cristiano Machado Inácio

    2010-02-01

    Full Text Available PURPOSE: To evaluate the development of Walker 256 tumor in male Wistar rats treated with tacrolimus using an experimental kidney tumor model. METHODS: 40 male Wistar rats were divided into four groups: Tumor group (TU (n=10, Tacrolimus-Tumor group (TT (n=10, Tacrolimus group (TC (n=10 and Control group (C (n=10. Treatment with tacrolimus was performed in groups TT and TC. Under anesthesia, the right kidney of each animal of TU and TT was accessed through a supraumbilical incision and inoculated with a 0.1mL solution containing 2x10(6 tumor cells (Walker 256 carcinosarcoma tumor cells. Group TC was treated with a saline solution. All the animals of groups TC and TT were treated with tacrolimus (5mg/kg/day by gavage for 15 days. TU group animals received saline by gavage for 15 days. On the 15th postoperative day, all animals were submitted to euthanasia and blood sampling for analysis of serum creatinine (Cr and blood urea nitrogen (BUN. Abdominal gross examination was performed, the right kidney removed and prepared for histological analysis by hematoxylin-eosin staining. The resulting data were submitted to statistical analysis by ANOVA. RESULTS: Statistical significance was found when comparing creatinine level between groups TU, TT and TC -TT group culminated with a marked increased in creatinine levels (Cr=1.013 ± 0.3028 mg/mL, TU group (Cr=0.5670 ± 0.03536 mg/dL P=0.00256, TC group (Cr =0.711 ± 0.1653 mg/mL P= 0.02832. Statistical significance was found when comparing BUN levels in TT group (71.32 ± 17.14 mg/mL, compared with TU group (45.83 ± 5.046 mg/dL, P=0.000318. There were no statistically significant differences between groups TT and TC (61.23 ± 9.503 mg/mL P=0.7242. Histological analysis showed a poor evolution in TT group with multiple foci of hemorrhage and cortical invasion by the Walker tumor. CONCLUSION: The Tacrolimus-treated group developed a more aggressive tumor and a drug-related nephrotoxic effect.OBJETIVO: Avaliar

  13. 24 CFR 983.256 - Lease.

    Science.gov (United States)

    2010-04-01

    ... the tenant. (2) If the owner uses a standard lease form for rental to unassisted tenants in the...) of this section. If the owner does not use a standard lease form for rental to unassisted tenants...) The amount of any charges for food, furniture, or supportive services. (d) Tenancy addendum. (1) The...

  14. 40 CFR 256.50 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... developed under the Clean Air Act (42 U.S.C. 7401 et seq.; incineration and open burning limitations; and... pesticide containers). (3) The Marine Protection, Research and Sanctuaries Act (33 U.S.C. 1420 et seq... sludge in reclamation), (iii) U.S. Geological Survey (wetlands, floodplains, ground water); (2...

  15. 76 FR 256 - Informed Consent Elements

    Science.gov (United States)

    2011-01-04

    ... designed to promote transparency of clinical research to participants and patients. DATES: Effective date... 20993-0002, 301- 796-4830. SUPPLEMENTARY INFORMATION: Table of Contents I. Introduction II. Overview of.... References I. Introduction In the Federal Register of December 29, 2009 (74 FR 68750), FDA issued a notice of...

  16. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This brief summarizes lessons from the CCAA learning forum on improving access to and use of seasonal forecasts in Africa, which took place in Nairobi, Kenya in March 2010. CCAA Learning Paper 1 Integrating meteorological and indigenous knowledge-based seasonal climate forecasts for the agricultural sector.

  17. Reference: 256 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available in parallel with POL. We observe a strong dosage sensitivity at the meristem for ...nt analysis. POL and related phosphatases are dosage-sensitive regulators of meristem and organ development

  18. 17 CFR 256.01-8 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... time to time. (p) Work order system means a system for the accumulation of service company cost on a.... (e) Direct cost shall include labor cost and expenses which can be identified through a work order... companies. Cost incidental to or related to a directly charged item shall be classified as direct costs. (f...

  19. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... ground into paste. The paste is then mashed with warm water and oil rises to the surface and is skimmed off. ... fuel for diesel engines (Duke, 1981). The groundnut cake (GNC) known as. 'Kulikuli' in Hausa ... that these age groups are the most active or energetic which, is required for the tedious nature of ...

  20. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... Globalization, the information age, and the rise of the knowledge-based economy are significantly transforming the way we acquire, disseminate, and transform knowledge. And ...

  1. 30 CFR 256.5 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... States, and includes islands, transition and intertidal areas, salt marshes, wetlands, and beaches, which..., the contiguous zone, transitional and intertidal areas, salt marshes, and wetlands within the coastal... the Central Gulf of Mexico Planning Area of the Outer Continental Shelf, as designated in the document...

  2. 25 CFR 256.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... companion to aid in basic needs, such as dressing, preparing food, etc.; or severe heart and/or respiratory... household and who function as members of a family. Independent trades person means any person possessing the...

  3. 32 CFR 256.3 - Criteria.

    Science.gov (United States)

    2010-07-01

    ... height standards defined in AFM 86-8, 1 NavFac P-272 and P-80, 1 and TM 5-803-4 1 will be used for... Assistant Secretary of Defense (Installations and Logistics)—ID, Washington, DC 20301. (c) Accident... for the purpose of defining accident potential areas. Class A runways are those restricted to light...

  4. 15 CFR 256.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... Program at the National Institute of Standards & Technology. In the exercise of its functions as a major... facilities available to persons other than Bureau employees to work with scientists and engineers in...

  5. BDML Metadata: 256 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available C BY-NC-SA 0.150 dd417ead-6cde-4952-8f16-a377db1adb9b 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_Y47D3A.d_040930_02/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_Y47D3A.d_040930_02.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce..._KK_P002.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/dd417ead-6cde-4952-8f16-a377db1adb9b/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-208 ...

  6. 49 CFR 256.7 - Financial assistance.

    Science.gov (United States)

    2010-10-01

    ..., and (D) parking and access for automobiles and bicycles; and (iv) Provisions for accommodating major... architectural and engineering design documents for the project, including: (i) Plans, sections, and sketches...

  7. 30 CFR 256.7 - Cross references.

    Science.gov (United States)

    2010-07-01

    ... Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Outer Continental Shelf Oil, Gas, and Sulphur Management, General... multiple use conflicts, see the Environmental Protection Agency listing of ocean dumping sites—40 CFR part...

  8. Explorations of Parole Policy. Report No. 256.

    Science.gov (United States)

    Daiger, Denise C.; And Others

    Due to the controversy over the institution of parole and recent changes in the criminal justice and penal system of Maryland, statistical models mirroring current parole practice were developed. These are described in this document in an effort to stimulate discussion leading to an explicit and equitable parole policy. Such variables as offense…

  9. Diagnostic accuracy of 256-row multidetector CT coronary angiography with prospective ECG-gating combined with fourth-generation iterative reconstruction algorithm in the assessment of coronary artery bypass: evaluation of dose reduction and image quality.

    Science.gov (United States)

    Ippolito, Davide; Fior, Davide; Franzesi, Cammillo Talei; Riva, Luca; Casiraghi, Alessandra; Sironi, Sandro

    2017-08-28

    Effective radiation dose in coronary CT angiography (CTCA) for coronary artery bypass graft (CABG) evaluation is remarkably high because of long scan lengths. Prospective electrocardiographic gating with iterative reconstruction can reduce effective radiation dose. To evaluate the diagnostic performance of low-kV CT angiography protocol with prospective ecg-gating technique and iterative reconstruction (IR) algorithm in follow-up of CABG patients compared with standard retrospective protocol. Seventy-four non-obese patients with known coronary disease treated with artery bypass grafting were prospectively enrolled. All the patients underwent 256 MDCT (Brilliance iCT, Philips) CTCA using low-dose protocol (100 kV; 800 mAs; rotation time: 0.275 s) combined with prospective ECG-triggering acquisition and fourth-generation IR technique (iDose(4); Philips); all the lengths of the bypass graft were included in the evaluation. A control group of 42 similar patients was evaluated with a standard retrospective ECG-gated CTCA (100 kV; 800 mAs).On both CT examinations, ROIs were placed to calculate standard deviation of pixel values and intra-vessel density. Diagnostic quality was also evaluated using a 4-point quality scale. Despite the statistically significant reduction of radiation dose evaluated with DLP (study group mean DLP: 274 mGy cm; control group mean DLP: 1224 mGy cm; P value evaluated by two radiologists in "double blind", did not reveal any significant difference in diagnostic quality of the two groups. The development of high-speed MDCT scans combined with modern IR allows an accurate evaluation of CABG with prospective ECG-gating protocols in a single breath hold, obtaining a significant reduction in radiation dose.

  10. A workflow for multiclass determination of 256 pesticides in essential oils by liquid chromatography tandem mass spectrometry using evaporation and dilution approaches: Application to lavandin, lemon and cypress essential oils.

    Science.gov (United States)

    Fillatre, Yoann; Rondeau, David; Daguin, Antoine; Communal, Pierre-Yves

    2016-01-01

    This paper describes the determination of 256 multiclass pesticides in cypress and lemon essential oils (EOs) by the way of liquid chromatography-electrospray ionization tandem mass spectrometry (LC-ESI/MS/MS) analysis using the scheduled selected reaction monitoring mode (sSRM) available on a hybrid quadrupole linear ion trap (QLIT) mass spectrometer. The performance of a sample preparation of lemon and cypress EOs based on dilution or evaporation under nitrogen assisted by a controlled heating were assessed. The best limits of quantification (LOQs) were achieved with the evaporation under nitrogen method giving LOQs≤10µgL(-1) for 91% of the pesticides. In addition the very satisfactory results obtained for recovery, repeatability and linearity showed that for EOs of relatively low evaporation temperature, a sample preparation based on evaporation under nitrogen is well adapted and preferable to dilution. By compiling these results with those previously published by some of us on lavandin EO, we proposed a workflow dedicated to multiresidue determination of pesticides in various EOs by LC-ESI/sSRM. Among the steps involved in this workflow, the protocol related to mass spectrometry proposes an alternative confirmation method to the classical SRM ratio criteria based on a sSRM survey scan followed by an information-dependent acquisition using the sensitive enhanced product ion (EPI) scan to generate MS/MS spectra then compared to a reference. The submitted workflow was applied to the case of lemon EOs samples highlighting for the first time the simultaneous detection of 20 multiclass pesticides in one EO. Some pesticides showed very high concentration levels with amounts greatly exceeding the mgL(-1). Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Valley Oakes/Cincinnati Electronics 256 X 256 InSb array evaluation

    Science.gov (United States)

    Heynssens, Julie B.; Fowler, Albert M.

    1993-10-01

    This array was developed for use in future NASA space infrared instrumentation and was funded by Craig McCreight at NASA Ames Research Center. The multiplexer was designed at Valley Oakes Semiconductor and fabricated using TRW's radiation hard 1.2 micron CMOS process as a baseline. Several processing variants were explored as this effort was directed toward the development of a low temperature (photovoltaic InSb mesa diodes. Much of this paper presents an evaluation of the bare multiplexer to determine the optimal operating point of the hybrid array. At 10 K, the detector reset node must be operated at a minimum of 2.2 V with respect to the reset on control signal (multiplexer ground) to overcome the threshold drop of the PMOS reset transistor. A linear regression of the multiplexer response at 10 K indicates that for linear gain response the reset voltage must be between 2.4 to 2.8 V. The standard deviation of the pedestal values gives an indication of multiplexer uniformity and is 32.0 mV. Charge pumping through the reset transistor adds bias to the detector. Within the operating range of the multiplexer, this charge pumping was measured to be 70 to 100 mV. The multiplexer operates continuously from 77 to 10 K with no anomalies due to threshold crossover in the CMOS gates.

  12. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  13. 30 CFR 256.77 - Cancellation of leases.

    Science.gov (United States)

    2010-07-01

    ... life, property, any mineral, national security or defense, or to the marine, coastal or human environment; (2) The threat of harm or damage will not disappear or decrease to an acceptable extent within a...

  14. 40 CFR 98.256 - Data reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... cracking units, traditional fluid coking units, and catalytic reforming units, owners and operators shall report: (1) The unit ID number (if applicable). (2) A description of the type of unit (fluid catalytic cracking unit, thermal catalytic cracking unit, traditional fluid coking unit, or catalytic reforming unit...

  15. All projects related to | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SMOKING, TOBACCO, TAXATION. Region: North of Sahara, South of Sahara. Program: Food, Environment, and Health. Total Funding: CA$ 476,150.00. Taxation of Tobacco Products in West Africa. Project. In December 2007, Research for International Tobacco Control (RITC) undertook an initiative to understand ...

  16. 24 CFR 207.256a - Reinstatement of defaulted mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Reinstatement of defaulted mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of...

  17. 24 CFR 207.256b - Modification of mortgage terms.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Modification of mortgage terms. 207... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of...

  18. Dicty_cDB: SSE256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available adsnkdnkitwdearqffv tsgsneaqakvfansmfedvdsdddkcitreelreyaieyyeiypte*lfp*k*SQFKSV LKK--- ---FXKKKKKKK...adsnkdnkitwdearqffv tsgsneaqakvfansmfedvdsdddkcitreelreyaieyyeiypte*lfp*k*SQFKSV LKK--- ---xkkkkkkkk

  19. (256-IJBCS-Article-H Yédomonhan)

    African Journals Online (AJOL)

    RHUMSIKI

    l'utilisation de pièges à abeilles qui sont des ruches construites en matériaux locaux (troncs d'arbre évidés, paille, .... questions ou pistes d'interrogations émergent tout au long de l'entretien (Tamboura et al.,. 1998). Les différentes ..... la Gestion Forestière Durable. Flamboyant; 56. Anonyme 2003. Troisième Recensement.

  20. 256 Preservation and Conservation of Yoruba Cultural Artifacts: The ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... presented, interpreted, accepted or rejected by different authors. However, he posited that the most ... organized and interpreted to meet broad and varying needs of people for information, knowledge, recreation and ... Library in Copenhagen (Ajibero, 1993). Although, there may be other versions to the ...

  1. Dicty_cDB: SSB256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available apping in prelim test: 218 Number of HSP's gapped (non-prelim): 0 length of query: 172 length of database: 80,480,566 effective... HSP length: 17 effective length of query: 155 effective lengt...h of database: 78,821,179 effective search space: 12217282745 effective search space used: 12217282745 T: 0 ...: 0 length of query: 172 length of database: P,143,474,805 effective HSP length: 22 effective length of query: 150 effective... length of database: O,601,657,991 effective search space: 4740248698650 effective

  2. General Criteria for Waterfront Construction. Design Manual 25.6.

    Science.gov (United States)

    1981-07-01

    Provide minimum 3/8 inches clear between planks. (c) Preferably attach pianks to stringers or nailers with drive screws. Where nailed, use minimum 20 penny...Protective coating. 25.6-20 a (6) Abrasion conditions (surf zone vs. deep water). (7) Stray electric currents. (8) Type of soil. b. Rate of Corrosion...Maintenance Cost. Consider cost of electricity , replacement of anodes, and general repair of damage to wires and hangers in the economic analysis. 25.6-21 I

  3. 17 CFR 256.308 - Office furniture and equipment.

    Science.gov (United States)

    2010-04-01

    ... company and used in rendering services, e.g., bookcases, shelves, desks, tables, chairs, desk equipment, safes, drafting-room equipment, filing cabinets, storage and other cabinets, floor covering, library...

  4. Dicty_cDB: CFD256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence LIKLFLSFNIYISLEKKKKKKKKKKKKXGXFFXXKK--- ---LFGILDYHVLSQLMALVINLVYLPLGVGWVVWRGKNDIHKDLVFD...kkkkkkkkkkkkxgxffxxk--- ---LFGILDYHVLSQLMALVINLVYLPLGVGWVVWRGKNDIHKDLVFDVNYLGGNMPTFS LNFSRPGGQIVCQYYNFLRHGRS

  5. 38 CFR 21.256 - Incentives for employers.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C... months, unless the VR&E Officer, approves a longer period. (e) Benefits and services. (1) An eligible...

  6. 43 CFR 2.56 - Disclosure of records.

    Science.gov (United States)

    2010-10-01

    ... criminal law enforcement activity if the activity is authorized by law, and if the head of the agency or... section does not apply where disclosure of the record would be: (1) For a routine use as defined in § 2.46... of the Census for purposes of planning or carrying out a census or survey or related activity...

  7. 17 CFR 256.152 - Fuel stock expenses undistributed.

    Science.gov (United States)

    2010-04-01

    ... undistributed. The service company shall utilize this account, where appropriate, to include the cost of service..., analysis and management of fuel supply contracts or agreements, the accumulation of fuel information and its interpretation, the logistics and handling of fuel, and other related support functions, as a...

  8. Dicty_cDB: SHA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA. 244 1e-70 3 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides...CTOR 2 ;, mRNA sequence. 66 4e-18 4 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloides trichosuri FL pAMP1 v1...;, mRNA sequence. 66 9e-15 3 BI451383 |BI451383.1 kx23e09.y1 Parastrongyloides tr...ichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to SW:EF2_CAEEL P29691 ... Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to SW:EF2_CHICK Q90705 ELONGATION FACTOR 2

  9. 40 CFR 421.256 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ....024 Silver 0.116 0.048 Zinc 0.408 0.168 Gold 0.040 (c) Electrolytic cells wet air pollution control... for any 1 day Maximum for monthly average mg/troy ounce of gold refined electrolytically Lead 5.544 2... Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0.364 0.169 Mercury 0.195 0.078...

  10. Dicty_cDB: SSK256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LIKSTKKKIMVINRKVVKIVKLLITLKNIEIIWLQLK VYSRPKYQKRISSNYNKIIIIR Translated Amino Acid sequence (All Frames)...LIKSTKKKIMVINRKVVKIVKLLITLKNIEIIWLQLK VYSRPKYQKRISSNYNKIIIIR Homology vs CSM-cDNA Score E Sequences producing

  11. Dicty_cDB: SLA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oducing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis o...f longfatty acids in plants. 1479 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesis of long ...chain polyunsaturated fatty acids. 1479 0.0 1 BD082630 |BD082630.1 Methods and composition

  12. 28 CFR 25.6 - Accessing records in the system.

    Science.gov (United States)

    2010-07-01

    ... a civil or criminal law enforcement activity relating to the Gun Control Act (18 U.S.C. Chapter 44... Federal or state law. A “Delayed” response to the FFL indicates that the firearm transfer should not... transferee would violate 18 U.S.C. 922 or state law. The “Denied” response will be provided to the requesting...

  13. Dicty_cDB: VHO256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2002.10.25 Translated Amino Acid sequence *KMIYTDAGVDEDKATIRPNQTHQFQKVQDEAKEWTKNKFLEFLNNFKLKKKIDKNNNNN...ETKITKMVINKMINKDNSLVVLVPNQYPIIEYY*hpnysxink Translated Amino Acid sequence (All Frames) Frame A: *KMIYTDAG...hwlvyi*iqkfyqnm*mklqdy*rnq*fmlkqmm*f*vmmmmi*skmlkmititmlkkmv mmvlan*l*ifqnihnyqny*fyklnnqekrnlv*nkli...klikiiiii imkimkiimkmkmnmtkmvlkkrk*ikviivnklke**kminqvyi*isyixrnlikv*e khy*wnil--- ---klykvykihlsnhs...IKQSGKEKSGIKQIDLIDWYIKDQLESGIITDDEVTK ETKITKMVINKMINKDNSLVVLVPNQYPIIEYY*hpnysxink Homology vs CSM-cDNA

  14. Dicty_cDB: CFC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of longfatty acids...acids in plants. 1306 0.0 1 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated...polyunsaturated fatty acids. 1306 0.0 1 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated

  15. Dicty_cDB: AFL256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KGKNHLIKKEINKVETDQL THQYTLVISPDNTYKVLVD--- ---DDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPEDW...KGKNHLIKKEINKVETDQL THQYTLVISPDNTYKVLVD--- ---DDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPEDW

  16. 40 CFR 256.22 - Recommendations for State regulatory powers.

    Science.gov (United States)

    2010-07-01

    ... effects. Based on this evaluation, instrumentation, sampling, monitoring, and inspection requirements... specify design and operational standards. (3) Should take into account the climatic, geologic, and other... specify, for the facility operator, the location, design, construction, operational, monitoring, reporting...

  17. Short communication: The effect of ultrasound at 256 KHz on ...

    African Journals Online (AJOL)

    The effect of ultrasound on the growth of M. aeruginosa confirmed to contain gas vacuoles and on a laboratory culture with no gas vacuoles was investigated. Both cultures were treated continuously for 9 d with an ultrasonic flow device. To evaluate the influence of ultrasound during the treatment, the chlorophyll-a ...

  18. 40 CFR 60.256 - Continuous monitoring requirements.

    Science.gov (United States)

    2010-07-01

    ... procedures; (iv) How the bag leak detection system will be maintained, including a routine maintenance schedule and spare parts inventory list; (v) How the bag leak detection system output will be recorded and...

  19. Dicty_cDB: SLH256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BT080943 |pid:none) Caligus clemensi clone ccle-evs-51... 73 3e-12 BT076915_1( BT076915 |pid:none) Caligus roger...cresseyi clone crog-e... 69 7e-11 BT077060_1( BT077060 |pid:none) Caligus rogercresseyi clone crog-e...

  20. Dicty_cDB: CFH256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence nk**NNSQVHIVVIIVINNNNKLKMATSLRELCKDRILNEMVRTITPEASNGWKALIVDQ DSLRVISACCGMFDIMEEKVTVVEKIDNPRQRLPNLE...C: nk**NNSQVHIVVIIVINNNNKLKMATSLRELCKDRILNEMVRTITPEASNGWKALIVDQ DSLRVISACCGMFDIMEEKVTVVEKIDNPRQRLPNLE

  1. Dicty_cDB: SHD256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hkkkii*n**rklxv*itntntyq*liiiiitiikiiiilxks*i*ikyniqi innn*likkk--- Frame C: ilqqlyrtkkk*yrinken*xfk*qiqihin...n******q**k***y*xnhkfklniifk* *iiin*lkk--- Homology vs CSM-cDNA Score E Sequences producing significant alig

  2. Dicty_cDB: VFO256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSEAARIFNIY PRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWS...FCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGKLTWCQFVRATSSEAARIFNIY PRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAVDFNIFEGIKVTGIAVTTIVAGNIVWS

  3. Long-Wavelength 256X256 GaAs/AIGaAs Quantum Well Infrared Photodetector (QWIP) Palm-Size Camera

    Science.gov (United States)

    Gunapala, S.; Bandara, S.; Liu, J.; Luong, E.; McKelvey, M.; Mumolo, J.; Rafol, S.; Shott, C.; Stetson, N.

    1999-01-01

    In this paper, we discuss the development of this very sensitive long-wavelength infrared (LWIR) camera based on a GaAs/AlGaAs QWIP focal plane array (FPA) and its performance in terms of quantum efficiency, NET, MRDT, uniformity, and operability.

  4. The effect of temperature and radiation on the cesium adsorption ability of IONSIV/256 IE-910 and IONSIV/256 IE-911

    Energy Technology Data Exchange (ETDEWEB)

    Martin, K.B.

    1999-12-08

    This study examined the ion exchange capacity of crystalline silicotitanate in a simulated waste solution. The focus areas included the effect of temperature and radiation on cesium sorption capacity. The cesium is expected to be removed from high-level radioactive wastes using these ion exchange materials.

  5. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  6. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  7. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  8. Nation-Building Unraveled?: Aid, Peace and Justice in Afghanistan. Bloomfield, Kumarian Press, 2005, 256 p.

    OpenAIRE

    Van Engeland, Anicée

    2007-01-01

    Écrit par des acteurs humanitaires de terrain, ce livre décrit avec justesse les enjeux humains qui se jouent en Afghanistan depuis le début de la guerre. En effet, la guerre en Afghanistan a des conséquences importantes sur la notion d’intervention humanitaire, d’établissement d’un état de droit, de réforme d’un système juridique, de l’éducation aux droits de l’homme et de reconstruction. Sont aussi passés aux cribles le rôle des organisations internationales et le rôle des organisations loc...

  9. 256. ¿Debemos respetar el anillo pulmonar pequeño al corregir el fallot?

    OpenAIRE

    Fernández, L.; Vázquez, L.; Cárdenas, I.; Marcos, S.; Bautista-Hernández, V.; Portela, F.

    2012-01-01

    Estudiamos nuestra forma de corrección en los últimos 5 años para conocer el impacto de respetar el anillo pulmonar sobre la incidencia de reoperación y el desarrollo de insuficiencia pulmonar. Material y métodos: Treinta y seis niños corregidos empleando cuatro grupos de técnicas según se respete o no el anillo pulmonar, y el abordaje de la comunicación interventricular (CIV): a) CIV por aurícula + anillo intacto (6p); b) CIV por infundíbulo + anillo intacto (17p); c) CIV por aurícula y m...

  10. Performance analysis of commercial MOSFET packages in Class E converter operating at 2.56 MHz

    DEFF Research Database (Denmark)

    Nair, Unnikrishnan Raveendran; Munk-Nielsen, Stig; Jørgensen, Asger Bjørn

    2017-01-01

    Wide bandgap (WBG) power electronic devices realized using silicon carbide(SiC) and gallium nitride (GaN) are increasingly replacing their silicon(Si) counterparts in power electronics applications. The obvious advantages of these devices with their higher switching speeds, lower on state resista...

  11. 32 CFR 256.8 - Land use compatibility guidelines for accident potential.

    Science.gov (United States)

    2010-07-01

    .... Rubber and miscellaneous plastic goods ......do ......do Do. Stone, clay, and glass products ......do Yes... 4170.7, “Natural Resources—Forest Management,” June 21, 1965 (32 CFR 233) and DoD Instruction 7310.1...

  12. Generación de cuadrados latinos de orden 256 utilizando un grafo de reemplazos

    OpenAIRE

    Gallego Sagastume, Ignacio

    2015-01-01

    Los cuadrados Latinos (LSs) son estructuras algebraicas con aplicaciones en criptografía. Si los LSs son aleatorios y uniformemente distribuidos, pueden ser usados como claves para algoritmos de encriptación simétricos. En el contexto de un protocolo de comunicación seguro, debe generarse un nuevo LS cada cierta cantidad de tiempo o cantidad de datos transmitida para no correr el riesgo de que un atacante lo deduzca y pueda así descifrar los mensajes transmitidos. El tiempo y recursos requeri...

  13. 2-(5,6-Diphenyl-1,2,4-triazin-3-ylaniline

    Directory of Open Access Journals (Sweden)

    Mariusz Mojzych

    2012-12-01

    Full Text Available The title compound, C21H16N4, obtained under standard Suzuki cross-coupling conditions, is a model compound in the synthesis and biological activity evaluation of new aza-analogues of sildenafil containing a pyrazolo[4,3-e][1,2,4]triazine system. An N—H...N intramolecular hydrogen bond involving the aminobenzene system and the 1,2,4-triazine moiety helps to establish a near coplanar orientation of the rings with a dihedral angle of 12.04 (4°, which is believed to be necessary for the biological activity of sildenafil analogues. The 1,2,4-triazine ring is slightly distorted from planarity [r.m.s deviation = 0.0299 (11 Å] and forms dihedral angles of 58.60 (4 and 36.35 (3° with the pendant phenyl rings. The crystal packing features bifurcated N—H...(N,N hydrogen bonds linking screw-axis-related molecules into chains parallel to the [010] direction< and π–π interactions, with a centroid–centroid separation of 3.8722 (7 Å and a slippage of 1.412 (3 Å. The crystal studied was a nonmerohedral twin with a ratio of 0.707 (2:0293 (2.

  14. Constellation Shaping for WDM systems using 256QAM/1024QAM with Probabilistic Optimization

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2016-01-01

    In this paper, probabilistic shaping is numerically and experimentallyinvestigated for increasing the transmission reach of wavelength divisionmultiplexed (WDM) optical communication system employing quadrature amplitudemodulation (QAM). An optimized probability mass function (PMF) of the QAMsymb...

  15. 40 CFR 256.01 - Purpose and scope of the guidelines.

    Science.gov (United States)

    2010-07-01

    ... as may be necessary to implement the plan. (5) The plan shall provide that no local government within... identify, in accordance with section 4006(b), (i) the responsibilities of State, local, and regional... 4005(c), prohibit the establishment of new open dumps within the State, and contain requirements that...

  16. : tous les projets | Page 256 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2011. End Date: 1 septembre 2013. Sujet: WOMEN'S RIGHTS, CIVIL RIGHTS, WOMEN'S PARTICIPATION, POLITICAL PARTICIPATION, GENDER EQUALITY. Région: Sudan, North of Sahara, South of Sahara. Programme: Gouvernance et justice. Financement total : CA$ 147,900.00. Participation ...

  17. Experimental Study of Nonlinear Phase Noise and its Impact on WDM Systems with DP-256QAM

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Da Ros, Francesco; Porto da Silva, Edson

    2016-01-01

    A probabilistic method for mitigating the phase noise component of the non-linear interference in WDM systems with Raman amplification is experimentally demonstrated. The achieved gains increase with distance and are comparable to the gains of single-channel digital back-propagation....

  18. Towards Primary School Physics Teaching and Learning: Design Research Approach. Research Report 256

    Science.gov (United States)

    Juuti, Kalle

    2005-01-01

    This thesis describes a project to design a primary school physics learning environment which takes into account teachers' needs, design procedures, properties of the learning environment, and pupil learning outcomes. The project's design team has wide experience in research and development work in relation to science education, the use of ICT in…

  19. Yeast Interacting Proteins Database: YDR256C, YGL153W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available central component of the peroxisomal protein import machinery; interacts with both PTS1 (Pex5p) and PTS2...central component of the peroxisomal protein import machinery; interacts with both PTS1 (Pex5p) and PTS2

  20. 40 CFR 256.31 - Recommendations for developing and implementing resource conservation and recovery programs.

    Science.gov (United States)

    2010-07-01

    .... (2) Available and potential markets for recovered materials and energy should be identified... should be conducted in regions of the State in which uses or markets for recovered materials or energy... encourage State procurement of products containing recovered materials in accord with section 6002 of the...

  1. Performance analysis of commercial MOSFET packages in Class E converter operating at 2.56 MHz

    DEFF Research Database (Denmark)

    Nair, Unnikrishnan Raveendran; Munk-Nielsen, Stig; Jørgensen, Asger Bjørn

    2017-01-01

    Wide bandgap (WBG) power electronic devices realized using silicon carbide(SiC) and gallium nitride (GaN) are increasingly replacing their silicon(Si) counterparts in power electronics applications. The obvious advantages of these devices with their higher switching speeds, lower on state...

  2. 24 CFR 25.6 - Violations creating grounds for administrative action.

    Science.gov (United States)

    2010-04-01

    ... the applicable net worth, liquidity or warehouse line of credit requirements of 24 CFR part 202 pertaining to net worth, liquid assets, and warehouse line of credit or other acceptable funding plan; (i... to justify an administrative sanction. (Approved by the Office of Management and Budget under Control...

  3. John Plunkett, Queen Victoria, First Media Monarch, Oxford, Oxford University Press, 2003, 256 p.

    OpenAIRE

    Chassaigne, Philippe

    2005-01-01

    Cet ouvrage, tiré de la thèse de doctorat soutenue par John Plunkett, Junior Research Fellow (allocataire de recherche) en anglais à l’université d’Exeter, aborde la question de la mise en image(s) de la monarchie britannique, partant du principe que les media sont « l’un des principaux moyens par lesquels [elle] maintient sa traditionnelle prééminence » (p. 1). L’un des éléments très positifs de son livre est d’étudier un segment chronologique souvent délaissé, à savoir, la première partie d...

  4. Constellation Shaping for WDM systems using 256QAM/1024QAM with Probabilistic Optimization

    CERN Document Server

    Yankov, Metodi P; da Silva, Edson P; Forchhammer, Søren; Larsen, Knud J; Oxenløwe, Leif K; Galili, Michael; Zibar, Darko

    2016-01-01

    In this paper, probabilistic shaping is numerically and experimentally investigated for increasing the transmission reach of wavelength division multiplexed (WDM) optical communication system employing quadrature amplitude modulation (QAM). An optimized probability mass function (PMF) of the QAM symbols is first found from a modified Blahut-Arimoto algorithm for the optical channel. A turbo coded bit interleaved coded modulation system is then applied, which relies on many-to-one labeling to achieve the desired PMF, thereby achieving shaping gain. Pilot symbols at rate at most 2% are used for synchronization and equalization, making it possible to receive input constellations as large as 1024QAM. The system is evaluated experimentally on a 10 GBaud, 5 channels WDM setup. The maximum system reach is increased w.r.t. standard 1024QAM by 20% at input data rate of 4.65 bits/symbol and up to 75% at 5.46 bits/symbol. It is shown that rate adaptation does not require changing of the modulation format. The performanc...

  5. 32 CFR 256.5 - The air installation compatible use program.

    Science.gov (United States)

    2010-07-01

    ...: (1) Determination by detailed study of flight operations, actual noise and safety surveys if... established under OMB Circular A-95; (2) Ensure that appropriate environmental factors are considered; and (3... matters which will promote and develop a public awareness of the complexities of air installation...

  6. The effect of ultrasound at 256 KHz on Microcystis aeruginosa, with ...

    African Journals Online (AJOL)

    2012-10-31

    Oct 31, 2012 ... for 5 min inhibits the growth of the cyanobacterium Spirulina platensis for 3 d, while a sonication with 20 kHz showed no constant effect (Hao et al., 2004). Several mechanisms were discovered by which ultrasonic treatment affects the cells, of which the collapsing of gas vacu- oles during cavitation was ...

  7. 256 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    Materials Transportation: Evaluating Uncertainty by Means of Fuzzy. Logic. Journal of Hazardous Materials, 62:59-74. Cassini, P. (1998) Road Transportation of dangerous goods: quantitative risk assessment and route comparison. Journal of Hazardous Materials. 61:133-1388. Spatial and Temporal Perspective on Road ...

  8. 19 CFR 10.256 - Maintenance of records and submission of Certificate by importer.

    Science.gov (United States)

    2010-04-01

    ... same in all material respects, including physical characteristics, quality, and reputation. (c...-commercial importation of an article; or (iii) A commercial importation of an article whose value does not...

  9. Investigation on steam oxidation behaviour of TP347H FG Part I Exposure at 256 bar

    DEFF Research Database (Denmark)

    Jianmin, J; Montgomery, Melanie; Larsen, OH

    2005-01-01

    The stainless steel TP347H FG is a candidate material for the final stage tubing of superheater and reheater sections of ultra supercritical boilers operated at steam temperatures up to 620C in the mild corrosion environments of coal-firing. A series of field tests has been conducted with the afo......The stainless steel TP347H FG is a candidate material for the final stage tubing of superheater and reheater sections of ultra supercritical boilers operated at steam temperatures up to 620C in the mild corrosion environments of coal-firing. A series of field tests has been conducted...... with the aforementioned steel in coal-fired boilers and this paper focuses on the steam oxidation behaviour for specimens tested at various metal temperatures for exposure times of 7700, 23000 and 30000 hours as investigated by light optical and scanning electron microscopy. The oxide present on the specimens is a duplex......, but the subsequent growth of oxide from further exposure is slower due to the formation of a healing layer consisting of chromium rich oxide near original alloy grain boundaries. At a temperature region above 600C a thin oxide rich in chromium and manganese is formed. In addition precipitation of secondary carbides...

  10. Thermal and physical property determination for IONSIV/256 IE-911 crystalline silicotitanate and Savannah River Site waste simulant solutions

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-12-08

    This document describes physical and thermophysical property determinations that were made in order to resolve questions associated with the decontamination of Savannah River Site waste streams using ion exchange on crystalline silicotitanate.

  11. Avaliação da resposta à insulina e ao AMPc em ratos com tumor Walker-256

    OpenAIRE

    Hely de Morais

    2011-01-01

    O câncer é considerado o maior problema de saúde pública em diversos países e a manifestação mais comum do avanço maligno da doença é a caquexia. A caquexia no câncer é caracterizada por acentuada perda de peso, decorrente do predomínio do catabolismo e anorexia, e por várias anormalidades metabólicas como a resistência à insulina. A resistência insulínica em pacientes com câncer poderia contribuir para a exacerbação dos processos catabólicos no tecido muscular, adiposo e hepático e consequen...

  12. State Programs for the Differential Assessment of Farm and Open Space Land. Agricultural Economic Report No. 256.

    Science.gov (United States)

    Hady, Thomas F.; Sibold, Ann Gordon

    Property taxes relate directly to rural education finance. This bulletin discusses differential tax assessment laws and the reasons states choose to institute them in 1970s. The first part of the report discusses the different types of tax laws and offers available evidence of their effects. More detailed summaries of individual state assessment…

  13. 30 CFR 250.256 - What related facilities and operations information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... facilities and operations located on the OCS (regardless of ownership). (b) Transportation system. A discussion of the transportation system that you will use to transport your production to shore, including: (1) Routes of any new pipelines; (2) Information concerning barges and shuttle tankers, including the...

  14. Thermal Distortion Due to Wall Thickness Variation and Uneven Cooling in an M256 120-mm Gun Barrel

    Science.gov (United States)

    1993-09-01

    REPORT: ADN : ADP0 060 A# AD#: thru ’A# A1W:_AD-P009 091 W IAccesion For NTIS CRA&I"’ IDTIC TABI Unannounced A&E E T j ustificatioft MA 1... 7&9m By...Azimuthal Plane (mils) Figure 7. Predicted and Measured Muzzle Arn le Change. One Minute afer Firing each of Five DM13 Rounds (One Every T_ • Minutes

  15. 256 Fertilité des sols agricoles sous vigne et sous blé de la région ...

    African Journals Online (AJOL)

    LDSE

    L'évaluation de la qualité chimique traduit l'état des sols étudiés en termes de statut acido-basique, organique, nutritif et le diagnostic de leurs fertilités. Cette évaluation sera faite par l'interprétation des résultats de l'analyse chimique des agrégats de taille inférieure ou égale à 2 mm par le pH, le carbone organique total et.

  16. 78 FR 62329 - Special Local Regulation; Tennessee River, Miles 255.0 to 256.5, Florence, AL

    Science.gov (United States)

    2013-10-17

    ... pursuant to authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This.... Civil Justice Reform This rule meets applicable standards in sections 3(a) and 3(b)(2) of Executive.... Technical Standards This rule does not use technical standards. Therefore, we did not consider the use of...

  17. Federal Student Loans: Better Oversight Could Improve Defaulted Loan Rehabilitation. Report to Congressional Requesters. GAO-14-256

    Science.gov (United States)

    Emrey-Arras, Melissa

    2014-01-01

    The Department of Education (Education) relies on collection agencies to assist borrowers in rehabilitating defaulted student loans, which allows borrowers who make nine on-time monthly payments within 10 months to have the default removed from their credit reports. Education works with 22 collection agencies to locate borrowers and explain…

  18. 2-(5,6-Dibromo-7-methyl-3H-imidazo[4,5-b]pyridin-2-ylphenol

    Directory of Open Access Journals (Sweden)

    Haixia Wang

    2010-12-01

    Full Text Available In the title compound, C13H9Br2N3O, the molecular skeleton, influenced by an intramolecular O—H...N hydrogen bond, is roughly planar, with a mean deviation of 0.033 Å. In the crystal, intermolecular N—H...O hydrogen bonds link the molecules into chains propagating in [100]. Weak intermolecular π–π interactions [centroid–centroid distances = 3.760 (3 and 3.723 (3 Å] further consolidate the packing.

  19. SU-E-T-256: Radiation Dose Responses for Chemoradiation Therapy of Pancreatic Cancer: An Analysis of Compiled Clinical Data Using Biophysical Models.

    Science.gov (United States)

    Moraru, I; Tai, A; Erickson, B; Li, X

    2012-06-01

    We have analyzed recent clinical data obtained from chemoradiation of unresectable, locally advanced pancreatic cancer in order to examine possible benefits from radiotherapy (RT) dose escalation as well as to propose possible dose escalated fractionation schemes. A modified linear quadratic (LQ) model was used to fit clinical tumor response data from chemoradiation treatments using different fractionations. Biophysical radiosensitivy parameters, a and α/β, tumor potential doubling time, Td, and delay time for tumor doubling during treatment, Tk, were extracted from the fits and were used to calculate feasible fractionation schemes for dose escalations. Examination of published data from 20 institutions showed no clear indication of improved survival with raised radiation dose. However, an enhancement in tumor response was observed for higher irradiation doses, an important and promising clinical Result with respect to palliation and quality of life. The radiobiological parameter estimates obtained from the analysis are: α/β = 10 ± 3 Gy, a = 0.010 ± 0.003 Gŷ-1, Td = 56 ± 5 days and Tk = 7 ± 2 days. Possible dose escalation schemes are proposed based on the calculation of the biologically equivalent dose (BED) required for a 50% tumor response rate. From the point of view of tumor response, escalation of the administered radiation dose leads to a potential clinical benefit, which when combined with normal tissue complication analyses may Result in improved treatments for certain patients with advanced pancreatic cancer. Based on this analysis, a dose escalation trial with 2.25 Gy/fraction up to 69.75 Gy is being initiated for unresectable pancreatic cancer at our institution. Partially supported by MCW Cancer Center Meinerz Foundation. © 2012 American Association of Physicists in Medicine.

  20. Closing and non-closing sutures in 256 crania of known age and sex from Amsterdam (a.d. 1883–1909)

    NARCIS (Netherlands)

    Perizonius, W.R.K.

    1984-01-01

    By dividing a Dutch reference collection into two subsamples of different ages, remarkable differences were found in the suture closure process in these subsamples. Spearman rank correlations demonstrated that mean endocranial closure stage is correlated (P<0·001) with age in the ages below fifty

  1. Design and Implementation of 256‐Point Radix‐4 100 Gbit/s FFT Algorithm into FPGA for High‐Speed Applications

    National Research Council Canada - National Science Library

    Polat, Gokhan; Ozturk, Sitki; Yakut, Mehmet

    2015-01-01

    ...‐4 is decided to be the optimal solution for our fully parallel FPGA application. The algorithms that we will implement during the development phase are to be tested on a Xilinx Virtex‐6 FPGA platform...

  2. 25 CFR 256.14 - What are the steps that must be taken to process my application for the Housing Improvement Program?

    Science.gov (United States)

    2010-04-01

    ... to the factors and numeric values shown in the following table. Factor Ranking factor and definition... which applicants will be served based on the amount of available funding, starting with the most needy...

  3. Comparison of radiation doses imparted during 128-, 256-, 384-multislice CT-scanners and cone beam computed tomography for intra- and perioperative cochlear implant assessment.

    Science.gov (United States)

    Guberina, N; Dietrich, U; Arweiler-Harbeck, D; Forsting, M; Ringelstein, A

    2017-09-19

    To examine radiation-doses imparted during multislice (MSCT) and cone-beam computed-tomography (CBCT) for perioperative examination of cochlear-implant insertion. Radiation-doses were assessed during standardized petrous-bone CT-protocols at different MSCT ((I) single-source CT-scanner Somatom-Definition-AS+, (II) 2nd generation of dual-source CT-scanner Somatom-Definition-Flash, (III) 3rd generation of dual-source CT-scanner Somatom-Force and at the CBCT Ziehm-Vision-RFD3D ((IV) (a) RFD-3D (Standard-modifier), (b) RFD-3D (Low-dose-modifier)). Image quality was examined by two radiologists appraising electrode-array placement, quality-control of cochlear-implant surgery and complications based on real patients' examinations (n=78). In MSCT-setting following radiation-doses were assessed (CTDIw; DLP): (I) 21.5mGy; 216mGycm; (II) 19.7mGy; 195mGycm; (III) 12.7mGy; 127mGycm; in the CBCT setting radiation doses were distributed as follows: (IV) (a) 1.9mGy; 19.4mGycm; (b) 1.2mGy; 12.9mGycm. Overall, image quality was evaluated as good for both, MSCT- and CBCT-examinations, with a good interrater reliability (r=0.81). CBCT bears considerable dose-saving potential for the perioperative examination of cochlear-implant insertion while maintaining adequate image quality. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Low radiation dose 256-MDCT angiography of the carotid arteries: Effect of hybrid iterative reconstruction technique on noise, artifacts, and image quality

    Energy Technology Data Exchange (ETDEWEB)

    Kondratyev, Evgeny, E-mail: evgenykondratiev@gmail.com; Karmazanovsky, Grigory, E-mail: Karmazanovsky@ixv.ru

    2013-12-01

    To evaluate the effect of hybrid iterative reconstruction on qualitative and quantitative parameters at low dose carotid CTA. Materials and methods: 44 consecutive patients were enrolled in the study. First group (n = 22) was examined under 120 kV 250 mAs, second group (n = 22) – 100 kV 250 mAs. CT images in first group were reconstructed only with the filtered back projection (FBP). CT data in second group were reconstructed both with FBP and three levels of hybrid iterative reconstruction algorithm (iDose). We compared quantitative and qualitative parameters among the two groups and among four different reconstructions in second group. Results: Effective dose in 120 kV and 100 kV group was 7.18 ± 1.19 mSv and 4.14 ± 1.03 mSv, respectively (p < 0.0001). Mean arterial attenuation was about 25% higher in second group (236.5 ± 46 HU vs. 302.6 ± 32.7 HU; p < 0.0001). Image noise at the level of humeral belt was 32.5 ± 12.5 in 100 kV group and 26.3 ± 13.3 in 120 kV (p = 0.115). Average noise decreased when using 3 levels of iDose up to 23.6 ± 6.4, 17.7 ± 5.6 and 13.7 ± 5.1, respectively (p = 0.00001). Mean CNR increased to 10.38 ± 3.87, 14.5 ± 5.21 and 18.32 ± 8.61, respectively (p < 0.05). The presence of artifacts on the level of humeral belt in 120 kV group was 14%, in 100 kV – 41% (p = 0.002). The difference in visual scores between standard and low-dose protocol was significant (p = 0.008). When applying iterative reconstruction the frequency of streak artifacts decreased dramatically (p < 0.0001). Most studies had excellent quality with no artifacts while using highest level of iDose. Conclusion: According to the results of our study low dose CT angiography using hybrid iterative reconstruction may provide sufficient image quality and allows for significant reduction of patient dose.

  5. Wilderness record, Semidi wilderness proposal involving Semidi Island (256,422) acres in the Semidi National Wildlife Refuge, Third Judicial District, Alaska

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Wilderness study report; mineral appraisal; refuge objective statement; Federal Register notice; materials sent to news media; and public hearing package, mailing...

  6. 24 CFR 221.256 - Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and...

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate increase and payment... Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and § 221.65... continuation of a below market interest rate, interest on such mortgage shall be computed by the mortgagee at...

  7. Zur vergleichend-kontrastiven Analyse der baltischen Fassungen von Luthers „Kleinen Katechismus“: Zu apr. 105, 25-6 ʃen brendekermnen

    Directory of Open Access Journals (Sweden)

    Pietro Umberto Dini

    2011-12-01

    Full Text Available LIUTERIO „MAŽOJO KATEKIZMO“ VERTIMŲ Į BALTŲ KALBAS LYGINAMOJI-KONTRASTYVINĖ ANALIZĖ: DĖL PR. 105,25–6 ſen brendekermnenSantraukaTrečiojo prūsų katekizmo sakinys kantou ſen brendekermnen poſtāsei (= vok. wenn du Schwanger wirſt jau du su puse šimtmečio yra iššūkis prūsistams. Straipsnyje, aptarus minėto sakinio ikišiolinius aiškinimus, siūloma nauja jo filologinė ir lingvistinė analizė.Pastebėtina, kad šią „Mažojo katekizmo“ vietą Abelis Willis verčia kitaip nei B. Vilentas (1579 ir J. Rivijus (1586. Pagal tradicinę sakinio segmentaciją vok. Schwanger atitinka pr. ſen brendekermnen, o vok. wirſt – pr. poſtāsei; brendekermnen traktuojamas kaip posesyvinis dūrinys (interpretuojamas kaip „mit ‘Frucht-leib’“, „mit ‘Schwer-leib’“ arba kaip „mit ‘Voll-leib’“, tačiau nė vienas iš šių žodžių vokiečių kalboje nėra paliudytas. Straipsnyje siūloma kitokia segmentacija, t. y.: pr. poſtāsei (beje, kaip ir lie. atitinka vok. Schwanger wirſt „pastoti; konzipieren“, tuo tarpu pr. ſen brendekermnen lieka be atitikmens vokiškame tekste. Vadinasi, Willis sąmoningai nutolo nuo Liuterio „Mažojo katekizmo“ teksto. Dėl pr. ſen brendekermnen siūloma, kad tai yra: 1 lokalinis-medialinis apibrėžimas veiksmažodžiu poſtāsei išreiškiamo veiksmo; 2 determinatyvinis dūrinys ir 3 vertinys pagal medicinos terminus technicus, plg. vok. (1594 m. Berleib [dabart. Gebärleib] „gimda, įsčios; uterus“.Atrodo, kad A. Willis nutolo ne be pagrindo. Prūsiškame tekste greičiausiai bus atsiradusi diktografijos išprovokuota klaida <ſen… ſen ← *en… ſen>, kurią reikėtų emenduoti kaip *en brendekermnen (vietininkas. Jei tai tiesa, nagrinėjama prūsų kalbos teksto vieta yra nesunkiai paaiškinama. Iš tikrųjų vertėjas į prūsų kalbą čia bus atsižvelgęs į Luko evangeliją (1,31, plg. vok. (1522 m. Liuteris du wirſt ſchwanger ym leibe, lo. (1529 m. Liuterio Vulgatos peržiūrėjimas Ecce concipes in utero, gr. (Septuaginta συλλήμψῃ ἐν γαστρὶ. Įdomu, kad lokalinis apibrėžimas kartojasi ir kitose baltų kalbose, plg. lie. (1590 m. Bretkūno nieſchcʒe bu̓ſi ſʒiwate bei la. (1685 m. Glücko tu tapſ̷i apgruhtinata tawâs Meeśâs.

  8. Crystal structure of hexaaquanickel(II bis{2-[(5,6-dihydroxy-3-sulfonatoquinolin-1-ium-7-yloxy]acetate} dihydrate

    Directory of Open Access Journals (Sweden)

    Hai Le Thi Hong

    2015-09-01

    Full Text Available The asymmetric unit of the title compound, [Ni(H2O6](C11H8NO8S2·2H2O, features a half-hexaaquanickel(II complex cation with the NiII ion on an inversion center, one deprotonated 5,6-dihydroxy-3-sulfoquinolin-7-yloxyacetic acid (QOH molecule appearing in its zwitterionic form and one lattice water molecule. The sulfonate group is disordered over two positions with occupancy factors of 0.655 (5 and 0.345 (5. The hexaaquanickel(II cation interacts through hydrogen bonding with eight QOH molecules and two water molecules. The six-membered rings of quinoline show π–π stacking [centroid-to-centroid distances of 3.679 (2 Å and 3.714 (2 Å].

  9. 25 CFR 256.17 - What will the servicing housing office do to identify what work is to be done on my dwelling?

    Science.gov (United States)

    2010-04-01

    ... other regional-based, industry-recognized cost data, such as that provided by the MEANs or MARSHALL... detailed, written report, also called “bid specifications” that identifies what and how the repairs... construction, the “bid specifications” will be supplemented with a set of construction plans. The plans must...

  10. Growth inhibition of Walker carcinosarcoma 256 with alcoholic extract of green tea leaves (Camellia sinensis Inibição do crescimento do carcinossarcoma 256 de Walker pelo extrato alcoólico de folhas de chá verde(Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Mauriclécio Franco Ponte

    2012-09-01

    Full Text Available PURPOSE: To evaluate the antitumor activity of alcoholic extracts of green tea (Camella sinensis. METHODS: Four groups of six Wistar rats were inoculated intramuscularly with 10(6 Walker tumor cells/mL. During 10 days, the animals received by gavage either 0.9% saline solution (Group I; negative control, solution containing 20 mg/Kg of tamoxifen (Group II; positive control, solution containing 0.07 g/Kg alcoholic extract of C. sinensis (Group III, or solution containing 0.14 g/Kg alcoholic extract of C. sinensis (Group IV. Following euthanasia on the tenth day, the tumor, liver, kidneys and spleen were excised and weighed, and tumor volume and tumor growth inhibition were quantified. RESULTS: The average weight of the animals was greater in Group IV than in Group II (p=0.0107. Tumor weight was smaller in Group IV than in Group I (p=0.0062, but did not differ from Group II. Tumor volume was smaller in Groups II and IV than in Group I (p=0.0131. Tumor growth inhibition was observed in Groups II (44.67% ± 32.47, III (16.83% ± 53.02 and IV (66.4% ± 25.82 (p>0.05. The groups did not differ with regard to the weight of the excised organs. CONCLUSION: Alcoholic extracts of green tea have antitumor activity.OBJETIVO: Avaliar a atividade antitumoral do extrato alcoólico do chá verde (C. sinensis. MÉTODOS: Quatro grupos de seis ratos Wistar foram inoculados com 1x10(6 células/mL do tumor de Walker por via intramuscular. Os grupos foram tratados durante 10 dias, por gavagem, com salina 0,9 % (Grupo I, controle negativo, 20 mg/Kg de tamoxifeno (Grupo II, controle positivo e extrato alcoólico de C. sinensis nas doses de 0,07 g/Kg (Grupo III ou 0,14 g/Kg (Grupo IV. O volume e a inibição do crescimento tumoral foram calculados. RESULTADOS: A média dos pesos dos animais foi maior no Grupo IV do que no Grupo II (p=0,0107. O peso tumoral do Grupo IV foi menor do que o Grupo I (p=0,0062, mas não houve diferença quando comparado ao Grupo II. O volume tumoral foi menor nos grupos II e IV quando comparados ao Grupo I (p=0,0131. Inibição tumoral foi observada nos Grupos II = 44,67 ± 32,47, III = 16,83 ± 53,02 e IV = 66,4 ± 25,82 (p>0,05. Não houve diferença no peso dos órgãos entre os grupos. CONCLUSÃO: O extrato alcoólico do chá verde possui ação antitumoral.

  11. SU-E-J-256: Predicting Metastasis-Free Survival of Rectal Cancer Patients Treated with Neoadjuvant Chemo-Radiotherapy by Data-Mining of CT Texture Features of Primary Lesions

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, H; Wang, J; Shen, L; Hu, W; Wan, J; Zhou, Z; Zhang, Z [Fudan University Shanghai Cancer Center, Shanghai (China)

    2015-06-15

    Purpose: The purpose of this study is to investigate the relationship between computed tomographic (CT) texture features of primary lesions and metastasis-free survival for rectal cancer patients; and to develop a datamining prediction model using texture features. Methods: A total of 220 rectal cancer patients treated with neoadjuvant chemo-radiotherapy (CRT) were enrolled in this study. All patients underwent CT scans before CRT. The primary lesions on the CT images were delineated by two experienced oncologists. The CT images were filtered by Laplacian of Gaussian (LoG) filters with different filter values (1.0–2.5: from fine to coarse). Both filtered and unfiltered images were analyzed using Gray-level Co-occurrence Matrix (GLCM) texture analysis with different directions (transversal, sagittal, and coronal). Totally, 270 texture features with different species, directions and filter values were extracted. Texture features were examined with Student’s t-test for selecting predictive features. Principal Component Analysis (PCA) was performed upon the selected features to reduce the feature collinearity. Artificial neural network (ANN) and logistic regression were applied to establish metastasis prediction models. Results: Forty-six of 220 patients developed metastasis with a follow-up time of more than 2 years. Sixtyseven texture features were significantly different in t-test (p<0.05) between patients with and without metastasis, and 12 of them were extremely significant (p<0.001). The Area-under-the-curve (AUC) of ANN was 0.72, and the concordance index (CI) of logistic regression was 0.71. The predictability of ANN was slightly better than logistic regression. Conclusion: CT texture features of primary lesions are related to metastasisfree survival of rectal cancer patients. Both ANN and logistic regression based models can be developed for prediction.

  12. REVIEW OF ‘TERRAIN VAGUE: INTERSTICES AT THE EDGE OF THE PALE’ By Manuela Mariani and Patrick Barron (editors. London & New York, Routledge, 2014, 256 pages, ISBN 978-0415827683

    Directory of Open Access Journals (Sweden)

    Anna Katharina Grichting

    2014-03-01

    This book Terrain Vague: Interstices at the Edge of the Pale – edited by the architect Manuela Mariani and the professor of English Patrick Barron - seeks to expand on Sola-Morales ideas and to present the terrain vague through a taxonomy of urban empty spaces presented by the authors in the introduction – derelict lands, brownfields, voids, loose spaces, heterotopias, dead zones, urban wilds, counter-sites. The book aims to collectively refine this notion as a central concept of urban planning and design, architecture, landscape architecture, film studies, cultural geography, literature, photography, and cultural studies, looking at possible positive alternatives to the negative images projected into them.

  13. Precaution, bioethics and normative justification: Daniel Steel: Philosophy and the precautionary principle: science, evidence and environmental policy. Cambridge University Press, Cambridge, 2015, xv + 256 pp, ISBN 978-1-107-07816-1

    National Research Council Canada - National Science Library

    Munthe, Christian

    2015-01-01

    Daniel Steel’s new book on the precautionary principle illustrates the need to work ahead to fuse perspectives of epistemology and philosophy of science with those of ethics to accomplish progress in the debate...

  14. Perfil da produção de óxido nítrico (NO) pelo cerebelo na progressão do estado caquético induzido por tumor de Walker-256

    OpenAIRE

    Fábio Leandro Santos Fenner

    2009-01-01

    A síndrome caquexia-anorexia é um estado metabólico complexo caracterizado por perda de músculos, tecido adiposo e anorexia. A perda de peso corporal pode ser causada por uma adaptação metabólica do indivíduo em prol do crescimento do tumor. A caquexia faz parte da progressão de diversas doenças, dentre elas, o câncer. Estudos anteriores em nosso laboratório demonstraram a associação entre caquexia e produção de •NO no músculo esquelético e no córtex cerebral de ratos. O •NO é um radical livr...

  15. Methods for assessing physical activity: a systematic review focused on older adults. http://dx.doi.org/10.5007/1980-0037.2013v15n2p256

    Directory of Open Access Journals (Sweden)

    Deisy Terumi Ueno

    2013-03-01

    Full Text Available Among the large array of instruments for measuring physical activity (PA, the use of questionnaires, pedometers, and accelerometers with older adults is frequent. This study aimed to analyze the most widely adopted protocol for each instrument that is most commonly used to assess PA in older adults, and explore possible advantages and disadvantages of the methods used for these instruments. Thereby, we performed a search in databases and cross references of the articles selected. This procedure yielded in 16 studies being included. The in-depth analyzed studies demonstrate that questionnaires are usually applied either as an interview or self-administered, assessing the domains of leisure, sports, and household chores with a recall period of a typical week in the last month. Regarding pedometers and accelerometers, the length of time considered to be sufficient for data collection is five days. The devices are frequently used on the waist or hip with a belt or attached to clothing and removed only for water activities or during sleeping time. The use of either instrument should take into account the advantages and disadvantages that influence choosing one over the other, such as the number of participants to be evaluated, the time available for assessment, among others. The use of accelerometer along with PA questionnaire may yield more reliable and accurate measurements of PA level. In addition, it is recommended that, for older adults, questionnaires should be applied employing the interview format, in order to minimize possible misinterpretation of the questions.

  16. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  18. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  19. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  20. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  1. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  2. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  3. Del otro lado del Río: ambientalismo y política entre uruguayos y argentinos; Vicente Palermo y Carlos Reboratti (compiladores) : Edhasa, 2007. ISBN 978-987-628-004-4. 256 páginas

    OpenAIRE

    Porcelli, Emanuel

    2008-01-01

    La historia reciente de la Política Exterior Argentina guardará durante años algunos capítulos dedicados al diferendo iniciado en el 2003 por la instalación de las plantas de celulosa en el margen oriental del Río Uruguay. La presente obra es una de las primeras aproximaciones, en donde se intenta realizar un análisis desde diferentes aristas al conflicto. Este trabajo compilado por Vicente Palermo y Carlos Reboratti intenta combinar la visión de académicos (que provienen de diferentes dis...

  4. Three novel HBB mutations, c.-140C>G (-90 C>G), c.237_256delGGACAACCTCAAGGGCACCT (FS Cd 78/85 -20 bp), and c.315+2T>G (IVS2:2 T>G). Update of the mutational spectrum of β-Thalassemia in Mexican mestizo patients.

    Science.gov (United States)

    Rizo-de-la-Torre, L C; Ibarra, B; Sánchez-López, J Y; Magaña-Torres, M T; Rentería-López, V M; Perea-Díaz, F J

    2017-10-01

    Beta-thalassemia (β-thal) is frequent in Mexican patients with microcytosis and hypochromia. We report three novel mutations and analyze the actual mutational spectrum in Mexican population. One hundred and forty-nine β-thal Mexican mestizo patients were studied (154 alleles). ARMS-PCR was performed to identify Cd39C>T, IVS1:1G>A, IVS1:110G>A, -28A>C, initiation codonA>G and IVS1:5G>A mutations, and gap-PCR for δβ-thal Spanish type. DNA sequencing of HBB gene was carried out in negative samples for the initial screening. Fifteen different HBB gene mutations were observed in 148 alleles; three of them are novel: -90C>G, 20 bp deletion (at codons 78/85), and IVS2:2T>G; the mutation IVS1:6T>C that was observed for first time in our population; and eleven previously described mutations. Six alleles showed normal HBB sequence. To date, a total of 21 different mutations have been observed in Mexican patients; the four most frequent mutations are of Mediterranean origin: Cd39C>T (37.2%), IVS1:1G>A (17.3%), IVS1:110G>A (13.9%), and δβ-thal Spanish type (9.0%), which represent 77.4% of the total studied alleles. Considering the novel mutations -90C>G, -20 bp Cd78/85, IVS2:2T>G and the first observation of IVS1:6T>C, the molecular spectrum of β-thal in Mexicans comprises 21 different mutations, confirming the high allelic heterogeneity in Mexicans. © 2017 John Wiley & Sons Ltd.

  5. Novel Single Photon Counting Readout Circuits and APD Arrays with Capability from UV to IR Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The overall goal of the proposed Phase I SBIR project is to develop and demonstrate 256x256 segmented readout integrated circuits (ROICs) that can read, digitize and...

  6. DOD Product Support Business Case Analysis Guidebook

    Science.gov (United States)

    2011-04-01

    Cargo Aircraft; Mike Tesi , 256-313-3745 10 Automatic Requirements Computation System Initial Provisioning (ARCSIP) CECOM; Ken Steinberg, LEO...Block III 256-313- 4988 PM Aviation Systems, PD Joint Cargo Aircraft Mike Tesi , 256- 313-3745 16 Computerized Optimization Model for

  7. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  8. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  9. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  10. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  11. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  12. Web‐Based Portal for Impact Evaluation Reveals Information Needs for Museums, Libraries and Archives. A review of: Williams, Dorothy A., Caroline Wavell, Graeme Baxter, Alan MacLennan, and Debbie Jobson. “Implementing Impact Evaluation in Professional Practice: A Study of Support Needs Within the Museum, Archive and Library Sector.” International Journal of Information Management 25.6 (Dec. 2005: 533‐48.

    Directory of Open Access Journals (Sweden)

    David Hook

    2007-03-01

    Full Text Available Objective – This study reports on research into the information and support needs of practitioners in the museum, archive, and library sectors, who are undergoing an impact evaluation.Design – Qualitative survey.Setting – Web‐based questionnaire.Subjects – Twenty‐one practitioners in the fields of museums, archives, and libraries.Methods – The study made use of a small scale web portal that provides impact evaluation research findings, toolkits, and examples of methods. The portal’s intent was to present to the users multiple views of the available information in order to overcome the problem of users not being able to identify their needs. A purposive sample group consisting of 50 practitioners from the museum, library, and archive fields was invited to participate in a questionnaire evaluating the website.Main Results – Despite a fairly low response rate (49% and poor distribution among the three sectors (museums, libraries, and archives, the results indicated a significant difference in the levels of knowledge and understanding of impact evaluation. Over half of the organizations surveyed had done some assessment of their institution’s economic impact, and there appears to be a rising trend towards doing impact studies for specific projects and developments. Nearly a quarter of the organizations had not undertaken any impact evaluation study previously. Practitioners already familiar with impact evaluation tended to look at broader range of fields for expertise, whereas those with less familiarity remained within their own sector. Practitioners with less experience preferred tools, guidance, and examples of methodologies as opposed to actual evidence of impact. The results also provided the authors with feedback on their web portal and how to organize the information therein.Conclusions – One of the findings of the study was that the overall reaction to impact evaluation support through research evidence, guidance, and other mechanisms was positive. For most practitioners, evaluation itself and the level of understanding of impact evaluation are at early stages. The primary goals for those undertaking impact evaluation were found to be professional and organizational learning, thus there is a need for practical help and guidance in these areas. Time limitation appeared to be a significant factor in the responses – particularly with smaller organizations – suggesting that their portal material would provide much‐needed assistance to such organizations. Finally, it was concluded that future emphasis should be placed on developing practical applications rather than pure research.

  13. The Uses of a Polarimetric Camera

    Science.gov (United States)

    2008-09-01

    xiii ACKNOWLEDGMENTS I would like to acknowledge the following people in their help with this thesis: • Professor R. C. Olsen • Angela Puetz...and more efficient measurements of light polarization, which set the foundation for many discoveries in the remainder of the century. Eastman Kodak ...of Day’, align = 0.5, size = 1.8, color = 0 red = 255 green = 255*256L blue = 255* 256L * 256L white = red+ green + blue window, 2, xsize

  14. Kuritegevusehirm, sotsiaalkontroll ja kommunitarism : kas kriminaalõiguse suund suuremale ühiskondlikkusele? / Jaan Sootak

    Index Scriptorium Estoniae

    Sootak, Jaan, 1948-

    2000-01-01

    Positiivsest üldpreventsioonist, ubikviteedipreventsioonist, nulltolerantsist ja kommunitaristlikust karistusteooriast. Ilmunud ka: Sootak, Jaan. Kuri karjas : [artiklite kogumik]. Tartu, 2009, lk. 225-256

  15. Drug: D05341 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05341 Drug Palmitic acid (NF) C16H32O2 256.2402 256.4241 D05341.gif Ingredient in ...a diagnostic aid [ultrasound contrast medium] Same as: C00249 Component of Leovist (TN) CAS: 57-10-3 PubChem

  16. Does Family Structure Matter in the Relationships between Youth Assets and Youth Alcohol, Drug and Tobacco Use?

    Science.gov (United States)

    Oman, Roy F.; Vesely, Sara K.; Tolma, Eleni; Aspy, Cheryl B.; Rodine, Sharon; Marshall, LaDonna

    2007-01-01

    This study investigated significant relationships between youth assets and youth alcohol, tobacco, and drug use that differ according to family structure (one- or two-parent households). Data were collected from a randomly sampled inner-city population (n=1,256 teenagers and 1,256 parents of the teenagers) using in-home, in-person interviews.…

  17. Proceedings of the Cloud Impacts on DoD Operations and Systems 1993 Conference (CIDOS - 93) Held in Fort Belvoir, Virginia on 16-19 November 1993

    Science.gov (United States)

    1994-07-01

    18, and 110 seconds for 128x128, 256x256, and 512x512 images respectively on a Silicon Graphics 50 MHz IRIS Indigo workstation. A preliminary...Air Force Systems Command, Hansom AFB, Massachusetts, 7 pp. Reinke, D.L., T.H. Vonde, nanr, C.L. Combs and S.Q. Kid ,’i.*, 1992: Satellite cloud

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 256 of 256 ... A Garba, BM Bolajoko, IJ Barde, A Ahmed, I Sa'adatu, I Agang, AS Abdullahi, HA Bakan, UA Turaki, A Abdurrahman, JN Goji. Vol 10, No 2 (2012), Time-related and sequential developmental horizons of Sahel goat foetuses, Abstract PDF. MA Waziri, NM Sivachelvan, AR Mustapha, AY Ribadu.

  19. implementation of spatial domain homomorphic filtering

    African Journals Online (AJOL)

    eobe

    There is a lot of background literature on frequency- domain Homomorphic ... developed in the literature [4-6, 8-9]. This paper ..... Processing times for spatial and frequency domain filter. Colour Image Dimensions Spatial domain processing time(s) Frequency domainprocessing time(s). Girl. 256 × 256. 0.058. 0.914. Swan.

  20. Pati, Prof. Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Quantum Information Theory, Quantum Computing, Foundations of Quantum Theory Address: QIC Group, Physics Division, Harish Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, U.P.. Contact: Office: (0532) 227 4391. Mobile: 87566 12314. Fax: (0532) 256 9576, (0532) 256 7444

  1. Radiation Hard Sensors for Surveillance.

    Science.gov (United States)

    1988-03-11

    magnitude higher count rate and better spatial resolution. Table 2: Comparison of diverse 2-D detectors of X-rays. Gas( MWPC ) TV CCD SXD Size: [cm] 20...of various 2-D detectors of neutrons. Gas( MWPC ) Scintillators SIND* Diameter [cm] 20 100 100 Resolution 512 x 512 256 x 256 4096 x 4096 QDE: Thermal 85

  2. Satellite backhaul

    Indian Academy of Sciences (India)

    ... require 25 kbps; Internet connectivity of about 100 - 200 kbps. appropriate caching and mirror server at hub; can provide Internet connections to about 50 villages. RT requires a 128 / 256 kbps dedicated connection. To serve multiple RTs, a shared download of 2 Mbps will help. uplink channels can be 128 / 256 kbps SCPC.

  3. Problems and Prospects of Pineapple Production in Enugu State ...

    African Journals Online (AJOL)

    Nnaji cynthia

    index.php/jae. Email: editorinchief@aesonnigeria. ... produce (x̅=2.56), and lack of technical knowledge on the use of improved technology (x̅=2.56). ...... submitted to The Swedish Society for Nature Conservation. August, 2014. Nwaru, J.C. ...

  4. Facultative Sterol Uptake in an Ergosterol-Deficient Clinical Isolate of Candida glabrata Harboring a Missense Mutation in ERG11 and Exhibiting Cross-Resistance to Azoles and Amphotericin B

    NARCIS (Netherlands)

    Hull, Claire M.; Parker, Josie E.; Bader, Oliver; Weig, Michael; Gross, Uwe; Warrilow, Andrew G. S.; Kelly, Diane E.; Kelly, Steven L.

    We identified a clinical isolate of Candida glabrata (CG156) exhibiting flocculent growth and cross-resistance to fluconazole (FLC), voriconazole (VRC), and amphotericin B (AMB), with MICs of >256, >256, and 32 mu g ml(-1), respectively. Sterol analysis using gas chromatography-mass spectrometry

  5. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  6. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  7. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  8. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  9. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  10. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  11. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  12. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  13. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  14. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  15. Optical Shaft-Angle Encoder For Helicopter Rotor

    Science.gov (United States)

    Golub, Robert A.; Fitzpatrick, Fred; Dennis, Dale V.; Taylor, Bryant D.

    1993-01-01

    Angular position of helicopter rotor blade determined precisely. Accomplished by use of optical shaft-angle encoder called "256 Ring" on rotor swashplate. Each 360 degree rotation of helicopter main rotor broken down into 256 reflective segments. As rotor rotates, beam of light reflected in turn from each segment into optoelectronic system. One of 256 segments reflects larger pulse than others do. Position of rotor determined by counting number of pulses after this reference pulse. While swashplate mounting requirements unique to each type of helicopter, concept applicable to all types of rotorcraft.

  16. 78 FR 43180 - Procurement List; Proposed Additions and Deletions

    Science.gov (United States)

    2013-07-19

    ... Bottle, GS High Dilution 256 Neutral Disinfectant, Silk Screened, 12-32oz bottles NPA: Susquehanna... and Printing, 9000 Blue Mound Road, Fort Worth, TX NPA: Goodwill Industrial Services of Fort Worth...

  17. Application of Artificial Neural Network to Computer-Aided Diagnosis of Coronary Artery Disease in Myocardial SPECT Bull's-eye Images

    National Research Council Canada - National Science Library

    Fujita, Hiroshi; Katafuchi, Tetsuro; Uehara, Toshiisa; Nishimura, Tsunehiko

    1992-01-01

    .... The technique employs a neural network to analyze 201 Tl myocardial SPECT bull's-eye images. This multi-layer feed-forward neural network with a backpropagation algorithm has 256 input units (pattern...

  18. Comprehensive family therapy: an effective approach for cognitive rehabilitation in schizophrenia

    National Research Council Canada - National Science Library

    Cai, Jun; Zhu, Yi; Zhang, Weibo; Wang, Yanfeng; Zhang, Chen

    2015-01-01

    .... An 18-month follow-up clinical trial of 256 stabilized patients with schizophrenia at six communities in Shanghai, People's Republic of China were randomly assigned to into either a comprehensive family therapy (CFT...

  19. Food for Thought: Cross-Classification and Category Organization in a Complex Real-World Domain.

    Science.gov (United States)

    Ross, Brian H.; Murphy, Gregory L.

    1999-01-01

    Seven studies involving 256 undergraduates examined how people represent, access, and make inferences about the real-world category domain, foods. Results give a detailed picture of the use of cross-classification in a complex domain. (SLD)

  20. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Troposphere Exchange Processes, Ground & Space-B Address: Space Physics Laboratory, Vikram Sarabhai Space Centre, Thiruvananthapuram 695 022, Kerala Contact: Office: (0471) 256 2157. Residence: (0471) 234 2603, 98955 94770. Fax: (0471) ...

  1. NODC Standard Product: Climatic Atlas of the Barents Sea 1998: Temperature, Salinity, Oxygen (NODC Accession 0000300)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This NODC CD-ROM product (NODC-121) contains the time and space distribution of 74,256 ocean stations (temperature, salinity, and oxygen) occupied in the Barents Sea...

  2. Review: Leonard and Virginia Woolf, the Hogarth Press and the Networks of Modernism, Ed. Helen Southworth (Edinburgh: Edinburgh UP, 2010

    Directory of Open Access Journals (Sweden)

    Caitlyn Tierney Caldwell

    2014-12-01

    Full Text Available A review of Helen Southworth (Editor, Leonard and Virginia Woolf, the Hogarth Press and the Networks of Modernism. ix + 256 pp., notes, appendix, index. Edinburgh: Edinburgh University Press, 2010. £75

  3. Dicty_cDB: AFO243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AE008995.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 21 of 256 of the complete...|AE007962.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 20 of 254 of the complete

  4. Social support patterns of collegiate athletes before and after injury

    National Research Council Canada - National Science Library

    Yang, Jingzhen; Peek-Asa, Corinne; Lowe, John B; Heiden, Erin; Foster, Danny T

    2010-01-01

    .... Prospective observational study. A Big Ten Conference university. A total of 256 National Collegiate Athletic Association Division I male and female collegiate athletes aged 18 or older from 13 sports teams...

  5. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  6. A Medipix2-based imaging system for digital mammography with silicon pixel detectors

    CERN Document Server

    Bisogni, M G; Fantacci, M E; Mettivier, G; Montesi, M C; Novelli, M; Quattrocchi, M; Rosso, V; Russo, P; Stefanini, A

    2004-01-01

    In this paper we present the first tests of a digital imaging system based on a silicon pixel detector bump-bonded to an integrated circuit operating in single photon counting mode. The X-rays sensor is a 300 mu m thick silicon, 14 by 14 mm/sup 2/, upon which a matrix of 256 * 256 pixels has been built. The read-out chip, named MEDIPIX2, has been developed at CERN within the MEDIPIX2 Collaboration and it is composed by a matrix of 256 * 256 cells, 55 * 55 mu m/sup 2/. The spatial resolution properties of the system have been assessed by measuring the square wave resolution function (SWRF) and first images of a standard mammographic phantom were acquired using a radiographic tube in the clinical irradiation condition. (5 refs).

  7. Proximate and Mineral Composition of the Pulp of Chrysophyllum ...

    African Journals Online (AJOL)

    MBI

    2014-11-13

    , calcium .... bioavailability by hindering their hydrolytic ... of the pulp of Chrysophyllum albidum (mg/100g). ELEMENTS. PULP (mg/100g). Potassium. 256.57+5.77. Sodium. 40.00+0.00. Phosphorus. 2.21+0.03. Calcium.

  8. Vibratory sensory testing in acute compartment syndromes: a clinical and experimental study.

    Science.gov (United States)

    Phillips, J H; Mackinnon, S E; Beatty, S E; Dellon, A L; O'Brien, J P

    1987-05-01

    Invasive and noninvasive diagnostic testing was correlated in 11 patients with acute compartmental syndromes of the forearm. The excellent correlation between diminished perception of vibration and increasing compartmental pressure suggested that 256 cycle per second (cps) vibratory stimuli may be useful clinically in determining the appropriate time for surgical intervention in the acute compartmental syndrome. In 12 adult male volunteers, elevated compartment pressures were created in the anterior tibial compartment of the leg. A decrease in perception to 256 cycle per second (cps) vibratory stimulus was the earliest sensory abnormality to occur with elevated tissue compartment pressures. Analysis of variance showed significantly that 256-cps vibration was the most reliable and earliest sensory modality to change at pressures of 35 to 40 mmHg. These clinical and experimental findings support the use of the 256-cps tuning fork as a noninvasive diagnostic test in the evaluation of the patient with suspected acute compartment syndrome.

  9. The Conference from the Prague Perspective

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2017-01-01

    Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

  10. Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain

    Directory of Open Access Journals (Sweden)

    Angela Rehbein

    2015-03-01

    Full Text Available Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain. New Haven: Yale UP, 2014. xi, 256 pages: illustrations; 24 cm. ISBN 978-0-300-17740-4.

  11. Sõlmes alumiiniummaja = Aluminium House in a Knot

    Index Scriptorium Estoniae

    2008-01-01

    Alumiiniumplaatidega kaetud sõlmekujulise plaaniga eramu (256 m2). Arhitektid: Peeter Pere, Urmas Muru. Projektbüroo: Muru & Pere. Konsultant Katrin Kaevats. Valmis: 2007. 2 plaani, 4 värv. välisvaadet, sisevaade

  12. Hyperlactatemia and concurrent use of antiretroviral therapy among

    African Journals Online (AJOL)

    Administrator

    concentration exceeds 4-5mmol/L even among patients without systemic ... Phone (256) 414 541188 .... between ART use and hyperlactatemia, the student's t-test was used. Results ..... Furthermore, the white blood cell component of the SIRS ...

  13. ORF Alignment: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323724 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion...1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var. n

  14. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|15219798 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion....1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var.

  15. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NT_033779 gi|28574716 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion....1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var.

  16. ORF Alignment: NC_003423 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003423 gi|19111992 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion....1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var.

  17. ORF Alignment: NC_005783 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005783 gi|45185248 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion....1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var.

  18. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17541368 >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion....1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus neoformans var.

  19. Attosecond nanotechnology: NEMS of energy storage and nanostructural transformations in materials

    Science.gov (United States)

    Beznosyuk, Sergey A.; Zhukovsky, Mark S.; Maslova, Olga A.

    2015-10-01

    The attosecond technology of the nanoelectromechanical system (NEMS) energy storage as active center fast transformation of nanostructures in materials is considered. The self-organizing relaxation of the NEMS active center containing nanocube of 256-atoms limited by planes (100) in the FCC lattice matrix of 4d-transition metals (Ru, Rh, Pd) is described by the quantum NEMS-kinetics (NK) method. Typical for these metals change of the NEMS active center physicochemical characteristics during the time of relaxation is presented. There are three types of intermediate quasistationary states of the NEMS active center. Their forms are plainly distinguishable. The full relaxed NEMS active centers (Ru256, Rh256, Pd256) accumulate next storage energies: ERu = 2.27 eV/at, ERh = 1.67 eV/at, EPd = 3.02 eV/at.

  20. Attosecond nanotechnology: NEMS of energy storage and nanostructural transformations in materials

    Energy Technology Data Exchange (ETDEWEB)

    Beznosyuk, Sergey A., E-mail: bsa1953@mail.ru; Maslova, Olga A., E-mail: maslova-o.a@mail.ru [Altai State University, Barnaul, 656049 (Russian Federation); Zhukovsky, Mark S., E-mail: zhukovsky@list.ru [Altai State Technical University, Barnaul, 656038 (Russian Federation)

    2015-10-27

    The attosecond technology of the nanoelectromechanical system (NEMS) energy storage as active center fast transformation of nanostructures in materials is considered. The self-organizing relaxation of the NEMS active center containing nanocube of 256-atoms limited by planes (100) in the FCC lattice matrix of 4d-transition metals (Ru, Rh, Pd) is described by the quantum NEMS-kinetics (NK) method. Typical for these metals change of the NEMS active center physicochemical characteristics during the time of relaxation is presented. There are three types of intermediate quasistationary states of the NEMS active center. Their forms are plainly distinguishable. The full relaxed NEMS active centers (Ru{sub 256}, Rh{sub 256}, Pd{sub 256}) accumulate next storage energies: E{sub Ru} = 2.27 eV/at, E{sub Rh} = 1.67 eV/at, E{sub Pd} = 3.02 eV/at.

  1. Qualitative trait loci analysis for seed yield and component traits in ...

    African Journals Online (AJOL)

    VANITHA

    2014-02-05

    ,linkage map for cultivated sunflower. Theor. Appl. Genet. 96:15-22. Jinks JL, Pooni HS (1976). Predicting the properties of recombinant inbred lines derived by single seed descent method. Heredity 36:253-. 256. Johnson HW ...

  2. Consumer perceptions of the sale of tobacco products in pharmacies and grocery stores among U.S. adults

    National Research Council Canada - National Science Library

    Patwardhan, Pallavi; McMillen, Robert; Winickoff, Jonathan P

    2013-01-01

    ...) to explore their opinions on sale of tobacco products in pharmacies and grocery stores. The majority reported that sale of tobacco products should be either 'allowed if products hidden from view' (29.9%, 25.6...

  3. Gclust Server: 89705 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(256) 963 mel-46: Maternal Effect Lethal family member (mel-46) 1 1.00e-99...Sequence length 963 Representative annotation mel-46: Maternal Effect Lethal family member (mel-46) Number of

  4. Domain Modeling: NP_653314.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_653314.1 chr2 Crystal structure of an 8 repeat consensus TPR superhelix (trigona...l crystal form) p2hyza_ chr2/NP_653314.1/NP_653314.1_apo_256-390.pdb p2fo7a_ chr2/NP_653314.1/NP_653314.1_holo_256-390.pdb psi-blast 416K,417H,418Y,458N _CD 1 ...

  5. Digital image processing for two-phase flow

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Young; Lim, Jae Yun [Cheju National University, Cheju (Korea, Republic of); No, Hee Cheon [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

    1992-07-01

    A photographic method to measure the key parameters of two-phase flow is realized by using a digital image processing technique. The 8 bit gray level and 256 x 256 pixels are used to generates the image data which is treated to get the parameters of two-phase flow. It is observed that the key parameters could be identified by treating data obtained by the digital image processing technique.

  6. Structure-Guided Modification of Rhizomucor miehei Lipase for Production of Structured Lipids

    Science.gov (United States)

    Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan

    2013-01-01

    To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids. PMID:23844120

  7. Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

    Directory of Open Access Journals (Sweden)

    Jun-Hui Zhang

    Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

  8. Industry Strength Tool and Technology for Automated Synthesis of Safety-Critical Applications from Formal Specifications

    Science.gov (United States)

    2015-11-01

    entertainment center at home and the smart-phones we use for communication – all have embedded systems in them. Some of these embedded systems are complex...Columbia Esterel Compiler [25], Esterel Studio [77] (commercial tool), etc. We consider here the compiler distributed by INRIA [37]. This compiler...of test input is 256x256 pixels (can be any size). 3. Energy Meter A model of the control system used in any common home energy measurement

  9. Sharp Infrared Eyes The Journey of QWIPs from Concept to Large Inexpensive Sensitive Arrays in Hand-held Infrared Cameras

    Science.gov (United States)

    Gunapala, Sarath; Sundaram, Mani; Liu, Joun; Bandara, Sumith

    1996-01-01

    One of the simplest device realizations of the classic particle-in-a-box problem of basic quantum mechanics is the Quantum Well Infrared Photodetector (QWIP). Optimization of the detector design and material growth and processing has culminated in the realization of a camera with a large (256x256 pixel) focal plane array of QWIPs which can see at 8.5 mu m, holding forth great promise for a variety of applications in the 6-25 mu m wavelength range.

  10. Dicty_cDB: AFK463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available probable transport protein Sec61 alpha subunit - Aedes aegypti. Score = 134 bits (337), Expect = 3e-31...trans... 260 5e-68 AY064125_1( AY064125 |pid:none) Aedes aegypti clone bR19Mc3 probab... 258 3e-67 AB062670_1(...Sec6... 256 7e-67 AF392805_1( AF392805 |pid:none) Aedes aegypti strain RED probable ... 256 9e-67 BT059399_1(

  11. Modeling Studies of the Leeuwin Current using a High-Resolution Primitive Equation Model

    Science.gov (United States)

    1989-09-01

    DistributioniAvailability of Abstract 21 Abtrc Security Classmotb 0 unclassifihd unlimited 13 samw us report D3 1)1 ic users Unclassified 23a Norme o Responsible...day 120 depth 0 T at day 120 depth 0 12B - 12830 -1280 1024 i-1024 -1024 -768 -76 -768 U.•, o , ,- o -, .-512 5-512 L -256 -258 -256 0 -0 Ŕ 576 384

  12. GETDB: 104775 [GETDB

    Lifescience Database Archive (English)

    Full Text Available inal cells, mouth fook (26-R-6), sg dorsal crescent of proximal leg, ubiquitous lethal - comment1:A, comme...ethal Also known as - Original Comments comment1:A, comment2:56A Disc (Image) d1 d2 d3 Disc (number) 3 Embry...nt2:56A d1 d2 d3 - - - Show 104775 DGRC Number 104775 Link to Original Genotype w[*

  13. Radiation Test Results for Common CubeSat Microcontrollers and Microprocessors

    Science.gov (United States)

    Guertin, Steven M.; Amrbar, Mehran; Vartanian, Sergeh

    2015-01-01

    SEL, SEU, and TID results are presented for microcontrollers and microprocessors of interest for small satellite systems such as the TI MSP430F1611, MSP430F1612 and MSP430FR5739, Microchip PIC24F256GA110 and dsPIC33FJ256GP710, Atmel AT91SAM9G20, and Intel Atom E620T, and the Qualcomm Snapdragon APQ8064.

  14. Improvement on detectability of early ischemic changes for acute stroke using nonenhanced computed tomography: Effect of matrix size

    Energy Technology Data Exchange (ETDEWEB)

    Ogura, Akio, E-mail: a-ogura@mbox.kyoto-inet.or.jp [Department of Radiology, Kyoto City Hospital (Japan); Graduate School of Medical Science, Kanazawa University (Japan); Hayakawa, Katsumi [Department of Radiology, Kyoto City Hospital (Japan); Miyati, Tosiaki [Graduate School of Medical Science, Kanazawa University (Japan); Maeda, Fumie [Department of Radiology, Kyoto City Hospital (Japan)

    2010-11-15

    Purpose: It has recently been reported that intravenous recombinant tissue plasminogen activator improves the clinical outcome after acute stroke. Computed tomography (CT) is the standard imaging method used to determine the indication for thrombolysis. However, detection of early ischemic change often results in an increase in local radiation exposure. Therefore, the effects of decreased matrix size and use of a noise reduction filter were evaluated. Materials and methods: The low contrast resolution was compared for different matrix sizes and imaging filters using a contrast-detail phantom. In addition, early ischemic change in clinical images with matrix sizes of 256 x 256 and 128 x 128 processed using three imaging filters (Gaussian, smoothing, and unsharp mask) from 11 patients within 3 h of stroke onset was evaluated by seven radiologists in a blind manner. Results: The use of images with a matrix size of 256 x 256 and processed with the Gaussian filter increased the detection of early signs of acute stroke. Conclusions: This study was performed to determine whether the converted matrix size and use of imaging filters could improve the detectability of early ischemic change on CT images in acute stroke. To reduce the dose of radiation exposure for patients, it was effective to use an optimal noise reduction filter and reasonable matrix size. In particular, changing the matrix size to 256 x 256 was the most effective for detection of early ischemic change in examinations using clinical images.

  15. Productivity, Physicochemical Changes, and Antioxidant Activity of Shiitake Culinary-Medicinal Mushroom Lentinus edodes (Agaricomycetes) Cultivated on Lignocellulosic Residues.

    Science.gov (United States)

    Gaitán-Hernández, Rigoberto; Zavaleta, Marco Antonio Barradas; Aquino-Bolaños, Elia Nora

    2017-01-01

    The effects of substrate and strain on productivity, physicochemical characteristics, and compounds with antioxidant activity were evaluated in basidiomes of the shiitake mushroom, Lentinus edodes. Strains IE-245 and IE-256 and the substrates oak wood shavings (OW), sorghum stubble (SS), and sugar cane bagasse (SC) were used. Productivity was evaluated by measuring biological efficiency (BE), production rate (PR), and yield. Total sugars, total soluble solids, pH, titratable acidity, color parameters, total phenolics, flavonoids, ascorbic acid, and antioxidant activity of the basidiomes were measured. BE, PR and yield were higher with the combination IE-256/SS, at 103.71%, 1.32%, and 34.57%, respectively. The largest amount of total sugars (17.61 mg glucose · g-1 dry weight) was found with combination IE-256/SS. Variation was observed in basidiome color; the lowest luminosity (L*) value (darkest color) was found in the IE-256 strain on the OW substrate (L* = 30.45), whereas that of the IE-245 strain on the SC substrate was the lightest in color (L* = 57.00). The largest amounts of total phenolics were recorded in the IE-256 strain on the OW (6.50 mg gallic acid equivalents [GAE] · g-1 dry weight) and the SS substrates (5.85 mg GAE · g-1 dry weight). The best antioxidant activity was obtained with IE-256-0.80, 0.65, and 0.59 μmol Trolox equivalents · g dry weight-1-on the OW, SC, and SS substrates, respectively. Based on the values of BE, PR, and yield, IE-256/SS was the most productive. Substrate and strain, and their interactions, influenced the physicochemical characteristics of the basidiomes and the amounts of compounds with antioxidant activity they contained.

  16. Negative feedback from CaSR signaling to aquaporin-2 sensitizes vasopressin to extracellular Ca2.

    Science.gov (United States)

    Ranieri, Marianna; Tamma, Grazia; Di Mise, Annarita; Russo, Annamaria; Centrone, Mariangela; Svelto, Maria; Calamita, Giuseppe; Valenti, Giovanna

    2015-07-01

    We previously described that high luminal Ca(2+) in the renal collecting duct attenuates short-term vasopressin-induced aquaporin-2 (AQP2) trafficking through activation of the Ca(2+)-sensing receptor (CaSR). Here, we evaluated AQP2 phosphorylation and permeability, in both renal HEK-293 cells and in the dissected inner medullary collecting duct, in response to specific activation of CaSR with NPS-R568. In CaSR-transfected cells, CaSR activation drastically reduced the basal levels of AQP2 phosphorylation at S256 (AQP2-pS256), thus having an opposite effect to vasopressin action. When forskolin stimulation was performed in the presence of NPS-R568, the increase in AQP2-pS256 and in the osmotic water permeability were prevented. In the freshly isolated inner mouse medullar collecting duct, stimulation with forskolin in the presence of NPS-R568 prevented the increase in AQP2-pS256 and osmotic water permeability. Our data demonstrate that the activation of CaSR in the collecting duct prevents the cAMP-dependent increase in AQP2-pS256 and water permeability, counteracting the short-term vasopressin response. By extension, our results suggest the attractive concept that CaSR expressed in distinct nephron segments exerts a negative feedback on hormones acting through cAMP, conferring high sensitivity of hormone to extracellular Ca(2+). © 2015. Published by The Company of Biologists Ltd.

  17. Granulocytes as effective anticancer agent in experimental solid tumor models.

    Science.gov (United States)

    Jaganjac, Morana; Poljak-Blazi, Marija; Kirac, Iva; Borovic, Suzana; Joerg Schaur, Rudolf; Zarkovic, Neven

    2010-12-01

    The aim of the study was to elucidate the effects of murine granulocytes on the growth of solid murine tumors when administrated in the vicinity of W256 carcinoma growing in Sprague Dawley rats, and in the vicinity of Ehrlich ascites tumor (EAT) growing in BALBc mice. The administration of granulocytes significantly improved the survival of W256-bearing rats, and increased the tumor regression incidence from 17% up to 75%. Rats with regressing tumors had 2.5 times increased levels of granulocytes in peripheral blood, which were also cytotoxic in vitro for W256 carcinoma cells. However, blood levels of cytokine-induced neutrophil chemoattractant-2, tumor necrosis factor α and interleukin 6 were similar between rats with regressing tumors and control healthy rats, suggesting that the observed regression of W256 carcinoma was caused by specific anticancer effects of the applied granulocytes. Anticancer effects of granulocytes were also found in BALBc mice bearing solid form of EAT, resulting in a 20% increase of survival in EAT-bearing mice. Therefore, the administration of granulocytes, isolated from healthy animals and applied at the site of solid tumors in rats and in mice, reduced experimental tumor growth, and extended the survival of tumor-bearing animals, while in some rats it even caused a W256 regression. Copyright © 2010 Elsevier GmbH. All rights reserved.

  18. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  19. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  20. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  1. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  2. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  3. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  4. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  5. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  6. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  7. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  8. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  9. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  10. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  11. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  12. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  13. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  14. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  15. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  16. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  17. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  18. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  19. Parallelization of a numerical simulation code for isotropic turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Shigeru; Yokokawa, Mitsuo; Watanabe, Tadashi; Kaburaki, Hideo

    1996-03-01

    A parallel pseudospectral code which solves the three-dimensional Navier-Stokes equation by direct numerical simulation is developed and execution time, parallelization efficiency, load balance and scalability are evaluated. A vector parallel supercomputer, Fujitsu VPP500 with up to 16 processors is used for this calculation for Fourier modes up to 256x256x256 using 16 processors. Good scalability for number of processors is achieved when number of Fourier mode is fixed. For small Fourier modes, calculation time of the program is proportional to NlogN which is ideal complexity of calculation for 3D-FFT on vector parallel processors. It is found that the calculation performance decreases as the increase of the Fourier modes. (author).

  20. Rootkit Detection Using a Cross-View Clean Boot Method

    Science.gov (United States)

    2013-03-01

    Hash Type Hash 1 Hacker Defender SHA256 SHA1 MD5 32bb981821fba79619f99f6cd9fb1347c4cb58ec26313c50665b80218a8f0832...6236eb59427021659ff0031d85e25cf8966ed91f33d868b9f578b2ed1c702dce 65115c405f71aea1d8c0a69d088435890f404825 b67c2117c39846ac1380c84f229b9a9e 58 # Rootkit Hash Type Hash 13 Haxdoor SHA256 SHA1 MD5 ...ad2d6c5cbe4a2b1839b780e916e42945 59 # Rootkit Hash Type Hash 26 Kryptik SHA256 SHA1 MD5

  1. Improved Impossible Differential Attacks on Large-Block Rijndael

    DEFF Research Database (Denmark)

    Wang, Qingju; Gu, Dawu; Rijmen, Vincent

    2012-01-01

    . The improvement can lead to 10-round attack on Rijndael-256 as well. With 2198.1 chosen plaintexts, an attack is demonstrated on 9-round Rijndael-224 with 2 195.2 encryptions and 2140.4 bytes memory. Increasing the data complexity to 2216 plaintexts, the time complexity can be reduced to 2130 encryptions...... and the memory requirements to 2 93.6 bytes. For 9-round Rijndael-256, we provide an attack requiring 2229.3 chosen plaintexts, 2194 encryptions, and 2 139.6 bytes memory. Alternatively, with 2245.3 plaintexts, an attack with a reduced time of 2127.1 encryptions and a memory complexity of 290.9 bytes can...... be mounted. With 2244.2 chosen plaintexts, we can attack 10-round Rijndael-256 with 2253.9 encryptions and 2186.8 bytes of memory....

  2. Concentração inibitória mínima (CIM de oito antimicrobianos frente isolados de Streptococcus suis

    Directory of Open Access Journals (Sweden)

    Felipe Masiero Salvarani

    2008-02-01

    Full Text Available The minimun inhibitory concentration (MIC was determined toward amoxicilin, ampicilin, penicillin, ceftiofur, florfenicol, lincomycin, trimethoprim-sulfadiazine and tetracycline for 75 strains of Streptococcus suis. The MIC was performed on sheep blood agar plates containing concentrations varying from 0,25 to 256 µg/ml of the antibiotic described above. The amoxicilin in the concentrations of 1 and 2 µg/ml, florfenicol in the concentration of 1 µg/ml and trimethoprim-sulfadiazine in the concentrations of 2 e 8 µg/ml, were the antibiotics that presented minor resistance. In contrast, the ampicilin, tetracycline, ceftiofur and lincomycin, presented MIC of 64 and 128 µg/ml, 64 and 128 µg/ml, 128 and 256 µg/ml and >;256 µg/ml, respectively. The results of this study show that the amoxicilin and florfenicol are the antibiotics of choice for the treatment of diseases by S. suis in swine.

  3. Klebsiella pneumoniae with multiple antimicrobial resistance

    Directory of Open Access Journals (Sweden)

    Caio Mendes

    Full Text Available A Klebsiella pneumoniae strain was isolated from the urine of a patient at one of the centers participating in the 2001 edition of the MYSTIC program in Brazil. The initial phenotypic findings of the isolated K. pneumoniae presented an unusual MIC of 8 mug/mL to meropenem, 2 mug/mL to imipenem, elevated MICs to broad spectrum cephalosporins (ceftazidime/cefotaxime/cefepime MIC > 256 mug/mL, aminoglycosides (gentamycin > 256 mug/mL and tobramycin = 48 mug/mL, piperacillin/tazobactam (MIC > 256 mug/mL and susceptibility to ciprofloxacin (MIC = 0.25 mug/mL. The strain also tested positive for ESBL production with double-disk and E-test methodologies. More detailed investigation revealed that the strain produced a SHV-4 type enzyme and also lacked a 36 kDa outer membrane porin.

  4. Multiple pathways of escape from HIV broadly cross-neutralizing V2-dependent antibodies.

    Science.gov (United States)

    Moore, Penny L; Sheward, Daniel; Nonyane, Molati; Ranchobe, Nthabeleng; Hermanus, Tandile; Gray, Elin S; Abdool Karim, Salim S; Williamson, Carolyn; Morris, Lynn

    2013-05-01

    Broadly cross-neutralizing (BCN) antibodies are likely to be critical for an effective HIV vaccine. However, the ontogeny of such antibodies and their relationship with autologous viral evolution is unclear. Here, we characterized viral evolution in CAP256, a subtype C-infected individual who developed potent BCN antibodies targeting positions R166 and K169 in the V2 region. CAP256 was superinfected at 3 months postinfection with a virus that was highly sensitive to BCN V2-dependent monoclonal antibodies. The autologous neutralizing response in CAP256 was directed at V1V2, reaching extremely high titers (>1:40,000) against the superinfecting virus at 42 weeks, just 11 weeks prior to the development of the BCN response targeting the same region. Recombination between the primary and superinfecting viruses, especially in V2 and gp41, resulted in two distinct lineages by 4 years postinfection. Although neutralization of some CAP256 clones by plasma from as much as 2 years earlier suggested incomplete viral escape, nonetheless titers against later clones were reduced at least 40-fold to less than 1:1,000. Escape mutations were identified in each lineage, either at R166 or at K169, suggesting that strain-specific and BCN antibodies targeted overlapping epitopes. Furthermore, the early dependence of CAP256 neutralizing antibodies on the N160 glycan decreased with the onset of neutralization breadth, indicating a change in specificity. These data suggest rapid maturation, within 11 weeks, of CAP256 strain-specific antibodies to acquire breadth, with implications for the vaccine elicitation of BCN V2-dependent antibodies. Overall these studies demonstrate that ongoing viral escape is possible, even from BCN antibodies.

  5. AcEST: BP915336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_C12 256 Adiantum capillus-veneris mRNA. clone: YMU001_000070_C12. BP915336... CL2234Contig1 Show BP915336 Clone id YMU001_000070_C12 Library YMU01 Length 256 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000070_C12. Accession BP915336 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915336|Adiantum capillus-veneris mRNA, clone: ...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915336|Adiantum capillus-vene

  6. AcEST: DK950225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 256 5e-67 tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illumination chlorophyll... 254 3e-66 tr|A9PFG9|A9PFG9...a m... 245 2e-63 tr|A1Y9I7|A1Y9I7_MAIZE Chloroplast post-illumination chlorophyll...YANVD 255 Query: 549 DGSCPYISDESSD 587 DGSCP +S + Sbjct: 256 DGSCPLELSDSDE 268 >tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illuminati

  7. Scientific and Engineering Studies; Spectral Estimation.

    Science.gov (United States)

    1977-01-01

    1972, pp. 104-117. 15. V. Kucera , "The Matrix Equation AX+XB - C," SIAM J. App1. Math., vol. 26, no. 1, Jan . 1974, pp. 15-25. 16. R. E. Hartwig, "AX-XB...percent Overlap 33 TR 4767 0 - - - a- - -1.42 0 .. .. flI I, 246 256 266 Frequency (Hz) Figure 12. fo= 256 71/2 Hz amy -50-5.0 0 .u _ -S - 34 (I- - - -1O a...analytic expansions of (15) are not fruitful , in contrast with the earlier approach for MSC results. instead, we must adopt some convenient simple

  8. Gclust Server: 90545 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 90545 Fal_FRAAL3518 Cluster Sequences Related Sequences(253) 256 3-hydroxyacyl-CoA dehydrogenase... type II (Short-chain type dehydrogenase/reductase) 1 1.00e-45 0.0 0.0 0.0 0.0 3.23 0.0 Show 90545 Cluster ID 90545 Se...quence ID Fal_FRAAL3518 Link to cluster sequences Cluster Sequences Link to related sequences Related Se...quences(253) Sequence length 256 Representative annotation 3-h...ydroxyacyl-CoA dehydrogenase type II (Short-chain type dehydrogenase/reductase) Number of Sequences 1 Homolo

  9. Gclust Server: 11371 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 11371 Cph_Cpha266_1485 Cluster Sequences Related Sequences(110) 256 putative reverse transcriptase/maturase...uence ID Cph_Cpha266_1485 Link to cluster sequences Cluster Sequences Link to related sequences Related Sequences(110) Se... family protein 9 1.00e-50 0.0 0.0 0.0 6.67 9.68 0.0 Show 11371 Cluster ID 11371 Seq...quence length 256 Representative annotation putative reverse transcriptase/maturase... family protein Number of Sequences 9 Homologs 9 Clustering threshold 1.00e-50 Plants and alg

  10. The Temperature Dependence of the Debye-Waller Factor of Magnesium

    DEFF Research Database (Denmark)

    Sledziewska-Blocka, D.; Lebech, Bente

    1976-01-01

    The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi-harmonic appro......The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi...

  11. Statistical Image Processing.

    Science.gov (United States)

    1982-11-16

    spectral analysist texture image analysis and classification, __ image software package, automatic spatial clustering.ITWA domenit hi ba apa for...ICOLOR(256),IBW(256) 1502 FORMATO (30( CNO(N): fF12.1)) 1503 FORMAT(o *FMINo DMRGE:0f2E20.8) 1504 FORMAT(/o IMRGE:or15) 1505 FOR14ATV FIRST SUBIMAGE:v...1506 FORMATO ’ JOIN CLUSTER NL:0) 1507 FORMAT( NEW CLUSTER:O) 1508 FORMAT( LLBS.GE.600) 1532 FORMAT(15XoTHETA ,7X, SIGMA-SQUAREr3Xe MERGING-DISTANCE

  12. Variability of thermohaline properties in Pearl Lagoon, Nicaragua (ESP)

    OpenAIRE

    Brenes, Carlos L.; Ballestero, Daniel

    2016-01-01

    Several hydrographic surveys were carried out in Pearl Lagoon, Nicaragua between april 1995 and december 1997 under the DIPAL (Proyecto para el Desarrollo Integral de la Pesca Artesanal en la Región Autónoma del Atlántico Sur) project. Surface temperature, salinity, dissolved oxygen and turbidity have been measured in 88 hydrographic campaigns. The annual cycle shows maximum and minimum temperatures in May (29.4 °C) and December (25.6 °C) respectively, maximum salinity (25.6 °C) in April, one...

  13. The charge pump PLL clock generator designed for the 1.56 ns bin size time-to-digital converter pixel array of the Timepix3 readout ASIC

    CERN Document Server

    Fu, Y et al.

    2014-01-01

    Timepix3 is a newly developed pixel readout chip which is expected to be operated in a wide range of gaseous and silicon detectors. It is made of 256×256 pixels organized in a square pixel-array with 55 µm pitch. Oscillators running at 640 MHz are distributed across the pixel-array and allow for a highly accurate measurement of the arrival time of a hit. This paper concentrates on a low-jitter phase locked loop (PLL) that is located in the chip periphery. This PLL provides a control voltage which regulates the actual frequency of the individual oscillators, allowing for compensation of process, voltage, and temperature variations.

  14. Photodynamic therapy with photofrin II derivative in the treatment of carcinosarcoma of rats with diabetes mellitus

    Science.gov (United States)

    Dima, Vasile F.; Vasiliu, Virgil V.; Ionescu, Mircea D.; Laky, Dezideriu

    1995-03-01

    Four batches of Wistar rats with Walker-256 carcinosarcoma were used to test the effects of PDT upon `in vivo' tumor growth. Ten days after tumor transplantation, rats from batch I(DM) were exposed to Photofrin II (20 mg/kg), given i.p. 24 h before exposure to laser (632.8 nm; 10 mw; He-Ne laser), five doses given at 4 days intervals; batch II and batch III received sole treatment (DM or PDT). The control batch IV included animals with untreated Walker-256 tumors. The animals were followed up 42 days.

  15. Flexible Photovoltaics: Mission Power from the Sun

    Science.gov (United States)

    2009-11-01

    UNCLASSIFIED Flexible Photovoltaics: Mission Power from the Sun NSRDEC Project Officer: Steven Tucker Senior Engineer, EE COMM 508-233-6962 DSN 256...NOV 2009 2. REPORT TYPE 3. DATES COVERED 00-00-2009 to 00-00-2009 4. TITLE AND SUBTITLE Flexible Photovoltaics: Mission Power from the Sun 5a

  16. 7 CFR 654.16 - Property management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Property management. 654.16 Section 654.16 Agriculture... Property management. Sponsor(s) are to: (a) Use real property acquired in whole or in part with Federal... property (34 CFR part 256). (c) Establish, adopt, and comply with a property management system which meets...

  17. 7 CFR 1767.19 - Liabilities and other credits.

    Science.gov (United States)

    2010-01-01

    ... 255Accumulated Deferred Investment Tax Credits 256Deferred Gains from Disposition of Utility Plant 257Unamortized... transaction shall be recorded by debiting Account 131.1, Cash—General, and crediting Account 451... adjustment, unrealized gains and losses on certain investments in debt and equity securities, and cash flow...

  18. High efficiency, long life terrestrial solar panel

    Science.gov (United States)

    Chao, T.; Khemthong, S.; Ling, R.; Olah, S.

    1977-01-01

    The design of a high efficiency, long life terrestrial module was completed. It utilized 256 rectangular, high efficiency solar cells to achieve high packing density and electrical output. Tooling for the fabrication of solar cells was in house and evaluation of the cell performance was begun. Based on the power output analysis, the goal of a 13% efficiency module was achievable.

  19. Phenotype-gene: 58 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 58 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1057i decreased efficiency...17(2):256-68. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12533513i decreased efficiency durin

  20. Self-regulation of learning and performance level of elite youth soccer players

    NARCIS (Netherlands)

    Toering, Tynke; Elferink-Gemser, Marije T.; Jordet, Geir; Pepping, Gert-Jan; Visscher, Chris

    2012-01-01

    This study examined the relationship between self-regulated learning and performance level of 256 elite youth soccer players aged 12 to 17 years (M-age = 14.2; SD = 1.2). As relative age may affect this relationship through its association with maturation, experience, and performance level, we

  1. Microprocessor aided data acquisition at VEDAS

    Energy Technology Data Exchange (ETDEWEB)

    Ziem, P.; Drescher, B.; Kapper, K.; Kowallik, R.

    1985-08-01

    Three microprocessor systems have been developed to support data acquisition in nuclear physics multiparameter experiments. A bit-slice processor accumulates up to 256 1-dim spectra and 16 2-dim spectra. A microprocessor, based on the AM 29116 ALU, performs a fast consistency check on the coincidence data. A VME-Bus double-processor displays a colored scatterplot.

  2. To Be or Not To Be Ethical. That's the Question for Advertising Students and Practitioners.

    Science.gov (United States)

    McBride, Michael H.; Cline, Carolyn G.

    A study examined the business and personal ethics of advertising students and advertising practitioners to determine whether important differences exist between the two groups. Data were gathered from 256 advertising professionals and from 178 students majoring in advertising at a Southwestern university. Subjects responded to twelve…

  3. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006138 gi|51246320 >1swvA 5 256 3 215 9e-25 ... ref|YP_066204.1| similar to indigo...idine systhesis protein [Desulfotalea psychrophila ... LSv54] emb|CAG37197.1| related to indigoidine

  4. Prevalence of measles neutralizing antibody in children under 15 ...

    African Journals Online (AJOL)

    The immune status of children under 15 years in the Southwestern region of Nigeria against measles virus was determined using the neutralization test with a view to assessing the herd immunity to the virus in these communities. A total of 256 serum samples collected from children were tested by the beta method of ...

  5. 78 FR 40970 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Six West Texas...

    Science.gov (United States)

    2013-07-09

    ... associated with scientific resources management such as research, census, law enforcement, habitat.... 256; Lysne et al. 2007, p. 649). Dundee and Dundee (1969, p. 207) found diatoms (a group of single... tryonia, indicating diatoms are a primary food source. Spring ecosystems occupied by these snail species...

  6. The effects of wildfire and environmental amenities on property values in northwest Montana, USA

    Science.gov (United States)

    Kyle M. Stetler; Tyron J. Venn; David E. Calkin

    2010-01-01

    This study employed the hedonic price framework to examine the effects of 256 wildfires and environmental amenities on home values in northwest Montana between June 1996 and January 2007. The study revealed environmental amenities, including proximity to lakes, national forests, Glacier National Park and golf courses, have large positive effects on property values in...

  7. A meta-analytic review of the MMPI validity scales and indexes to detect defensiveness in custody evaluations

    National Research Council Canada - National Science Library

    Francisca Fariña; Laura Redondo; Dolores Seijo; Mercedes Novo; Ramón Arce

    2017-01-01

    .... The instrument of choice for undertaking this double task is the MMPI. Method: As to establish the state of the art on this, a meta-analysis was undertaken with a total of 32 primary studies from which 256 effect sizes were assessed...

  8. Investigation of zoonotic infections in risk groups in Ordu University ...

    African Journals Online (AJOL)

    Conclusions: In this study, examined in the risk groups in which it is located along black sea coast of Turkey for tularemia, bartonellosis, and hydatid cysts, seropositivity was not found. When Brucella was tested, 7.8% was found to be positive, and when analyzed in terms of Q fever, 25.6% of people were determined to be ...

  9. Education and Social Selection in Ancient China: Semantics, Conceptual Transformation and Social Change

    Science.gov (United States)

    Wu, Meiyao

    2015-01-01

    This paper investigates the transformation in the Zhou dynasty China (1046-256 BC) of the concept of education in relation to the process of social selection, which concerns the distribution both of knowledge and of social ranks. An approach in terms of historical semantics, mainly influenced by Luhmannian sociological theory with some reference…

  10. Hawthorne Control Procedures in Educational Experiments: A Reconsideration of Their Use and Effectiveness.

    Science.gov (United States)

    Adair, John G.; And Others

    1989-01-01

    A descriptive analysis of research practices and a meta-analysis of control group effect sizes are used to address Hawthorne effects in educational experiments. The analysis of 86 studies and 256 treatment/Hawthorne/no-treatment control group effect size comparisons indicate that artifact controls have limited utility in dealing with the Hawthorne…

  11. Production of value-added chars and activated carbons from animal manure

    Science.gov (United States)

    The United States has a strong agricultural foundation that leaves behind large quantities of animal wastes. In the United States, an estimated 9 billion broilers, 256 million turkeys, 62 million pigs and 97 million dairy cows were produced in 2006 producing 5 times the waste of the U.S. human popu...

  12. Alfred Lameli, Roland Kehrein, Stefan Rabanus (eds): Language and Space. An Internatuinal Handbook of Linguistic Variation. Volume 2. Language Mapping. Part , I, II. Berlin - New York 2010: De Gruyer Mouton, I, 668 s., II, 446 s. (ISBN 978-3-11-019609-2, e-ISBN 978-3-11-021916-6)

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena

    2015-01-01

    Roč. 7, - (2015), s. 247-256. ISBN 978-83-7654-182-2. ISSN 1898-9276 R&D Projects: GA ČR(CZ) GAP406/11/1786 Keywords : language/linguistic maps * language/linguistic atlases * computerization of language mapping Subject RIV: AI - Linguistics

  13. Computer-Aided Structural Engineering (CASE) Project. Sliding Stability of Concrete Structures (CSLIDE).

    Science.gov (United States)

    1987-10-01

    This report is a documentation of the computer program (CSLIDE) which was developed to assess the sliding stability of concrete structures using the...limit equilibrium method described in ETL 1110-2-256, Sliding Stability for Concrete Structures . CSLIDE can compute the factor of safety against

  14. Lack of arginine vasopressin-induced phosphorylation of aquaporin-2 mutant AQP2-R254L explains dominant nephrogenic diabetes insipidus.

    NARCIS (Netherlands)

    Mattia, F.P. de; Savelkoul, P.J.M.; Kamsteeg, E.J.; Konings, I.B.M.; Sluijs, P. van der; Mallmann, R.; Oksche, A.; Deen, P.M.T.

    2005-01-01

    Water homeostasis in humans is regulated by vasopressin, which induces the translocation of homotetrameric aquaporin-2 (AQP2) water channels from intracellular vesicles to the apical membrane of renal principal cells. For this process, phosphorylation of AQP2 at S256 by cAMP-dependent protein kinase

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 256 ... Vol 7, No 2 (2008), Field trial of Malaysian thermostable Newcastle disease vaccine in village chickens in Kaduna State, Nigeria, Abstract PDF ... Vol 14, No 1 (2016), Gastrointestinal helminths and external parasites of domestic rats trapped from residential areas within Maiduguri Municipality, Nigeria ...

  16. International Journal of Arts and Humanities(IJAH) Ethiopia

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    of Copernicus and Immanuel Kant in the history of philosophy” (256). Instrumentalism, which is our major focus fluctuates between the second and the third aspects of his pragmatic theory of truth. Understandably, Dewey calls his pragmatic theory, instrumentalism just to distinguish it from other forms of pragmatism.

  17. AcEST: BP920585 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|P31569|YCF2_OENVI Protein ycf2 (Fragment) OS=Oenothera villar... 45 1e-04 sp|Q8IWN7|RP1L1_HUMAN Retinitis ...D Sbjct: 256 EVEGTED 262 >sp|Q8IWN7|RP1L1_HUMAN Retinitis pigmentosa 1-like 1 pro

  18. Observed Gossip Moderates the Link between Anxious Withdrawal and Friendship Quality in Early Adolescence

    Science.gov (United States)

    Menzer, Melissa M.; McDonald, Kristina L.; Rubin, Kenneth H.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Schulz, Annie

    2012-01-01

    We evaluated whether gossip between best friends moderated the relation between anxious withdrawal and friendship quality in early adolescence, using an Actor-Partner Interdependence Model ("APIM," Kenny, Kashy, & Cook, 2006) approach. Participants (n = 256) were 5th and 6th grade young adolescents (actors) and their best friends…

  19. Non-Attenuation Of Highly Pathogenic Avian Influenza H5N1 By ...

    African Journals Online (AJOL)

    Avian influenza H5N1 represents one of the most researched viruses in laboratories world-wide in recent times with regards to its epidemiology, ecology, biology and geography. The virus has caused 409 human cases and 256 human fatalities to date. Some laboratory activities and other lab related works predispose ...

  20. Dry socket following surgical removal of impacted third molar in an ...

    African Journals Online (AJOL)

    2013-03-02

    Mar 2, 2013 ... Materials and Methods: A total of 189 patients with a total of 256 surgeries entered this study. Surgeries to ... Department of Oral and Maxillofacial Surgery, 1Member of Student Research Committee, Dental School, Mashhad. University of ... Diabetes (22), hypertension (4), and asthma (1). A total of 49 cases ...

  1. Correlates of Sexual Abuse and Smoking among French Adults

    Science.gov (United States)

    King, Gary; Guilbert, Philippe; Ward, D. Gant; Arwidson, Pierre; Noubary, Farzad

    2006-01-01

    Objective: The goal of this study was to examine the association between sexual abuse (SA) and initiation, cessation, and current cigarette smoking among a large representative adult population in France. Method: A random sample size of 12,256 adults (18-75 years of age) was interviewed by telephone concerning demographic variables, health…

  2. Integrating GIS in the Middle School Curriculum: Impacts on Diverse Students' Standardized Test Scores

    Science.gov (United States)

    Goldstein, Donna; Alibrandi, Marsha

    2013-01-01

    This case study conducted with 1,425 middle school students in Palm Beach County, Florida, included a treatment group receiving GIS instruction (256) and a control group without GIS instruction (1,169). Quantitative analyses on standardized test scores indicated that inclusion of GIS in middle school curriculum had a significant effect on student…

  3. ONR Far East Scientific Information Bulletin. Volume 14, Number 4, October-December 1989

    Science.gov (United States)

    1989-12-01

    found it said that the name of this program reflects appropriate to define new long range bea - the original charter of MCC, which was to cons...Congress on Hong Kong Penny Moon, Conference Manager 2-4 Biosensors Elsevier Seminars Mayfield House 256 Banbury Rd. Oxford OX2 7DH, U.K. May The 14th

  4. Long-term results of the randomized phase III trial EORTC 18991 of adjuvant therapy with pegylated interferon alfa-2b versus observation in resected stage III melanoma

    NARCIS (Netherlands)

    A.M.M. Eggermont (Alexander); S. Suciu (Stefan); A. Testori (Alessandro); M. Santinami (Mario); W.H.J. Kruit (Wim); J. Marsden (Jeremy); C.J.A. Punt (Cornelis); F. Salès (François); R. Dummer (Reinhard); C. Robert (Caroline); D. Schadendorf (Dirk); P. Patel (Poulam); G. de Schaetzen (Gaetan); A. Spatz (Alan); U. Keilholz (Ulrich)

    2012-01-01

    textabstractPurpose: Adjuvant pegylated interferon alfa-2b (PEG-IFN-α-2b) was approved for treatment of resected stage III melanoma in 2011. Here, we present long-term follow-up results of this pivotal trial. Patients and Methods: In all, 1,256 patients with resected stage III melanoma were randomly

  5. The role of preoperative prophylactic antibiotic administration in periapical endodontic surgery: a randomized, prospective double-blind placebo-controlled study

    NARCIS (Netherlands)

    Lindeboom, J. A. H.; Frenken, J. W. H.; Valkenburg, P.; van den Akker, H. P.

    2005-01-01

    Aim To determine the value of clindamycin prophylaxis in the prevention of postoperative wound infections in patients undergoing endodontic surgery. Methodology This study included 256 patients undergoing endodontic surgery in a prospective double-blind placebo-controlled trial comparing oral

  6. Missorting of the Aquaporin-2 mutant E258K to multivesicular bodies/lysosomes in dominant NDI is associated with its monoubiquitination and increased phosphorylation by PKC but is due to the loss of E258.

    NARCIS (Netherlands)

    Kamsteeg, E.J.; Savelkoul, P.J.; Hendriks, G.; Konings, I.B.M.; Nivillac, N.M.; Lagendijk, A.K.; Sluijs, P van der; Deen, P.M.T.

    2008-01-01

    To stimulate renal water reabsorption, vasopressin induces phosphorylation of Aquaporin-2 (AQP2) water channels at S256 and their redistribution from vesicles to the apical membrane, whereas vasopressin removal results in AQP2 ubiquitination at K270 and its internalization to multivesicular bodies

  7. High-Resolution Melting Curve Analysis for High-Throughput Genotyping of NOD2/CARD15 Mutations and Distribution of These Mutations in Slovenian Inflammatory Bowel Diseases Patients

    Directory of Open Access Journals (Sweden)

    Mitja Mitrovič

    2011-01-01

    in CD patients, 25/197 (12.69% in UC patients and in 26/256 (10.15% in healthy controls. We have successfully implemented NOD2/CARD15 HRMA assays, which may contribute to the development of genetic profiles for risk prediction of developing CD and for differential diagnosis of CD vs. UC.

  8. Historic Properties Report: Picatinny Arsenal, Dover, New Jersey.

    Science.gov (United States)

    1985-03-01

    an explosion, is the most complicated part of a shell. Activities within the 200 area included the manufacture of mercury fulminate , lead azide, and...Detonator Loading) 1918 #235 Ordnance Facility ( Mercury Fulminate Mixing) 1918 #252 Operating (Press Loading) 1918 #256 Ordnance Facility (No. 6 Powder

  9. Influence of amendments on soil structure and soil loss under ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-13

    Sep 13, 2010 ... Adding each of the three polymers to the soil increased infiltration by an average of 0.813 mm min-1; an increase of 25.6% over the control. Increasing the number of polymer applications gradually increased water infiltration rates until the infiltration levelled off under the PPA and. UR treatments, whereas ...

  10. Knowledge and perceptions about indoor residual spray for malaria ...

    African Journals Online (AJOL)

    Dr.Munga

    of malaria in the previous 2–3 years. Whether or not the local communities considered malaria as an important cause of mortality, 74% (n = 256) believed that malaria was an important cause of mortality, while 25% (n = 88) did not believe so. Only 1.1% of the respondents did not know whether malaria cause death or not.

  11. Preliminary study on the potential of improving pulp quality and energy efficiency in a South African TMP mill

    CSIR Research Space (South Africa)

    Johakimu, Jonas K

    2010-09-01

    Full Text Available ). The mill’s screen fractionation process has limited efficiency. Substantial amounts of thick-walled fibres are present in the mill accept pulp samples (i.e. 66% by mass of the mill accept has a freeness of 256 ml CSF (Table 2)). The benefits of adding a...

  12. Motivational and Cognitive Test-Taking Strategies and Their Influence on Test Performance in Mathematics

    Science.gov (United States)

    Peng, Yun; Hong, Eunsook; Mason, Elsa

    2014-01-01

    A structural equation model of relationships among testing-related motivation variables (test value, effort, self-efficacy, and test anxiety), test-taking strategies (test tactics and metacognitive strategies), gender, and math test performance were examined with a sample of 10th graders (N = 438; 182 males and 256 females). In general, motivation…

  13. The genetics of phytate content and morphological traits in Brassica rapa

    NARCIS (Netherlands)

    Jianjun Zhao, Jianjun

    2007-01-01

    In this thesis molecular genetic studies on Brassica rapa are described based on a collection of 256 accessions and 6 segregating populations. In chapter 2 and 3 the genetic variation and population structure are characterized in a set of genotypes from different geographical origins representing

  14. Competence, Reticence and Helping by Children and Adolescents.

    Science.gov (United States)

    Midlarsky, Elizabeth

    Considerable attention has been paid to the question of whether altruism increases with age through the years of childhood and early adolescence. The relationship between age and helping was examined for 128 boys and 128 girls in the first experiment. A second sample of an additional 256 participants was then studied to investigate factors which…

  15. ()tolaryngological Manifestations of HI V/ AIDS : A Review

    African Journals Online (AJOL)

    Otolaryngol Clin North Am 1992; 25(6): 1147-. 1 1 5 8. 5. Riederer AP, Grein GO and Bogner JR. High prevalence of opportunistic infections in the head and neck related to human immunodeficiency ofotorhinolaryngologic disorders in 250 patients. Infection. 1996; 24(6): 44o44s. ' 6.. Karsten M and Goldberg A N. HIV and.

  16. Development of Shyness: Relations with Children's Fearfulness, Sex, and Maternal Behavior

    Science.gov (United States)

    Eggum, Natalie D.; Eisenberg, Nancy; Spinrad, Tracy L.; Reiser, Mark; Gaertner, Bridget M.; Sallquist, Julie; Smith, Cynthia L.

    2009-01-01

    The relations of childhood fearfulness (observed and adult reported) and adult-reported shyness at 18 (n = 256) and 30 (n = 230) months of age were assessed. Fear was positively related to shyness concurrently and longitudinally, but slightly more consistently at 18 months. The moderating roles of observed maternal sensitivity and children's sex…

  17. The Pattern of Cardiac Diseases at the Cardiac Clinic of Jimma ...

    African Journals Online (AJOL)

    RESULTS: Rheumatic heart disease was the diagnosis in 256 (32.8%) of the cardiac cases on follow-up followed by hypertensive heart disease and cardiomyopathy accounting for 189 (24.2%) and 158 (20.2%) of cases, respectively. Among Rheumatic heart disease patients; male to female ratio was 0.86:1 and the mean ...

  18. 75 FR 21045 - Notice of intent to grant exclusive license

    Science.gov (United States)

    2010-04-22

    ... Application No. 12/ 558,319 ``Moving-Article X-Ray Imaging System and Method for 3-D Image Generation'' to GaN..., (256) 544-0013. FOR FURTHER INFORMATION CONTACT: Sammy A. Nabors, Technology Transfer Program Office... inventions available for licensing can be found online at http://technology.nasa.gov . Dated: April 15, 2010...

  19. Download this PDF file

    African Journals Online (AJOL)

    PROF. MADUKWE

    Climate Change Information Needs of Pineapple Farmers in Enugu State, ... burning (M=2.56) and avoidance of deforestation (M=2.29) were respondents major ... and these groups will accordingly be most vulnerable to climate change ( United .... human beings contribution to climate change and prediction of stopping of ...

  20. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ravikumar. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 231-256. Dynamic pricing models for electronic business · Y Narahari C V L Raju K Ravikumar Sourabh Shah · More Details Abstract Fulltext PDF. Dynamic pricing is the dynamic adjustment of prices to consumers ...

  1. Mechanical performance of hemp fiber polypropylene composites at different operating temperatures

    Science.gov (United States)

    Mehdi Tajvidi; Nazanin Motie; Ghonche Rassam; Robert H. Falk; Colin Felton

    2010-01-01

    In order to quantify the effect of temperature on the mechanical properties of hemp fiber polypropylene composites, formulations containing 25% and 40% (by weight) hemp fiber were produced and tested at three representative temperatures of 256, 296, and 336 K. Flexural, tensile, and impact tests, as well as dynamic mechanical analysis, were performed and the reduction...

  2. 75 FR 15642 - Schedules of Controlled Substances: Exempted Prescription Product; River Edge Pharmaceutical...

    Science.gov (United States)

    2010-03-30

    ... Prescription Product; River Edge Pharmaceutical, Servira AGENCY: Drug Enforcement Administration (DEA... one new application for exemption for River Edge Pharmaceutical's Servira . Having reviewed this... Pharmaceutical's Servira (NDC Code 68032-256) tablets containing 48.6 mg phenobarbital in combination with...

  3. Power, Status and Network Perceptions: The Effects of Network Bias on Organizational Outcomes

    Science.gov (United States)

    2012-09-01

    to have achieved. Extending social comparison theory ( Festinger 1954) and cognitive network comparison research (e.g., Burt 1982) to this case, we...Faust, K. 2007. Very local structure in social networks. Sociological Methodology. 37 209-256. Festinger , L. 1954. A theory of social comparison

  4. Undergraduate students' perception and Utilization of electronic ...

    African Journals Online (AJOL)

    The finding revealed that 25.6% of the respondents became aware of the availability of e-library resources and services during orientation programme for fresh students. On the perception of electronic resources and services by undergraduate students' the finding revealed a mix of positive and negative perception.

  5. Effect of sodium adsorption ratio and electric conductivity of the ...

    African Journals Online (AJOL)

    1Agricultural Engineering Research Institute (AEnRI), Agricultural Research Centre, P.O. Box 256, Giza, Egypt. 2Shaqra University ... 3Department of Agricultural Engineering, College of Food and Agriculture Sciences King Saud University, Riyadh 11451, Saudi Arabia .... e-mail: elmarazky58@gmail.com. Received 2 May ...

  6. Effect Of Different Intesties Of Semen Collection And Biochemical ...

    African Journals Online (AJOL)

    The effect of different intensities of semen collection on semen characteristics, cations and fructose concentrations of the seminal plasma in West African dwarf bucks was studied. Twelve clinically healthy and matured bucks weighing between 25.6 – 35.7 kg were randomly allocated to four treatment groups in a completely ...

  7. Identification of Phytophthora sojae genes involved in asexual ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 88; Issue 2 ... Research Article Volume 88 Issue 2 August 2009 pp 141-148 ... whereas the transcripts of phosphatidylinositol-4-phosphate 5-kinase (UB36), FAD-dependent pyridine nucleotide-disulphide oxidoreductase (UB226) and sugar transporter (UB256) were expressed ...

  8. Gclust Server: 44449 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 44449 DPTM_GSPATP00001481001 Cluster Sequences Related Sequences(58) 256 no annotation 2 1.00e-99 0.0...0 11.11 0.0 0.0 0.0 0.0 Show 44449 Cluster ID 44449 Sequence ID DPTM_GSPATP00001481001 Link to cluster

  9. Gclust Server: 177444 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 177444 Bja_bll2004 Cluster Sequences - 256 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show...Show 177444 Cluster ID 177444 Sequence ID Bja_bll2004 Link to cluster sequences Cluster Sequences Link

  10. EST Table: FY035903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available /04 41 %/256 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber protein 2 (Out...er dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] FS892927 bmte ...

  11. Ye Shakoch Chilot (the court of the sheikhs): A traditional institution ...

    African Journals Online (AJOL)

    Traditional institutions of conflict resolution play a very significant role in ... alternative institutions of conflict resolution in a country where the state legal ...... 228–256. Gluckman, Max 1965. The ideas in Barotse jurisprudence. Manchester, Manchester University. Press. Gopin, Marc 1997. Religion violence and conflict ...

  12. e-Learning Continuance Intention: Moderating Effects of User e-Learning Experience

    Science.gov (United States)

    Lin, Kan-Min

    2011-01-01

    This study explores the determinants of the e-learning continuance intention of users with different levels of e-learning experience and examines the moderating effects of e-learning experience on the relationships among the determinants. The research hypotheses are empirically validated using the responses received from a survey of 256 users. The…

  13. immunological arthritis Prevalence of biochemical and abnormalities ...

    African Journals Online (AJOL)

    1991-02-02

    Feb 2, 1991 ... Tile prevalence of biochemical and immunological abnormali- ties was studied in a group of 256 patients with rheumatoid arthritis (104 coloureds, 100 whites and 52 blacks). The most common biochemical abnormalities detected were a reduction in the serum creatinine value (43,4%), raised globulins (39 ...

  14. Prevalence of biochemical and immunological abnormalities in ...

    African Journals Online (AJOL)

    Tile prevalence of biochemical and immunological abnormalities was studied in a group of 256 patients with rheumatoid arthritis (104 coloureds, 100 whites and 52 blacks). The most common biochemical abnormalities detected were a reduction in the serum creatinine value (43,4%), raised globulins (39,7%), raised serum ...

  15. Boron in seawater of Wadge bank region in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Shirodkar, P.V.; Sankaranarayanan, V.N.

    In the upper 200 m in the Wadge Bank region B varies from 3.09 to 4.95 mg.kg/1. B/Cl ratio ranges from 0.159 to 0.256. Depthwise distribution of B shows its inverse relationship with dissolved oxygen, direct relationship with inorganic phosphate...

  16. Naval Research Reviews. Volume 39, Number 3,

    Science.gov (United States)

    1987-01-01

    Na\\s of the medical applications, possible means for treatment and future as well as to continue its proud record of in\\estment amelioration of \\arious...of Deprivation 18. Buisseret, P. and M. Imbert, "Visual cortical cells. Amblyopia in the Cat," Nature 260:256-257 (1976). Their developmental

  17. Brain MR image segmentation based on an improved active contour model.

    Science.gov (United States)

    Meng, Xiangrui; Gu, Wenya; Chen, Yunjie; Zhang, Jianwei

    2017-01-01

    It is often a difficult task to accurately segment brain magnetic resonance (MR) images with intensity in-homogeneity and noise. This paper introduces a novel level set method for simultaneous brain MR image segmentation and intensity inhomogeneity correction. To reduce the effect of noise, novel anisotropic spatial information, which can preserve more details of edges and corners, is proposed by incorporating the inner relationships among the neighbor pixels. Then the proposed energy function uses the multivariate Student's t-distribution to fit the distribution of the intensities of each tissue. Furthermore, the proposed model utilizes Hidden Markov random fields to model the spatial correlation between neigh-boring pixels/voxels. The means of the multivariate Student's t-distribution can be adaptively estimated by multiplying a bias field to reduce the effect of intensity inhomogeneity. In the end, we reconstructed the energy function to be convex and calculated it by using the Split Bregman method, which allows our framework for random initialization, thereby allowing fully automated applications. Our method can obtain the final result in less than 1 second for 2D image with size 256 × 256 and less than 300 seconds for 3D image with size 256 × 256 × 171. The proposed method was compared to other state-of-the-art segmentation methods using both synthetic and clinical brain MR images and increased the accuracies of the results more than 3%.

  18. A Cross-Cultural Assessment of Three Theories of Pro-Environmental Behavior: A Comparison between Business Students of Chile and the United States

    Science.gov (United States)

    Cordano, Mark; Welcomer, Stephanie; Scherer, Robert F.; Pradenas, Lorena; Parada, Victor

    2011-01-01

    We surveyed business students in the United States (n = 256) and Chile (n = 310) to compare three theories of pro-environmental behavior.We examined Ajzen and Fishbein's theory of reasoned action, Schawartz's norm activation theory, and the values-beliefs-norms theory created by Stern, Dietz, Abel, Guagnano, and Kalof. We produced reliable…

  19. An Examination of Science High School Students' Motivation towards Learning Biology and Their Attitude towards Biology Lessons

    Science.gov (United States)

    Kisoglu, Mustafa

    2018-01-01

    The purpose of this study is to examine motivation of science high school students towards learning biology and their attitude towards biology lessons. The sample of the study consists of 564 high school students (308 females, 256 males) studying at two science high schools in Aksaray, Turkey. In the study, the relational scanning method, which is…

  20. South African Medical Journal - Vol 79, No 3 (1991)

    African Journals Online (AJOL)

    Lupus nephritis Part I. Histopathological classification, activity and chr~nicity scores · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. W.D. Bates, A.M. Halland, R.D. Tribe, D.J. Rossouw, 256-259 ...